BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014L01

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    365   3e-121   Sesamum indicum [beniseed]
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    364   7e-121   Cucumis melo [Oriental melon]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    364   1e-120   Cucumis melo [Oriental melon]
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    363   2e-120   Mesembryanthemum crystallinum
gb|AAN84539.1|  putative plastidic glutamine synthetase                 355   4e-120   Gazania splendens
ref|XP_004167630.1|  PREDICTED: glutamine synthetase leaf isozyme...    355   4e-120   
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    362   5e-120   Sesamum indicum [beniseed]
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    361   1e-119   Nelumbo nucifera [Indian lotus]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    361   2e-119   Eucalyptus grandis [rose gum]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    361   2e-119   Eucalyptus grandis [rose gum]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    360   2e-119   Eucalyptus grandis [rose gum]
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    358   3e-119   Eucalyptus grandis [rose gum]
gb|AIR07818.1|  chloroplastic glutamine synthetase GS2                  354   4e-119   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         360   4e-119   Jatropha curcas
gb|ACF17656.1|  putative glutamine synthase 2                           360   4e-119   Capsicum annuum
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    359   5e-119   Tarenaya hassleriana [spider flower]
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    359   6e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             359   6e-119   Eutrema salsugineum [saltwater cress]
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    359   6e-119   Glycine max [soybeans]
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    359   6e-119   Prunus mume [ume]
gb|ABL89188.2|  plastid glutamine synthetase 2                          359   7e-119   Spinacia oleracea
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        359   7e-119   Glycine soja [wild soybean]
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    359   9e-119   Glycine max [soybeans]
gb|KJB28233.1|  hypothetical protein B456_005G035800                    358   1e-118   Gossypium raimondii
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    358   1e-118   Daucus carota [carrots]
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     358   1e-118   Brassica rapa
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    358   1e-118   Cucumis sativus [cucumbers]
ref|XP_002516801.1|  glutamine synthetase plant, putative               358   2e-118   Ricinus communis
gb|ABY87178.1|  chloroplast glutamine synthetase                        358   2e-118   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    358   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    358   2e-118   Brassica rapa
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    358   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    358   3e-118   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                353   3e-118   Erythranthe guttata [common monkey flower]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             357   4e-118   Prunus persica
gb|ACU24520.1|  unknown                                                 357   4e-118   Glycine max [soybeans]
gb|AAF17703.1|AF031082_1  glutamine synthetase                          357   4e-118   Canavalia lineata
gb|AAN84563.1|  glutamine synthetase                                    357   5e-118   Lotus japonicus
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         357   5e-118   Lotus japonicus
gb|ADK27329.1|  plastid glutamine synthetase                            357   6e-118   Vigna radiata [mung bean]
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        357   6e-118   Gossypium arboreum [tree cotton]
emb|CDO98975.1|  unnamed protein product                                357   7e-118   Coffea canephora [robusta coffee]
ref|NP_198413.1|  glutamine synthetase 2                                357   7e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    357   7e-118   Cicer arietinum [garbanzo]
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    356   8e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    356   8e-118   
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             356   8e-118   
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    356   8e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   9e-118   Vitis vinifera
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             356   9e-118   Phaseolus vulgaris [French bean]
gb|AGV54414.1|  glutamine synthetase                                    356   9e-118   Phaseolus vulgaris [French bean]
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             356   9e-118   Capsella rubella
dbj|BAF62340.1|  glutamine synthetase                                   356   1e-117   Avicennia marina
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   1e-117   Vitis vinifera
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    356   1e-117   
emb|CAA73062.1|  plastidic glutamine synthetase precursor               356   1e-117   Brassica napus [oilseed rape]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     356   1e-117   Vitis vinifera
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   1e-117   Pyrus x bretschneideri [bai li]
emb|CDY33684.1|  BnaC04g29670D                                          357   2e-117   Brassica napus [oilseed rape]
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    355   2e-117   Malus domestica [apple tree]
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    355   2e-117   Medicago sativa [alfalfa]
gb|AAO37651.1|  glutamine synthetase                                    355   2e-117   Medicago truncatula
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     355   2e-117   
gb|KJB37729.1|  hypothetical protein B456_006G218100                    355   2e-117   Gossypium raimondii
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     355   3e-117   Nicotiana sylvestris
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     355   3e-117   Nicotiana tomentosiformis
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    355   4e-117   
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    355   4e-117   Pyrus x bretschneideri [bai li]
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         355   4e-117   Lotus japonicus
gb|AAN84537.1|  putative plastidic glutamine synthetase                 355   4e-117   Crataegus crus-galli
gb|AFH88076.1|  chloroplast glutamine synthetase protein                354   5e-117   Sesuvium portulacastrum [sea-purslane]
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                354   5e-117   Juglans nigra
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                353   9e-117   Erythranthe guttata [common monkey flower]
prf||1601519A  Gln synthetase                                           353   1e-116
gb|AAL67439.1|  glutamine synthetase precursor                          353   2e-116   Lotus japonicus
emb|CAB72423.1|  glutamine synthetase                                   353   2e-116   Brassica napus [oilseed rape]
ref|NP_001237784.1|  glutamine synthetase precursor                     353   2e-116   
emb|CAA29057.1|  gluthamine synthetase                                  350   5e-116   Pisum sativum [garden pea]
gb|AJI44225.1|  plastid glutamine synthetase                            352   5e-116   Boehmeria nivea [Chinese silk-plant]
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    352   6e-116   Pisum sativum [garden pea]
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   352   7e-116   Citrus sinensis [apfelsine]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   351   9e-116   Citrus sinensis [apfelsine]
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   351   1e-115   Citrus sinensis [apfelsine]
gb|ACU18743.1|  unknown                                                 350   1e-115   Glycine max [soybeans]
gb|AJD14836.1|  plastid glutamine synthetase                            350   2e-115   Boehmeria nivea [Chinese silk-plant]
ref|XP_007034566.1|  Glutamine synthetase 2                             353   6e-115   
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             349   7e-115   Citrus clementina [clementine]
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    349   7e-115   Elaeis guineensis
gb|AAN84538.1|  putative plastidic glutamine synthetase                 347   2e-114   Spiraea nipponica
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  347   3e-114   Morus notabilis
ref|XP_002314425.1|  glutamine synthetase family protein                347   6e-114   Populus trichocarpa [western balsam poplar]
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           346   7e-114   Solanum tuberosum [potatoes]
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    346   7e-114   Populus euphratica
ref|XP_002312733.1|  glutamine synthetase family protein                346   8e-114   
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    346   1e-113   Populus euphratica
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    345   2e-113   Fragaria vesca subsp. vesca
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            345   2e-113   Lemna minor
ref|NP_001054133.1|  Os04g0659100                                       345   3e-113   
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    343   5e-113   
dbj|BAD12057.1|  plastidic glutamine synthetase                         343   7e-113   Phragmites australis
gb|ACO59263.1|  chloroplast glutamine synthetase                        339   1e-112   Populus x canadensis [Canadian poplar]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    342   3e-112   
dbj|BAD12059.1|  plastidic glutamine synthetase                         342   4e-112   Phragmites australis
gb|ACG31728.1|  hypothetical protein                                    340   5e-112   Zea mays [maize]
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    342   5e-112   Setaria italica
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      341   5e-112   
gb|ACG35376.1|  glutamine synthetase                                    340   1e-111   Zea mays [maize]
dbj|BAL45315.1|  glutamine synthetase                                   335   2e-111   Boykinia occidentalis
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    343   2e-111   Zea mays [maize]
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        340   2e-111   Medicago truncatula
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          340   3e-111   Amborella trichopoda
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            339   4e-111   Lemna minor
emb|CDY49365.1|  BnaA08g29950D                                          337   2e-110   Brassica napus [oilseed rape]
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     337   2e-110   Brachypodium distachyon [annual false brome]
ref|XP_003594092.1|  Glutamine synthetase                               358   1e-109   
gb|AAX18864.1|  chloroplast glutamine synthetase                        330   2e-109   Glycine max [soybeans]
dbj|BAJ91545.1|  predicted protein                                      334   5e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA34131.1|  unnamed protein product                                333   7e-109   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAK49029.1|  cytosolic glutamine synthetase                          331   7e-109   Populus tremula x Populus alba [gray poplar]
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            333   7e-109   Secale cereale
gb|AAX18865.1|  chloroplast glutamine synthetase                        328   1e-108   Glycine max [soybeans]
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    333   2e-108   Hordeum vulgare [barley]
gb|ACT22500.1|  plastid glutamine synthetase 2                          332   3e-108   Triticum aestivum [Canadian hard winter wheat]
gb|ACT22496.1|  plastid glutamine synthetase 2                          332   4e-108   Triticum aestivum [Canadian hard winter wheat]
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               332   4e-108   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ95492.1|  predicted protein                                      331   6e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               329   4e-107   Triticum aestivum [Canadian hard winter wheat]
dbj|BAG49063.1|  glutamine synthetase                                   323   6e-107   Lactuca sativa [cultivated lettuce]
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        332   8e-107   Triticum urartu
emb|CAA47373.2|  glutamate--ammonia ligase                              328   1e-106   Nicotiana sylvestris
gb|EPS69972.1|  glutamine synthetase                                    319   2e-106   Genlisea aurea
sp|P52783.1|GLNA_PINSY  RecName: Full=Glutamine synthetase cytoso...    325   2e-106   Pinus sylvestris [Scotch pine]
gb|AGC24242.1|  glutamine synthetase 1                                  319   9e-106   Brassica napus [oilseed rape]
gb|EPS57588.1|  glutamine synthetase                                    320   1e-105   Genlisea aurea
gb|AGC24240.1|  glutamine synthetase 1                                  319   1e-105   Brassica napus [oilseed rape]
gb|AGC82199.1|  glutamine synthetase 1                                  319   1e-105   Brassica napus [oilseed rape]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        323   1e-105   Cucumis sativus [cucumbers]
gb|AAA50249.1|  glutamine synthetase                                    317   1e-105   Solanum lycopersicum
ref|XP_010528562.1|  PREDICTED: glutamine synthetase cytosolic is...    321   2e-105   Tarenaya hassleriana [spider flower]
gb|ABK21449.1|  unknown                                                 322   2e-105   Picea sitchensis
gb|AJD14835.1|  glutamine synthetase                                    322   3e-105   Boehmeria nivea [Chinese silk-plant]
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    322   4e-105   Tarenaya hassleriana [spider flower]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               323   5e-105   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             321   5e-105   Cucumis melo [Oriental melon]
emb|CDY38104.1|  BnaC02g06690D                                          321   5e-105   Brassica napus [oilseed rape]
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    321   5e-105   Populus euphratica
gb|AGC24238.1|  glutamine synthetase 1                                  321   5e-105   Brassica napus [oilseed rape]
emb|CAA52448.1|  glutamate--ammonia ligase                              321   6e-105   Pinus sylvestris [Scotch pine]
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    321   7e-105   Brassica rapa
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    321   7e-105   Pyrus x bretschneideri [bai li]
emb|CDO98315.1|  unnamed protein product                                320   8e-105   Coffea canephora [robusta coffee]
ref|XP_003619869.1|  Glutamine synthetase                               320   8e-105   Medicago truncatula
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     320   8e-105   Populus euphratica
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             320   9e-105   
emb|CDY49656.1|  BnaC09g41340D                                          320   9e-105   Brassica napus [oilseed rape]
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     320   1e-104   Tarenaya hassleriana [spider flower]
gb|AGC82204.1|  glutamine synthetase 1                                  316   1e-104   Brassica napus [oilseed rape]
dbj|BAD11327.1|  glutamine synthetase                                   320   1e-104   Camellia sinensis [black tea]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    320   1e-104   Camelina sativa [gold-of-pleasure]
gb|AGC24239.1|  glutamine synthetase 1                                  320   2e-104   Brassica napus [oilseed rape]
ref|XP_008229355.1|  PREDICTED: glutamine synthetase cytosolic is...    319   2e-104   Prunus mume [ume]
emb|CDX69442.1|  BnaA10g17910D                                          320   2e-104   
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            320   2e-104   Populus trichocarpa [western balsam poplar]
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    320   2e-104   Medicago truncatula
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    320   2e-104   Brassica rapa
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme     320   2e-104   Fragaria vesca subsp. vesca
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               320   2e-104   Glycine max [soybeans]
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    320   2e-104   Alnus glutinosa
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    320   2e-104   
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    320   2e-104   
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    319   2e-104   Nelumbo nucifera [Indian lotus]
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    319   2e-104   Medicago sativa [alfalfa]
ref|NP_568335.1|  glutamine synthetase 1;4                              319   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AIK03054.1|  glutamine synthetase                                    319   3e-104   Eichhornia crassipes
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    319   3e-104   Lotus japonicus
emb|CAA73366.1|  glutamine synthetase                                   319   3e-104   Lotus japonicus
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    319   4e-104   Camelina sativa [gold-of-pleasure]
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    319   4e-104   Sesamum indicum [beniseed]
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    318   4e-104   
gb|AIR07816.1|  cytosolic glutamine synthetase 1-1                      317   5e-104   Vitis labrusca x Vitis vinifera [Labruscan grape]
gb|AID48673.1|  theanine synthetase                                     318   5e-104   Camellia oleifera [abura-tsubaki]
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    318   5e-104   Sesamum indicum [beniseed]
dbj|BAM84282.1|  glutamine synthetase                                   318   6e-104   Tulipa humilis var. pulchella
ref|XP_009370556.1|  PREDICTED: glutamine synthetase cytosolic is...    317   6e-104   Pyrus x bretschneideri [bai li]
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           318   6e-104   Vitis vinifera
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               318   6e-104   Glycine max [soybeans]
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    318   6e-104   Populus euphratica
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    318   1e-103   Pyrus x bretschneideri [bai li]
gb|ABK23723.1|  unknown                                                 318   1e-103   Picea sitchensis
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    318   1e-103   Arabis alpina [alpine rockcress]
gb|ABK95973.1|  unknown                                                 318   1e-103   Populus trichocarpa [western balsam poplar]
gb|ABW89464.1|  glutamine synthetase                                    318   1e-103   Gossypium hirsutum [American cotton]
gb|ABW89460.1|  glutamine synthetase                                    318   1e-103   Gossypium herbaceum [Arabian cotton]
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880          318   1e-103   Amborella trichopoda
ref|XP_002318305.1|  glutamine synthetase family protein                318   1e-103   
gb|ABW89463.1|  glutamine synthetase                                    317   1e-103   Gossypium raimondii
gb|ABW89462.1|  glutamine synthetase                                    317   1e-103   Gossypium hirsutum [American cotton]
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    317   1e-103   
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                317   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    317   2e-103   Camelina sativa [gold-of-pleasure]
gb|AAP33167.1|  cytosolic glutamine synthetase                          317   2e-103   Securigera parviflora
ref|XP_008659016.1|  PREDICTED: glutamine synthetase root isozyme...    315   2e-103   Zea mays [maize]
gb|KCW69395.1|  hypothetical protein EUGRSUZ_F02872                     316   2e-103   Eucalyptus grandis [rose gum]
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             317   2e-103   Eutrema salsugineum [saltwater cress]
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            317   2e-103   Populus trichocarpa [western balsam poplar]
gb|AAW21273.1|  glutamine synthetase                                    317   2e-103   Saccharum officinarum [noble cane]
ref|XP_007043312.1|  Glutamine synthetase 1,4                           317   2e-103   
gb|AAP33169.1|  cytosolic glutamine synthetase                          317   2e-103   Securigera parviflora
gb|ACN40288.1|  unknown                                                 317   2e-103   Picea sitchensis
dbj|BAA04995.1|  glutamine synthetase                                   317   2e-103   Raphanus sativus
ref|XP_006391363.1|  hypothetical protein EUTSA_v10018774mg             317   2e-103   
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    317   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD99525.1|  glutamine synthetase                                   317   2e-103   Camellia sinensis [black tea]
gb|AFN42876.1|  glutamine synthetase                                    317   2e-103   Camellia sinensis [black tea]
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    317   2e-103   Citrus sinensis [apfelsine]
dbj|BAM84285.1|  glutamine synthetase                                   317   3e-103   Tulipa fosteriana
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                317   3e-103   Tulipa gesneriana
gb|KDP43303.1|  hypothetical protein JCGZ_24224                         317   3e-103   Jatropha curcas
ref|XP_002888488.1|  ATGSR2                                             317   3e-103   
gb|KCW69394.1|  hypothetical protein EUGRSUZ_F02872                     316   3e-103   Eucalyptus grandis [rose gum]
ref|XP_001755833.1|  predicted protein                                  317   3e-103   
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    317   3e-103   Solanum tuberosum [potatoes]
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               317   3e-103   Nicotiana sylvestris
prf||1804333C  Gln synthetase                                           319   3e-103
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    317   3e-103   Eucalyptus grandis [rose gum]
gb|AIR07817.1|  cytosolic glutamine synthetase 1-2                      315   3e-103   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             316   4e-103   Phaseolus vulgaris [French bean]
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    316   4e-103   Cicer arietinum [garbanzo]
gb|AAR29057.1|  glutamine synthetase 1                                  316   4e-103   Datisca glomerata
emb|CAA73063.1|  cytosolic glutamine synthetase                         316   4e-103   Brassica napus [oilseed rape]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             316   4e-103   Eutrema salsugineum [saltwater cress]
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    316   4e-103   Arabis alpina [alpine rockcress]
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              316   4e-103   Gossypium arboreum [tree cotton]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            319   4e-103
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             316   4e-103   Prunus persica
ref|XP_006374208.1|  glutamine synthetase family protein                316   5e-103   
emb|CAN68162.1|  hypothetical protein VITISV_015673                     316   5e-103   Vitis vinifera
emb|CAA63963.1|  glutamate synthetase                                   316   5e-103   Lotus japonicus
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    316   5e-103   Populus euphratica
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                316   5e-103   Gossypium arboreum [tree cotton]
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    316   5e-103   Oryza brachyantha
emb|CAA06383.1|  glutamine synthetase                                   316   5e-103   Pinus sylvestris [Scotch pine]
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    316   6e-103   Zea mays [maize]
emb|CAJ87510.1|  putative glutamine synthetase                          316   6e-103   Pisum sativum [garden pea]
gb|ABK51388.1|  cytosolic glutamine synthetase                          316   6e-103   Camellia sinensis [black tea]
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               316   6e-103   Solanum lycopersicum
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             316   6e-103   Capsella rubella
emb|CBI33470.3|  unnamed protein product                                316   6e-103   Vitis vinifera
dbj|BAD99526.1|  glutamine synthetase                                   316   7e-103   Camellia sinensis [black tea]
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             318   7e-103   
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    316   7e-103   Setaria italica
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                316   7e-103   
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    315   7e-103   Populus euphratica
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     315   7e-103   Zea mays [maize]
ref|XP_002306385.1|  glutamine synthetase family protein                315   7e-103   Populus trichocarpa [western balsam poplar]
gb|ABW89461.1|  glutamine synthetase                                    315   8e-103   Gossypium hirsutum [American cotton]
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                315   8e-103   Zea mays [maize]
emb|CAA29058.1|  glutamine synthetase                                   312   8e-103   Pisum sativum [garden pea]
gb|AJD14834.1|  glutamine synthetase                                    315   8e-103   Boehmeria nivea [Chinese silk-plant]
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               315   8e-103   Nicotiana tomentosiformis
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    315   9e-103   Oryza sativa Japonica Group [Japonica rice]
gb|ABK94916.1|  unknown                                                 315   9e-103   Populus trichocarpa [western balsam poplar]
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             315   9e-103   Phaseolus vulgaris [French bean]
emb|CCO25538.1|  glutamine synthetase                                   315   9e-103   Pinus pinaster [cluster pine]
gb|ACJ11724.1|  glutamine synthase                                      315   9e-103   Gossypium hirsutum [American cotton]
gb|AGZ15411.1|  glutamine synthetase PR-2                               315   9e-103   Phaseolus vulgaris [French bean]
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     315   1e-102   Phoenix dactylifera
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    315   1e-102   Setaria italica
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    315   1e-102   Brassica rapa
gb|AAB61597.1|  glutamine synthetase                                    315   1e-102   Hevea brasiliensis [jebe]
emb|CAA54151.1|  glutamine                                              315   1e-102   Brassica napus [oilseed rape]
gb|ACR38147.1|  unknown                                                 315   1e-102   Zea mays [maize]
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         315   1e-102   Vitis vinifera
tpg|DAA50997.1|  TPA: glutamine synthetase2                             312   1e-102   
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                315   1e-102   
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    315   1e-102   Zea mays [maize]
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    315   1e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002873784.1|  GLN1_4                                             315   1e-102   
gb|KDP25795.1|  hypothetical protein JCGZ_22517                         315   1e-102   Jatropha curcas
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    317   1e-102   
ref|NP_001049424.1|  Os03g0223400                                       315   1e-102   
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                315   1e-102   
gb|ACF42116.1|  cytosolic glutamine synthetase                          315   1e-102   
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    315   2e-102   
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           315   2e-102   
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                315   2e-102   
gb|ACD13217.1|  glutamine synthetase                                    315   2e-102   
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    315   2e-102   
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    315   2e-102   
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    315   2e-102   
gb|AGI78873.1|  glutamine synthetase                                    314   2e-102   
ref|XP_002310666.1|  glutamine synthetase family protein                314   2e-102   
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    314   2e-102   
gb|AAB03492.1|  cytosolic glutamine synthetase                          314   2e-102   
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    315   2e-102   
ref|NP_176794.1|  glutamine synthetase                                  314   2e-102   
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             314   2e-102   
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    314   2e-102   
gb|AGI78872.1|  glutamine synthetase                                    314   2e-102   
ref|NP_001185327.1|  glutamine synthetase                               315   2e-102   
gb|ABX79672.1|  glutamine synthetase                                    314   2e-102   
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                314   3e-102   
gb|EEC73954.1|  hypothetical protein OsI_08842                          314   3e-102   
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    314   3e-102   
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     314   3e-102   
dbj|BAD94626.1|  glutamate--ammonia ligase                              309   3e-102   
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    314   3e-102   
gb|ACB06727.1|  glutamine synthetase                                    314   3e-102   
gb|AAW21274.1|  glutamine synthetase                                    314   3e-102   
gb|KEH36742.1|  glutamine synthetase domain protein                     315   4e-102   
gb|ACA50923.1|  glutamine synthetase                                    314   4e-102   
gb|AGV07415.1|  glutamine synthetase                                    313   4e-102   
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    313   4e-102   
ref|XP_006828441.1|  hypothetical protein AMTR_s00060p00116070          313   4e-102   
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    313   4e-102   
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    313   4e-102   
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    313   5e-102   
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     313   5e-102   
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    313   5e-102   
ref|NP_001048045.1|  Os02g0735200                                       313   5e-102   
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    313   5e-102   
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    313   5e-102   
gb|ACN26845.1|  unknown                                                 313   5e-102   
gb|KGN51032.1|  Glutamine synthetase                                    313   5e-102   
gb|ACR45960.1|  glutamine synthetase 1b                                 313   6e-102   
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        313   6e-102   
prf||1804333B  Gln synthetase                                           316   6e-102
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    313   7e-102   
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    313   7e-102   
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    315   7e-102   
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    313   7e-102   
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    313   7e-102   
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    313   7e-102   
ref|XP_008781316.1|  PREDICTED: glutamine synthetase cytosolic is...    313   7e-102   
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    313   8e-102   
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    313   9e-102   
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    313   9e-102   
gb|ACF78695.1|  unknown                                                 313   9e-102   
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    313   1e-101   
gb|ACL54769.1|  unknown                                                 313   1e-101   
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     313   1e-101   
dbj|BAE98486.1|  glutamine synthetase like protein                      313   1e-101   
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    313   1e-101   
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    313   1e-101   
emb|CAA58118.1|  glutamate--ammonia ligase                              313   1e-101   
gb|AAW21275.1|  glutamine synthetase                                    313   1e-101   
emb|CAA46723.1|  glutamine synthetase                                   308   1e-101   
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         312   1e-101   
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           312   1e-101   
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          312   1e-101   
gb|AAR86718.1|  glutamine synthetase GS56                               312   1e-101   
tpg|DAA44141.1|  TPA: glutamine synthetase6                             312   1e-101   
ref|XP_010450398.1|  PREDICTED: glutamine synthetase, chloroplast...    306   2e-101   
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    312   2e-101   
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    312   2e-101   
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    312   2e-101   
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    312   2e-101   
tpg|DAA44139.1|  TPA: glutamine synthetase6                             312   2e-101   
gb|AAM63710.1|  glutamine synthetase, putative                          312   2e-101   
gb|AFK48742.1|  unknown                                                 312   2e-101   
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    311   2e-101   
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                311   2e-101   
emb|CAA65173.1|  glutamine synthetase                                   311   3e-101   
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    311   3e-101   
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    311   3e-101   
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    311   3e-101   
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               311   3e-101   
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     311   3e-101   
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               311   3e-101   
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    311   4e-101   
gb|AAK08103.1|AF338444_1  glutamine synthetase                          311   4e-101   
ref|NP_001268104.1|  glutamine synthetase                               311   4e-101   
ref|XP_003600702.1|  Glutamine synthetase                               311   5e-101   
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    311   5e-101   
emb|CAA71317.1|  glutamine synthetase                                   311   5e-101   
ref|NP_198576.1|  glutamine synthetase 1;1                              311   5e-101   
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    311   6e-101   
gb|ABU45501.1|  cytosolic glutamine synthetase                          310   6e-101   
sp|O22504.1|GLNA1_DAUCA  RecName: Full=Glutamine synthetase cytos...    310   7e-101   
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                310   7e-101   
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     310   7e-101   
ref|XP_002870545.1|  ATGSR1                                             310   7e-101   
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    310   7e-101   
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     310   7e-101   
dbj|BAL45318.1|  glutamine synthetase                                   306   8e-101   
gb|ACR45959.1|  glutamine synthetase 1a                                 310   8e-101   
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    310   9e-101   
ref|XP_006405854.1|  hypothetical protein EUTSA_v10027817mg             309   9e-101   
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              310   1e-100   
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             310   1e-100   
ref|XP_002989575.1|  hypothetical protein SELMODRAFT_184683             310   1e-100   
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     310   1e-100   
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             310   1e-100   
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    310   1e-100   
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    310   1e-100   
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    310   1e-100   
gb|KJB79890.1|  hypothetical protein B456_013G070600                    310   1e-100   
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         310   1e-100   
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             310   2e-100   
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             310   2e-100   
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             310   2e-100   
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    309   2e-100   
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    309   2e-100   
gb|AFP20991.1|  glutamine synthetase isozyme                            309   2e-100   
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             310   2e-100   
dbj|BAL45347.1|  glutamine synthetase                                   305   2e-100   
gb|KJB79891.1|  hypothetical protein B456_013G070600                    309   2e-100   
gb|AFB69880.1|  glutamine synthetase isoform 1r                         309   2e-100   
ref|XP_001782920.1|  predicted protein                                  309   2e-100   
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    309   2e-100   
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    309   2e-100   
gb|AAR29058.1|  glutamine synthetase 2                                  307   2e-100   
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730          309   2e-100   
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               309   3e-100   
dbj|BAL45316.1|  glutamine synthetase                                   305   3e-100   
dbj|BAL45353.1|  glutamine synthetase                                   305   3e-100   
dbj|BAL45319.1|  glutamine synthetase                                   305   3e-100   
dbj|BAL45327.1|  glutamine synthetase                                   305   3e-100   
ref|XP_002964238.1|  hypothetical protein SELMODRAFT_82032              311   3e-100   
dbj|BAL45337.1|  glutamine synthetase                                   305   3e-100   
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    309   3e-100   
ref|NP_001051067.1|  Os03g0712800                                       309   3e-100   
dbj|BAL45339.1|  glutamine synthetase                                   305   3e-100   
dbj|BAL45325.1|  glutamine synthetase                                   305   4e-100   
gb|KJB43163.1|  hypothetical protein B456_007G187300                    308   4e-100   
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      308   4e-100   
gb|AAD52008.1|  cytosolic glutamine synthetase                          308   5e-100   
gb|AGG19203.1|  glutamine synthetase                                    308   5e-100   
ref|XP_001782914.1|  predicted protein                                  308   5e-100   
emb|CAA73064.1|  cytosolic glutamine synthetase                         308   5e-100   
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    308   5e-100   
gb|AAP33168.1|  cytosolic glutamine synthetase                          306   6e-100   
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     308   6e-100   
emb|CDP01645.1|  unnamed protein product                                308   6e-100   
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    308   7e-100   
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       308   7e-100   
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    308   7e-100   
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    308   8e-100   
gb|AGT16433.1|  glutamine synthetase                                    308   8e-100   
gb|KDO52771.1|  hypothetical protein CISIN_1g018391mg                   305   8e-100   
dbj|BAA04996.1|  glutamine synthetase                                   308   9e-100   
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                308   9e-100   
dbj|BAL45335.1|  glutamine synthetase                                   304   1e-99    
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    308   1e-99    
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    307   1e-99    
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    307   1e-99    
dbj|BAL45333.1|  glutamine synthetase                                   303   1e-99    
ref|XP_006437562.1|  hypothetical protein CICLE_v10031939mg             304   1e-99    
gb|EMT12639.1|  Glutamine synthetase                                    307   1e-99    
gb|AAT39510.1|  glutamine synthetase                                    307   1e-99    
gb|AEH16645.1|  glutamine synthetase                                    307   1e-99    
gb|ABF06665.1|  glutamine synthetase                                    307   1e-99    
dbj|BAL45352.1|  glutamine synthetase                                   303   1e-99    
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         307   1e-99    
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  307   1e-99    
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             307   2e-99    
dbj|BAK01909.1|  predicted protein                                      307   2e-99    
dbj|BAL45317.1|  glutamine synthetase                                   303   2e-99    
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       307   2e-99    
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       307   2e-99    
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       306   2e-99    
dbj|BAL45326.1|  glutamine synthetase                                   303   3e-99    
gb|EEC76061.1|  hypothetical protein OsI_13264                          307   3e-99    
ref|XP_006437564.1|  hypothetical protein CICLE_v10031939mg             305   3e-99    
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              306   3e-99    
gb|AEM42903.1|  cytosolic glutamine synthetase isoform                  306   3e-99    
gb|AAB71692.1|  cytosolic glutamine synthetase                          303   4e-99    
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      306   4e-99    
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    306   4e-99    
ref|XP_006484548.1|  PREDICTED: glutamine synthetase nodule isozy...    306   5e-99    
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    306   5e-99    
ref|NP_001105444.1|  glutamine synthetase root isozyme 4                306   6e-99    
ref|XP_006437563.1|  hypothetical protein CICLE_v10031939mg             306   6e-99    
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     306   6e-99    
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    309   6e-99    
dbj|BAL45322.1|  glutamine synthetase                                   301   6e-99    
gb|AGV54248.1|  glutamine synthetase                                    305   8e-99    
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              305   9e-99    
gb|AAR84349.1|  glutamine synthetase isoform GSe1                       305   1e-98    
ref|XP_010549036.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    306   1e-98    
dbj|BAL45321.1|  glutamine synthetase                                   302   1e-98    
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    305   1e-98    
ref|XP_009401139.1|  PREDICTED: glutamine synthetase nodule isozy...    305   1e-98    
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    305   1e-98    
gb|EMT08718.1|  Glutamine synthetase cytosolic isozyme 1-3              305   1e-98    
gb|ACU19484.1|  unknown                                                 304   2e-98    
gb|AAR84348.1|  glutamine synthetase isoform GSr2                       304   2e-98    
gb|AAG40237.2|  glutamine synthetase GS1                                304   2e-98    
gb|EMS45858.1|  Glutamine synthetase cytosolic isozyme 1-3              304   3e-98    
gb|EMS46544.1|  Glutamine synthetase cytosolic isozyme 1-2              305   3e-98    
gb|EMT23121.1|  Glutamine synthetase cytosolic isozyme 1-2              305   3e-98    
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        304   3e-98    
gb|AFX60877.1|  glutamine synthetase isoform GS1_3                      303   4e-98    
gb|AGW24651.1|  cytosolic glutamine synthetase                          303   5e-98    
gb|AGW24652.1|  cytosolic glutamine synthetase                          303   5e-98    
ref|XP_002527139.1|  glutamine synthetase plant, putative               303   7e-98    
gb|AAR84350.1|  glutamine synthetase isoform GSe2                       303   7e-98    
gb|AEM42901.1|  cytosolic glutamine synthetase isoform                  303   1e-97    
dbj|BAL45320.1|  glutamine synthetase                                   298   1e-97    
ref|XP_010231134.1|  PREDICTED: glutamine synthetase cytosolic is...    302   2e-97    



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/189 (96%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   364 bits (935),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   364 bits (934),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARYILERITEQ 
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYILERITEQV  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  290  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKDHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLA
Sbjct  350  ERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKAGKGYLEDRRPASNMDPYVVTGLLA  409

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  410  ETTLLWEPT  418



>gb|AAN84539.1| putative plastidic glutamine synthetase, partial [Gazania splendens]
Length=224

 Score =   355 bits (910),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  21   RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  80

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST +MRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  81   GVVLTLDPKPIDGDWNGAGCHTNYSTLAMREDGGFEVIKKAILNLSLRHMEHISAYGEGN  140

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY VT LLA
Sbjct  141  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKAGKGYLEDRRPASNMDPYTVTGLLA  200

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  201  ETTLLWEPT  209



>ref|XP_004167630.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Cucumis sativus]
Length=249

 Score =   355 bits (912),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  46   RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  105

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  106  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  165

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  166  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  225

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  226  ETTLLWEPT  234



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   362 bits (929),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  226  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAI NLSLRH++HISAYGEGN
Sbjct  286  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIFNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  346  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYIVTSLLA  405

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  406  ETTILWEPT  414



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   361 bits (927),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLY+GINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYSGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ 
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQT  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ 
Sbjct  235  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQI  294

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  295  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  354

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  355  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  414

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  415  ETTLLWEPT  423



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ 
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQI  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_010041423.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X2 [Eucalyptus grandis]
Length=369

 Score =   358 bits (918),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RY+LERITEQ 
Sbjct  166  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYLLERITEQT  225

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  226  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  285

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  286  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  345

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  346  ETTLLWEPT  354



>gb|AIR07818.1| chloroplastic glutamine synthetase GS2, partial [Vitis labrusca 
x Vitis vinifera]
Length=273

 Score =   354 bits (909),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  70   RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  129

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GG+E+IKKAILNLSLRH++HISAYGEGN
Sbjct  130  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYELIKKAILNLSLRHKEHISAYGEGN  189

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCS+RVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  190  ERRLTGKHETANINTFSWGVANRGCSVRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  249

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  250  ETTILWEPT  258



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GG+EVIKKAILNLSLRHR+HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHREHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   360 bits (923),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYST SMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  231  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  290

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GG+EVIKKAILNLSLRH++HISAYGEGN
Sbjct  291  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHKEHISAYGEGN  350

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  351  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYVVTSLLA  410

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  411  ETTLLWEPT  419



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGG+EVIKKAILNLSLRH DHISAYGEGN
Sbjct  290  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEVIKKAILNLSLRHMDHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVV +LLA
Sbjct  350  ERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVISLLA  409

Query  265  ettlLWQPT  239
            ETT+LWQPT
Sbjct  410  ETTILWQPT  418



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   359 bits (921),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  223  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  282

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  283  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHMEHISAYGEGN  342

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  343  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  402

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  403  ETTLLWEPT  411



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 180/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH DHISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHTDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+SDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQ 
Sbjct  228  RDVSDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQI  287

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV+TLDPKPIEGDWNGAG HTNYSTK+MREEGGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  288  GVVMTLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEVIKKAILNLSLRHKDHISAYGEGN  347

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  348  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLA  407

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  408  ETTILWEPT  416



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   359 bits (922),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  231  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  290

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  291  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  350

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  351  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  410

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  411  ETTLLWEPT  419



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   359 bits (921),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  228  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  287

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  288  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  347

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  348  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  407

Query  265  ettlLWQPT  239
            ETTLL++PT
Sbjct  408  ETTLLYEPT  416



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIDGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVA+RGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDSFSWGVADRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  404

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  405  ETTLLWEPT  413



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GV+LTLDPKPIEGDWNGAG HTNYSTKSMR+EGG+EVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVILTLDPKPIEGDWNGAGCHTNYSTKSMRDEGGYEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  404

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  405  ETTLLWEPT  413



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GV+L+LDPKPIEGDWNGAG HTN+STKSMREEGG+EVIKKAILNLSLRH DHISAYGEGN
Sbjct  290  GVILSLDPKPIEGDWNGAGCHTNFSTKSMREEGGYEVIKKAILNLSLRHMDHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  350  ERRLTGKHETANINTFSWGVANRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLA  409

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  410  ETTILWQPS  418



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGF+VIKKAILNLSLRH +HISAYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFDVIKKAILNLSLRHMEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  404

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  405  ETTLLWEPT  413



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 188/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  231  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  290

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMR++GG+EVIKKAILNLSLRH++HISAYGEGN
Sbjct  291  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMRDDGGYEVIKKAILNLSLRHKEHISAYGEGN  350

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  351  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  410

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  411  ETTILWEPT  419



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  228  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  287

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTK+MRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  288  GVVLTLDPKPIEGDWNGAGCHTNYSTKTMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  347

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA I+TFSWGVANRGCSIRVGRDTEK GKGY+EDRRPASNMDPYVVT LLA
Sbjct  348  ERRLTGKHETADIDTFSWGVANRGCSIRVGRDTEKEGKGYMEDRRPASNMDPYVVTGLLA  407

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  408  ESTLLWEPT  416



>gb|EYU43846.1| hypothetical protein MIMGU_mgv1a010285mg [Erythranthe guttata]
Length=317

 Score =   353 bits (907),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  130  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  189

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAI NLSLRH++HISAYGEGN
Sbjct  190  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIYNLSLRHKEHISAYGEGN  249

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  250  ERRLTGKHETASIDKFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  309

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  310  ETTLLWKP  317



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITE+A
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEEA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH DHISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHTDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPAS+MDPYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASSMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIW ARYILERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWAARYILERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH DHI AYGEGN
Sbjct  287  GVVLSLDPKPIQGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHSDHIRAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  347  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG+HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  347  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG+HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  347  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   357 bits (915),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  406  ETTLLWEPT  414



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   357 bits (915),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   357 bits (915),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GG+E IKKAIL+LSLRH+DHISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEKIKKAILSLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGR+TEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETADINTFSWGVANRGCSIRVGRETEKNGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   357 bits (915),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  347  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   357 bits (915),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKVHIEAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY VTALLA
Sbjct  347  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYTVTALLA  406

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  407  ESTLLWEPT  415



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  347  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  215  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  274

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  275  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  334

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  335  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  394

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  395  ETTLLWEPT  403



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  226  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  346  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  405

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  406  ETTLLWEPT  414



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   356 bits (914),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  347  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GG+E+IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGYELIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCS+RVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETANINTFSWGVANRGCSVRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  406  ESTLLWEPT  414



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  406  ESTLLWEPT  414



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   356 bits (914),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  226  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  346  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  405

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  406  ETTLLWEPT  414



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLY+GINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWC+RY+LERITEQA
Sbjct  229  RDISDAHYKACLYSGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCSRYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGG EVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGLEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+I+TFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETANIDTFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  290  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHEVHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  350  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  409

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  410  ETTILWEPT  418



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGI+AGDH+WCARY+LERITEQA
Sbjct  238  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIDAGDHVWCARYLLERITEQA  297

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  298  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  357

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  358  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLA  417

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  418  ETTLLWEPT  426



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGF+VIKK ILNLSLRH +HISAYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFDVIKKDILNLSLRHMEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  404

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  405  ETTLLWEPT  413



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  290  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHEVHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  350  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  409

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  410  ETTILWEPT  418



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   356 bits (913),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHGEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  286  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  345

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  346  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGN  405

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  406  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  465

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  466  ETTLLWEPT  474



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHGEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHIEAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  345  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  404

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  405  ESTLLWEPT  413



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  345  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  404

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  405  ESTLLWEPT  413



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIE GDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEGGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYST SMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 187/189 (99%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYST SMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDKFSWGVANRGASIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYST SMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPYVVT LLA
Sbjct  349  ERRLTGKHETASIDKFSWGVANRGASIRVGRDTEKQGKGYLEDRRPASNMDPYVVTGLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHGEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHVEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/189 (95%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYHLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG+HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  347  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   355 bits (910),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHVEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQ 
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQV  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG+HTNYSTKSMRE+GGFEVIKKAILN S RH +HISAYGEGN
Sbjct  290  GVVLTLDPKPIEGDWNGAGAHTNYSTKSMREDGGFEVIKKAILNPSPRHTEHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPYVVTALLA
Sbjct  350  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYVVTALLA  409

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  410  ETTILWEPT  418



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGD NGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDRNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   353 bits (906),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAI NLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIHNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  349  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  408

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  409  ETTLLWDP  416



>prf||1601519A Gln synthetase
Length=429

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACL+AGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKACLFAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  286  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKEHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGK ETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGKMETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  406  ESTLLWEPT  414



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGP VGIEAGDHIW +RY+LERIT QA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPXVGIEAGDHIWASRYLLERITXQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG+HTNYSTKSMREEGGFEVIKKAILNLSLRH+DHI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGAHTNYSTKSMREEGGFEVIKKAILNLSLRHQDHIRAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  347  ERRLTGKHETADINTFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPYVVTALLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSV IEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVRIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HI AYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHIIAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLA  404

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  405  ETTLLWEPT  413



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGT GEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTIGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRP SNMDPYV T+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPTSNMDPYVATSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   350 bits (897),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  170  RDISDAHYKACIYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  229

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  230  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGN  289

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASIN FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  290  ERRLTGKHETASINDFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  349

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  350  ESTLLWEPT  358



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   352 bits (902),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWMSRYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTN+STK+MRE+GG+E IKKAILNLSLRH+DHISAYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNFSTKTMREDGGYEAIKKAILNLSLRHKDHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPY+VT+LLA
Sbjct  347  ERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYIVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW PT
Sbjct  407  ETTLLWAPT  415



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   352 bits (902),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 176/189 (93%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  227  RDISDAHYKACIYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASIN FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  347  ERRLTGKHETASINDFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  406

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  407  ESTLLWEPT  415



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQA
Sbjct  229  RDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   351 bits (900),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQA
Sbjct  225  RDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  285  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  345  ERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  404

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  405  ETTILWEPT  413



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQA
Sbjct  239  RDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQA  298

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  299  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYETIKKAILNLSLRHKEHISAYGEGN  358

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  359  ERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  418

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  419  ETTILWEPT  427



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   350 bits (899),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 175/189 (93%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLS RH+DHISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSPRHKDHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+T+K+GKGYLEDRRPASNM+PYVVT+LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRNTKKNGKGYLEDRRPASNMNPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  409  ETTLLWEPT  417



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQA
Sbjct  227  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWMSRYLLERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTN+STK+MRE+GG+E IKKAILNLSLRH+DHISAYGEGN
Sbjct  287  GVVLTLDPKPIEGDWNGAGCHTNFSTKTMREDGGYEAIKKAILNLSLRHKDHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  347  ERRLTGKHETASIDSFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYIVTSLLA  406

Query  265  ettlLWQPT  239
            ETTLLW PT
Sbjct  407  ETTLLWAPT  415



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   353 bits (906),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINI GTNGEVMPGQWE+QVGPSVGIEAGDHIWC+RYILERITEQA
Sbjct  346  RDISDAHYKACLYAGINIGGTNGEVMPGQWEYQVGPSVGIEAGDHIWCSRYILERITEQA  405

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GG+EVIKKAILNLSLRH++HISAYGEGN
Sbjct  406  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGYEVIKKAILNLSLRHQEHISAYGEGN  465

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVV +LLA
Sbjct  466  ERRLTGKHETASIDTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVISLLA  525

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  526  ETTILYEPT  534



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI+DAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RY+LERITEQA
Sbjct  229  RDIADAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKS REEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKSTREEGGYETIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI++FSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   349 bits (895),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 169/189 (89%), Positives = 186/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIE+GDHIWC+RYILERITEQA
Sbjct  231  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIESGDHIWCSRYILERITEQA  290

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTN+STK MRE+GG+EVIKKA+LNLSLRH++HISAYGEGN
Sbjct  291  GVVLSLDPKPIEGDWNGAGCHTNFSTKRMREDGGYEVIKKAVLNLSLRHKEHISAYGEGN  350

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCSIRVGR+TE+ GKGYLEDRRPASNMDPYVVT++LA
Sbjct  351  ERRLTGKHETANINTFSWGVANRGCSIRVGRETERRGKGYLEDRRPASNMDPYVVTSMLA  410

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  411  ETTILWEPT  419



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 181/187 (97%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAI  LSLRH++HISAYGEGN
Sbjct  289  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAIHKLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT LLA
Sbjct  349  ERRLTGKHETASINTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTGLLA  408

Query  265  ettlLWQ  245
            ETTLLW+
Sbjct  409  ETTLLWE  415



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  230  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  289

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTN+STKSMRE+GG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  290  GVVLSLDPKPIEGDWNGAGCHTNFSTKSMREDGGYEAIKKAILNLSLRHKEHISAYGEGN  349

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  350  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  409

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  410  ETTLLWEPT  418



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACMYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGGFE IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEAIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+VT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   346 bits (888),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIE GDHIWCARY+LERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEGGDHIWCARYLLERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYST S+REEGGFEVIKKAILNLSLRH+ HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTLSIREEGGFEVIKKAILNLSLRHKGHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+ FSWGVANRGCSIRVGR TEK  +GYLEDRRPASNMDPYVVTALLA
Sbjct  349  ERRLTGKHETASIDQFSWGVANRGCSIRVGRYTEKEARGYLEDRRPASNMDPYVVTALLA  408

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  409  ETTILWEPT  417



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   346 bits (888),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   346 bits (888),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVTALLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTALLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGG+E IKKAILNLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGYEAIKKAILNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+L++PT
Sbjct  409  ETTILYEPT  417



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  228  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  287

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  288  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  347

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HET +IN FSWGVANRG SIRVGRDTEK GKGYLEDRRPASNMDPY VTALLA
Sbjct  348  ERRLTGLHETQNINKFSWGVANRGASIRVGRDTEKEGKGYLEDRRPASNMDPYTVTALLA  407

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  408  ETTILWEPT  416



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGIDAGDHIWVSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGGFEVIKKA++NLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEVIKKAVVNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCS+RVGR+TEK GKGY+EDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETANINTFSWGVANRGCSVRVGRETEKEGKGYMEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+P+
Sbjct  409  ETTILWEPS  417



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   345 bits (884),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/189 (92%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  285  GVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPYVVTALLA
Sbjct  345  ERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYVVTALLA  404

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  405  ETTILWEPT  413



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   343 bits (881),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/189 (92%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  207  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  266

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  267  GVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGN  326

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  327  ERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAQGKGYLEDRRPASNMDPYVVTSLLA  386

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  387  ETTILWEPT  395



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G+VLTLDPKPI+GDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  286  GIVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  406  ETTILWEPT  414



>gb|ACO59263.1| chloroplast glutamine synthetase [Populus x canadensis]
 gb|ACT83378.1| chloroplast glutamine synthetase [Populus sp. FZ-2009]
Length=316

 Score =   339 bits (870),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKAC+YAGINISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  136  RDISDAHYKACMYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHIWISRYILERITEQA  195

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MREEGGFE IKKAILNL LRH++HISAYGEGN
Sbjct  196  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREEGGFEAIKKAILNLPLRHKEHISAYGEGN  255

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPY+V
Sbjct  256  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYIV  310



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  220  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  279

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFE IK+AILNLSLRH  HISAYGEGN
Sbjct  280  GVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGN  339

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLA
Sbjct  340  ERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLA  399

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  400  ETTILWQPS  408



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/189 (91%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYK CLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  226  RDISDAHYKPCLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  285

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  286  GVVLTLDPKPIQGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHDLHISAYGEGN  345

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  346  ERRLTGLHETASIDNFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYVVTSLLA  405

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  406  ETTILWEPT  414



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   340 bits (872),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  179  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  238

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFE IK+AILNLSLRH  HISAYGEGN
Sbjct  239  GVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGN  298

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VT LLA
Sbjct  299  ERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTGLLA  358

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  359  ETTILWQPS  367



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI GDWNGAG HTNYSTKSMRE+GGFE+IKKAILNLSLRH  HISAYGEGN
Sbjct  285  GVVLTLDPKPIPGDWNGAGCHTNYSTKSMREDGGFELIKKAILNLSLRHDLHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLA
Sbjct  345  ERRLTGLHETASIDTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLA  404

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  405  ETTILWEPT  413



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  220  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  279

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFE IK+AILNLSLRH  HISAYGEGN
Sbjct  280  GVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGN  339

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLA
Sbjct  340  ERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLA  399

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  400  ETTILWQPS  408



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 179/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  224  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFE IK+AILNLSLRH  HISAYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VT LLA
Sbjct  344  ERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTGLLA  403

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  404  ETTILWQPS  412



>dbj|BAL45315.1| glutamine synthetase, partial [Boykinia occidentalis]
Length=274

 Score =   335 bits (858),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGIN+SGTNGEVMPGQWE+QVGPSVGI+AGDHIWC+RYILERITEQA
Sbjct  105  RDISDAHYKACLYAGINVSGTNGEVMPGQWEYQVGPSVGIDAGDHIWCSRYILERITEQA  164

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGGFEVIKKAILNLSLRH++HISAYGEGN
Sbjct  165  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGFEVIKKAILNLSLRHKEHISAYGEGN  224

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNM  296
            ERRLTGKHETASIN FSWGVANRGCS+RVGR+TE+ GKGYLEDRRPASNM
Sbjct  225  ERRLTGKHETASINQFSWGVANRGCSVRVGRETEQQGKGYLEDRRPASNM  274



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  309  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWISRYILERITEQA  368

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFE IK+AILNLSLRH  HISAYGEGN
Sbjct  369  GVVLTLDPKPIQGDWNGAGCHTNYSTKTMREDGGFEEIKRAILNLSLRHDLHISAYGEGN  428

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI TFSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY+VT LLA
Sbjct  429  ERRLTGKHETASIGTFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTGLLA  488

Query  265  ettlLWQPT  239
            ETT+LWQP+
Sbjct  489  ETTILWQPS  497



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVG EA DHIW +RYILERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGTEAADHIWASRYILERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ H+ AYGEGN
Sbjct  285  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHMEAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWG+  RGCSIRVGR+TEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  345  ERRLTGKHETASIDTFSWGIGKRGCSIRVGRETEKNGKGYLEDRRPASNMDPYVVTALLA  404

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  405  ESTLLWEPT  413



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGI+AGDH+WC+RY+LERITE A
Sbjct  233  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIDAGDHVWCSRYLLERITEMA  292

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTN+STKSMR+EGG+ VIKKAI NLSLRH++HI AYGEGN
Sbjct  293  GVVLSLDPKPIEGDWNGAGCHTNFSTKSMRDEGGYAVIKKAIRNLSLRHKEHIGAYGEGN  352

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASI+TFSWGVANRGCSIRVGR+TEK GKGYLEDRRPASNMDPYVVT+LLA
Sbjct  353  ERRLTGKHETASIDTFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLA  412

Query  265  ettlLWQPT  239
            ET +L++PT
Sbjct  413  ETAILFEPT  421



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   339 bits (870),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/189 (87%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPS GI+AGDHIW +RYILERITEQA
Sbjct  229  RDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSAGIDAGDHIWVSRYILERITEQA  288

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTK+MRE+GGFE IKKA++NLSLRH++HISAYGEGN
Sbjct  289  GVVLSLDPKPIEGDWNGAGCHTNYSTKTMREDGGFEEIKKAVVNLSLRHKEHISAYGEGN  348

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTFSWGVANRGCS+RVGR+TEK GKGY+EDRRPASNMDPYVVT+LLA
Sbjct  349  ERRLTGKHETANINTFSWGVANRGCSVRVGRETEKEGKGYMEDRRPASNMDPYVVTSLLA  408

Query  265  ettlLWQPT  239
            ETT+LW+P+
Sbjct  409  ETTILWEPS  417



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/168 (95%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDH+WCARY+LERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHVWCARYLLERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH +HISAYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHMEHISAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPAS  302
            ERRLTGKHETASI+ FSWGVANRGCSIRVGRDTEK GKGYLEDRRPAS
Sbjct  345  ERRLTGKHETASIDQFSWGVANRGCSIRVGRDTEKKGKGYLEDRRPAS  392



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKAC+YAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  227  RDISDAHYKACIYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYSTK+MRE+GGFEVIKKAILNLSLRH  HISAYGEGN
Sbjct  287  GVVLTLDPKPIQGDWNGAGCHTNYSTKAMREDGGFEVIKKAILNLSLRHDLHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE +GKGYLEDRRPASNMDPY VTALLA
Sbjct  347  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEANGKGYLEDRRPASNMDPYTVTALLA  406

Query  265  ettlLWQPT  239
            ETTLLW+PT
Sbjct  407  ETTLLWEPT  415



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   358 bits (918),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/189 (94%), Positives = 185/189 (98%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  225  RDISDAHYKACLYAGINISGTNGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  284

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ HI AYGEGN
Sbjct  285  GVVLTLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKIHIEAYGEGN  344

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  345  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTALLA  404

Query  265  ettlLWQPT  239
            E+TLLW+PT
Sbjct  405  ESTLLWEPT  413


 Score =   341 bits (875),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 180/189 (95%), Gaps = 0/189 (0%)
 Frame = -1

Query  805   RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
             RDISDAHYKACLYAGINISGTN EVMPGQWE+QVGPSVG EA DHIW +RYILERITEQA
Sbjct  1436  RDISDAHYKACLYAGINISGTNAEVMPGQWEYQVGPSVGTEAADHIWASRYILERITEQA  1495

Query  625   GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
             GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+ H+ AYGEGN
Sbjct  1496  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKVHMEAYGEGN  1555

Query  445   ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
             ERRLTGKHETASI+TFSWG+  RGCSIRVGR+TEK+GKGYLEDRRPASNMDPYVVTALLA
Sbjct  1556  ERRLTGKHETASIDTFSWGIGKRGCSIRVGRETEKNGKGYLEDRRPASNMDPYVVTALLA  1615

Query  265   ettlLWQPT  239
             E+TLLW+PT
Sbjct  1616  ESTLLWEPT  1624


 Score = 97.1 bits (240),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 98/181 (54%), Gaps = 56/181 (31%)
 Frame = -1

Query  769  YAGINISGTNGEVMPGQWE---FQVGPSVGIEAGDHIWCARYILERITEQAGVVL-TLDP  602
            +  + I  T+G ++P  ++     +  +  ++ GDHIW +++  +RI +QAGVVL TL+P
Sbjct  848  FKSLEIQSTDGWMVPQVYQQSTRSMAFANSVKDGDHIWASKF--KRIAKQAGVVLLTLNP  905

Query  601  KPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKH  422
            +PIE   NGAG                                 +S   EGNER+LT KH
Sbjct  906  QPIE---NGAG---------------------------------MSGNNEGNERKLTVKH  929

Query  421  ETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQP  242
            ET SINTFSW              TEK+GKGYLEDR   SNMDPYVVT LLAE+TLLW+ 
Sbjct  930  ETVSINTFSW--------------TEKNGKGYLEDRPLVSNMDPYVVTTLLAESTLLWEQ  975

Query  241  T  239
            T
Sbjct  976  T  976



>gb|AAX18864.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   330 bits (845),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/169 (93%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  113  RDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  172

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG +TNYSTKSMRE+GGFEVIKKAILNLSLRH+DHISAYGEGN
Sbjct  173  GVVLSLDPKPIEGDWNGAGCYTNYSTKSMREDGGFEVIKKAILNLSLRHKDHISAYGEGN  232

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASN  299
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASN
Sbjct  233  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASN  281



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   334 bits (857),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  232  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  291

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  292  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  351

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  352  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLA  411

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  412  ETTILWEPT  420



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  223  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  282

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  283  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  342

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  343  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLA  402

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  403  ETTILWEPT  411



>gb|AAK49029.1| cytosolic glutamine synthetase [Populus tremula x Populus alba]
Length=356

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGDHIW ARYILERITEQA
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDHIWAARYILERITEQA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  224  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            E+T+LW+PT
Sbjct  404  ESTILWEPT  412



>gb|AAX18865.1| chloroplast glutamine synthetase, partial [Glycine max]
Length=281

 Score =   328 bits (840),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/169 (93%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWE+QVGPSVGIEAGDHIW +RYILERITEQA
Sbjct  113  RDIVDAHYKACIYAGINISGINGEVMPGQWEYQVGPSVGIEAGDHIWASRYILERITEQA  172

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMRE+GGFEVIKKAILNLSLRH+D ISAYGEGN
Sbjct  173  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREDGGFEVIKKAILNLSLRHKDRISAYGEGN  232

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASN  299
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYLEDRRPASN
Sbjct  233  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKNGKGYLEDRRPASN  281



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/189 (89%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  231  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  290

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  291  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  350

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  351  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYTVTALLA  410

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  411  ETTILWEPT  419



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  224  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  404  ETTILWEPT  412



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   332 bits (850),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  224  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  404  ETTILWEPT  412



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   332 bits (850),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  224  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  404  ETTILWEPT  412



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   331 bits (849),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  232  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  291

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  292  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  351

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGRDTE  GK YLEDRRPASNMDPY VTALLA
Sbjct  352  ERRLTGLHETASISDFSWGVANRGCSIRVGRDTEAKGKRYLEDRRPASNMDPYTVTALLA  411

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  412  ETTILWEPT  420



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/189 (88%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            R ISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  224  RGISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  404  ETTILWEPT  412



>dbj|BAG49063.1| glutamine synthetase [Lactuca sativa]
Length=266

 Score =   323 bits (827),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/161 (96%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARY+LERITEQA
Sbjct  106  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQA  165

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPIEGDWNGAG HTNYST SMREEGGFEVIK+AILNLSLRH DHISAYGEGN
Sbjct  166  GVVLTLDPKPIEGDWNGAGCHTNYSTLSMREEGGFEVIKEAILNLSLRHADHISAYGEGN  225

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYL  323
            ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEK+GKGYL
Sbjct  226  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKAGKGYL  266



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   332 bits (850),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/189 (88%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW +RYILERITEQA
Sbjct  216  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASRYILERITEQA  275

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  276  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  335

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSWGVANRGCSIRVGR+TE  GKGYLEDRRPASNMDPY VTALLA
Sbjct  336  ERRLTGLHETASISDFSWGVANRGCSIRVGRETEAKGKGYLEDRRPASNMDPYTVTALLA  395

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  396  ETTILWEPT  404



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/188 (88%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  802  DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAG  623
            DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERIT QAG
Sbjct  230  DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITGQAG  289

Query  622  VVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNE  443
            VVL+LDPKPIEGDWNGAG HTNYST SMRE+GGFEVIKKA LNLSLRH++HI+AYGEG  
Sbjct  290  VVLSLDPKPIEGDWNGAGCHTNYSTLSMREDGGFEVIKKANLNLSLRHKEHINAYGEGIL  349

Query  442  RRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallae  263
             +LTG HETASI+ FSWGVA RG SIRVG DTEK GKGYLEDRRPASNMDPYVVT LLAE
Sbjct  350  EKLTGNHETASIDKFSWGVAFRGASIRVGADTEKQGKGYLEDRRPASNMDPYVVTGLLAE  409

Query  262  ttlLWQPT  239
            TT+LW+PT
Sbjct  410  TTILWEPT  417



>gb|EPS69972.1| glutamine synthetase, partial [Genlisea aurea]
Length=201

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/187 (86%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  15   RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQIWAARYILERITEIA  74

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRH+ HI+AYGEGN
Sbjct  75   GVVLSLDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKHHIAAYGEGN  134

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTE +GKGY EDRRPASNMDPYVVT+L+A
Sbjct  135  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEAAGKGYFEDRRPASNMDPYVVTSLIA  194

Query  265  ettlLWQ  245
            ETT+LW+
Sbjct  195  ETTILWK  201



>sp|P52783.1|GLNA_PINSY RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Pinus sylvestris]
 emb|CAA49476.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLY+GINISG NGEVMPGQWEFQVGPSVGI A D +WCAR+I+ERITE+A
Sbjct  170  RDIVDAHYKACLYSGINISGINGEVMPGQWEFQVGPSVGISAADELWCARFIMERITEKA  229

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPIEGDWNGAG HTNYSTKSMR+EGGFEVIKKAI  L LRH++HISAYGEGN
Sbjct  230  GVVLSFDPKPIEGDWNGAGCHTNYSTKSMRKEGGFEVIKKAIEKLKLRHKEHISAYGEGN  289

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA +NTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  290  ERRLTGRHETADMNTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  349

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  350  ETTILWKP  357



>gb|AGC24242.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24243.1| glutamine synthetase 1, partial [Brassica napus]
Length=249

 Score =   319 bits (818),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  62   RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  121

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  122  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGN  181

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  182  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  241

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  242  ETTILWKP  249



>gb|EPS57588.1| glutamine synthetase, partial [Genlisea aurea]
Length=283

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  96   RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQIWAARYILERITEIA  155

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRH+ HI+AYGEGN
Sbjct  156  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKHHIAAYGEGN  215

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTE +GKGY EDRRPASNMDPYVVT+L+A
Sbjct  216  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEAAGKGYFEDRRPASNMDPYVVTSLIA  275

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  276  ETTILWKP  283



>gb|AGC24240.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC24241.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82197.1| glutamine synthetase 1, partial [Brassica napus]
 gb|AGC82198.1| glutamine synthetase 1, partial [Brassica napus]
Length=257

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  70   RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  129

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  130  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGN  189

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  190  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  249

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  250  ETTILWKP  257



>gb|AGC82199.1| glutamine synthetase 1, partial [Brassica napus]
Length=255

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  68   RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  127

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  128  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGN  187

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  188  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  247

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  248  ETTILWKP  255



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   323 bits (827),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|AAA50249.1| glutamine synthetase, partial (chloroplast) [Solanum lycopersicum]
Length=191

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/176 (91%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  766  AGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAGVVLTLDPKPIEG  587
            AGINISGTNGEVMPGQWE QVGPSVGIE GDHIWCARY+LERITEQAGVVL+LDPKPIEG
Sbjct  1    AGINISGTNGEVMPGQWESQVGPSVGIEGGDHIWCARYLLERITEQAGVVLSLDPKPIEG  60

Query  586  DWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNERRLTGKHETASI  407
            DWNGAG HTNYST SMR EGGFEVIKKAILNLSLRH++HISAYGEGNERRLTGKHETASI
Sbjct  61   DWNGAGCHTNYSTLSMRGEGGFEVIKKAILNLSLRHKEHISAYGEGNERRLTGKHETASI  120

Query  406  NTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallaettlLWQPT  239
            + FSWGVANRGCSIRVGRDTEK GKGYLEDRRPASNMDP VVT LLAETT+LW+PT
Sbjct  121  DQFSWGVANRGCSIRVGRDTEKEGKGYLEDRRPASNMDPIVVTGLLAETTILWEPT  176



>ref|XP_010528562.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like isoform 
X2 [Tarenaya hassleriana]
Length=326

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  139  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYILERITEIA  198

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L +RH+DHI+AYGEGN
Sbjct  199  GVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIKKLEMRHKDHIAAYGEGN  258

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  259  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  318

Query  265  ettlLWQP  242
            ETT+LW P
Sbjct  319  ETTILWNP  326



>gb|ABK21449.1| unknown [Picea sitchensis]
 gb|ABK23372.1| unknown [Picea sitchensis]
Length=357

 Score =   322 bits (825),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGPSVGI A D +WCARYI+ERITE+ 
Sbjct  170  RDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPSVGISAADELWCARYIMERITEKE  229

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPIEGDWNGAG HTNYSTKS R+EGGFEVIKKAI  L LRH++HISAYGEGN
Sbjct  230  GVVLSFDPKPIEGDWNGAGCHTNYSTKSTRKEGGFEVIKKAIEKLRLRHKEHISAYGEGN  289

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  290  ERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPYIVTSMIA  349

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  350  ETTILWKP  357



>gb|AJD14835.1| glutamine synthetase [Boehmeria nivea]
Length=356

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_010528561.1| PREDICTED: glutamine synthetase nodule isozyme-like isoform X1 
[Tarenaya hassleriana]
Length=356

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L +RH+DHI+AYGEGN
Sbjct  229  GVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIKKLEMRHKDHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW P
Sbjct  349  ETTILWNP  356



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/189 (87%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDISDAHYKACLYAGI ISGTNGEVMPGQWE+QVGPSVGI+AGDHIW + YILERITEQA
Sbjct  224  RDISDAHYKACLYAGIEISGTNGEVMPGQWEYQVGPSVGIDAGDHIWASGYILERITEQA  283

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLTLDPKPI+GDWNGAG HTNYST SMRE+GGF+VIKKAILNLSLRH  HI+AYGEGN
Sbjct  284  GVVLTLDPKPIQGDWNGAGCHTNYSTLSMREDGGFDVIKKAILNLSLRHDLHIAAYGEGN  343

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETASI+ FSW VANRGCSIRVGR+TE  GKGYLEDRRP SNMDPY VTALLA
Sbjct  344  ERRLTGLHETASISDFSWCVANRGCSIRVGRETEAKGKGYLEDRRPPSNMDPYTVTALLA  403

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  404  ETTILWEPT  412



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNM PYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMGPYVVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>emb|CDY38104.1| BnaC02g06690D [Brassica napus]
Length=356

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDELWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRHR+HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHREHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|AGC24238.1| glutamine synthetase 1 [Brassica napus]
Length=356

 Score =   321 bits (823),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTVLWKP  356



>emb|CAA52448.1| glutamate--ammonia ligase [Pinus sylvestris]
Length=357

 Score =   321 bits (822),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +WCAR+I+ERITE+A
Sbjct  170  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADELWCARFIMERITEKA  229

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPIEGDWNGAG HTNYSTKSMR+EGGFEVIKKAI  L LRH++HISAYGEGN
Sbjct  230  GVVLSFDPKPIEGDWNGAGCHTNYSTKSMRKEGGFEVIKKAIEKLKLRHKEHISAYGEGN  289

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA +NTFS GVANRG S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  290  ERRLTGRHETADMNTFSRGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  349

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  350  ETTILWKP  357



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFVWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   321 bits (822),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>emb|CDO98315.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   320 bits (821),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI ++HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVNSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWMARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GGF VIKKAI  L LRH+DHI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGFNVIKKAIEKLKLRHKDHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIVWKP  356



>ref|XP_003619869.1| Glutamine synthetase [Medicago truncatula]
 emb|CAA71316.1| glutamine synthetase [Medicago truncatula]
 gb|AES76087.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   320 bits (821),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMRE GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>ref|XP_011003750.1| PREDICTED: glutamine synthetase nodule isozyme [Populus euphratica]
Length=356

 Score =   320 bits (821),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR +GGFEVIKKAI NL LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIAGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGNLKLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   320 bits (821),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   320 bits (821),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_010553887.1| PREDICTED: glutamine synthetase nodule isozyme [Tarenaya hassleriana]
Length=356

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH+DHI+AYGEGN
Sbjct  229  GVVLSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLRHKDHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>gb|AGC82204.1| glutamine synthetase 1, partial [Brassica napus]
Length=235

 Score =   316 bits (809),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  54   RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  113

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  114  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGN  173

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY V
Sbjct  174  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTV  228



>dbj|BAD11327.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQLWMARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
             TT+LW+P
Sbjct  349  NTTILWKP  356



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>gb|AGC24239.1| glutamine synthetase 1 [Brassica napus]
 emb|CDX85499.1| BnaA02g03140D [Brassica napus]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_008229355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Prunus mume]
Length=326

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  139  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  198

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR  GGFEVIKKAI  L LRH++HI+AYGEGN
Sbjct  199  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRANGGFEVIKKAIEKLGLRHKEHIAAYGEGN  258

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+L+A
Sbjct  259  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSLIA  318

Query  265  ettlLWQ  245
            ETTL+W+
Sbjct  319  ETTLVWK  325



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDELWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNEGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>pdb|4IS4|A Chain A, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|B Chain B, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|C Chain C, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|D Chain D, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|E Chain E, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|F Chain F, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|G Chain G, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|H Chain H, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|I Chain I, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
 pdb|4IS4|J Chain J, The Glutamine Synthetase From The Dicotyledonous Plant 
M. Truncatula Is A Decamer
Length=378

 Score =   320 bits (821),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  191  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYILERITEIA  250

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMRE GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  251  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRENGGYEIIKKAIEKLGLRHKEHIAAYGEGN  310

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++A
Sbjct  311  ERRLTGKHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIA  370

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  371  ETTLLWKP  378



>ref|XP_009126124.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Brassica 
rapa]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI GDWNGAG+HTNYSTKSMR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIVWKP  356



>ref|NP_001239821.1| cytosolic glutamine synthetase alpha [Glycine max]
 gb|ACU18102.1| unknown [Glycine max]
 gb|KHN43648.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEMA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GV+++ DPKPI GDWNGAG+H+NYSTKSMR+EGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVIVSFDPKPIPGDWNGAGAHSNYSTKSMRDEGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGSSIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>sp|O04867.1|GLNA1_ALNGL RecName: Full=Glutamine synthetase; AltName: Full=GS(1); AltName: 
Full=Glutamate--ammonia ligase [Alnus glutinosa]
 emb|CAA69937.1| glutamate synthetase [Alnus glutinosa]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTNYSTKSMR  GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNYSTKSMRNNGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>ref|XP_007036933.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
 gb|EOY21434.1| Glutamine synthase clone R1, 1,ATGLN1,1 isoform 1 [Theobroma 
cacao]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARY+LERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYLLERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+E+IKKAI NL LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIENLKLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRDTEKCGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAINKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYVV  343



>ref|XP_010271383.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Nelumbo 
nucifera]
Length=356

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR EGG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSEGGYEVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFVWGVANRGASIRVGRDTERAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>sp|Q43785.1|GLNA3_MEDSA RecName: Full=Glutamine synthetase nodule isozyme; AltName: Full=Glutamate--ammonia 
ligase [Medicago sativa]
 gb|AAB41554.1| cytosolic glutamine synthetase [Medicago sativa]
Length=356

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHET  INTFSWGVANRG S+RVGRDTEK GKGY EDRRP+SNMDPYVVT+++A
Sbjct  289  ERRLTGKHETTDINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPSSNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>ref|NP_568335.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
 sp|Q9FMD9.1|GLN14_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-4; AltName: 
Full=Glutamate--ammonia ligase GLN1;4; Short=GLN1;4 [Arabidopsis 
thaliana]
 dbj|BAB10184.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL24414.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAM91149.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED92312.1| glutamine synthetase 1;4 [Arabidopsis thaliana]
Length=356

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGR+TEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRETEKNGKGYFEDRRPASNMDPYVVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>emb|CAA73366.1| glutamine synthetase [Lotus japonicus]
Length=356

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W AR+ILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARFILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>ref|XP_011083120.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Sesamum 
indicum]
Length=356

 Score =   319 bits (817),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISAGDQLWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH+ HI+AYGEGN
Sbjct  229  GVVVSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKHHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_008365754.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYIV  343



>gb|AIR07816.1| cytosolic glutamine synthetase 1-1, partial [Vitis labrusca x 
Vitis vinifera]
Length=318

 Score =   317 bits (813),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGI AGD +W +RYILERITE A
Sbjct  131  RDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGISAGDELWVSRYILERITEIA  190

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L LRH++HI+AYGEGN
Sbjct  191  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGN  250

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  251  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  310

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  311  ETTILWKP  318



>gb|AID48673.1| theanine synthetase [Camellia oleifera]
Length=356

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQLWMARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSMRSDGGFEVIKKAIEKLGLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPA NMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPAPNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
             TT+LW+P
Sbjct  349  NTTILWKP  356



>ref|XP_011085871.1| PREDICTED: glutamine synthetase cytosolic isozyme [Sesamum indicum]
Length=356

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKSMR+EGG+E+IKKAI  L  RH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKEGGYEIIKKAIEKLGHRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTF WGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETANINTFKWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>dbj|BAM84282.1| glutamine synthetase [Tulipa pulchella]
Length=353

 Score =   318 bits (815),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTNYSTKSMR +GG+EVI KAI  LSL+H++HISAYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLSLKHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>ref|XP_009370556.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X2 
[Pyrus x bretschneideri]
Length=326

 Score =   317 bits (813),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  139  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  198

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  199  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGN  258

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  259  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYIV  313



>ref|NP_001268175.1| glutamine synthetase cytosolic isozyme 1 [Vitis vinifera]
 sp|P51118.1|GLNA1_VITVI RecName: Full=Glutamine synthetase cytosolic isozyme 1; AltName: 
Full=Glutamate--ammonia ligase [Vitis vinifera]
 emb|CAA63981.1| glutamine synthetase [Vitis vinifera]
 emb|CBI15615.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWE+QVGPSVGI AGD +W +RYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEYQVGPSVGISAGDELWVSRYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_003528974.1| PREDICTED: glutamine synthetase PR-2 [Glycine max]
 gb|KHN45263.1| Glutamine synthetase PR-2 [Glycine soja]
Length=356

 Score =   318 bits (816),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G +++ DPKPI GDWNGAG+H+NYSTKSMREEGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GAIVSFDPKPIPGDWNGAGAHSNYSTKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGSSIRVGRDTEKNGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_011002191.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 [Populus 
euphratica]
Length=356

 Score =   318 bits (815),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPS+GI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSIGISAGDELWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYST+SMR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEIIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYIV  343



>gb|ABK23723.1| unknown [Picea sitchensis]
 gb|ABR17424.1| unknown [Picea sitchensis]
Length=355

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPTVGISSGDQVWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMREEGG +VIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTE+ GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPYIV  343



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+EVI KAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEVILKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMVA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>gb|ABK95973.1| unknown [Populus trichocarpa]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>gb|ABW89464.1| glutamine synthetase [Gossypium hirsutum]
 gb|ABW89465.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITETA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|ABW89460.1| glutamine synthetase [Gossypium herbaceum]
 gb|ABW89466.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_006844043.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
 gb|ERN05718.1| hypothetical protein AMTR_s00006p00241880 [Amborella trichopoda]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEIWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMRE+GG +VIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGIDVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGHHETADINTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_002318305.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE96525.1| glutamine synthetase family protein [Populus trichocarpa]
Length=356

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR +GGFEVIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIAGDWNGAGAHTNYSTKSMRNDGGFEVIKKAIGKLQLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>gb|ABW89463.1| glutamine synthetase [Gossypium raimondii]
 gb|KJB10477.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=356

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITETA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|ABW89462.1| glutamine synthetase [Gossypium hirsutum]
Length=356

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+ W+P
Sbjct  349  ETTIPWKP  356



>ref|XP_008358170.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTE++GKGY EDRRPASNMDPY V
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEQAGKGYFEDRRPASNMDPYXV  343



>gb|EYU45782.1| hypothetical protein MIMGU_mgv1a009017mg [Erythranthe guttata]
Length=355

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  168  RDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWIARYILERITEIA  227

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPIEGDWNGAG+HTNYSTKSMRE+GG+E+I KAI  LSLRH++HI+AYGEGN
Sbjct  228  GVVLSFDPKPIEGDWNGAGAHTNYSTKSMREDGGYEIILKAIEKLSLRHKEHIAAYGEGN  287

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+V
Sbjct  288  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIV  342



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGIN+SGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERIT+ A
Sbjct  169  RDIVDSHYKACLYAGINVSGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITQLA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI GDWNGAG+HTNYSTKSMRE+GG+E IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIPGDWNGAGAHTNYSTKSMREDGGYEAIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG++ISG NGEVMPGQWEFQVGPSVGI AGD +W ARY+LERITE A
Sbjct  169  RDIVDAHYKACLYAGVSISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYVLERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>ref|XP_008659016.1| PREDICTED: glutamine synthetase root isozyme 5 isoform X1 [Zea 
mays]
 gb|AFW89162.1| glutamine synthetase3 [Zea mays]
Length=306

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  118  RDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEMA  177

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G+VL+LDPKPI+GDWNGAG+HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI+AYGEGN
Sbjct  178  GIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGKRHREHIAAYGEGN  237

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT ++A
Sbjct  238  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIA  297

Query  265  ettlLWQ  245
            +TT+LW+
Sbjct  298  DTTILWK  304



>gb|KCW69395.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=313

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  126  RDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYILERITEIA  185

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  186  GVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  245

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  246  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIA  305

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  306  ETTILWKP  313



>ref|XP_006400196.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
 dbj|BAJ34289.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41649.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISGTNGEVMPGQWEFQVGP+VGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGTNGEVMPGQWEFQVGPTVGIAAADQVWVARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV +LDPKPI GDWNGAG+HTNYSTK MRE+GG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVPSLDPKPIPGDWNGAGAHTNYSTKPMREDGGYEVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>ref|XP_002305885.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|EEE86396.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYST+SMR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTESMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVA+RG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVADRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|AAW21273.1| glutamine synthetase [Saccharum officinarum]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQVWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLT DPKPI GDWNGAG+HTNYSTKSMR EGG+EVIK AI  L LRH++HI+AYGEGN
Sbjct  229  GVVLTFDPKPIPGDWNGAGAHTNYSTKSMRNEGGYEVIKAAIEKLKLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGR+TE++GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASVRVGRETEQNGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>ref|XP_007043312.1| Glutamine synthetase 1,4 [Theobroma cacao]
 gb|EOX99143.1| Glutamine synthetase 1,4 [Theobroma cacao]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDQLWVARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG  VIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGIHVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA IN+FSWGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINSFSWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTMLWKP  356



>gb|AAP33169.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G V++ DPKPI GDWNGAG+HTNYSTKSMRE+GGFE+IKKAI  L L+H++HI+AYG+GN
Sbjct  229  GAVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGFEIIKKAIEKLGLKHKEHIAAYGKGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTFSWGVANRG S+RVGR+TEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGKHETADINTFSWGVANRGASVRVGRETEKEGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|ACN40288.1| unknown [Picea sitchensis]
Length=355

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI +GD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPTVGISSGDQVWAARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMREEGG +VIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTE+ GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPYIV  343



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMVA  348

Query  265  ettlLWQP  242
            ETT+LW P
Sbjct  349  ETTILWNP  356



>ref|XP_006391363.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28649.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=340

 Score =   317 bits (811),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  153  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYILERITEIA  212

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  213  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGN  272

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  273  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  332

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  333  ETTLLWNP  340



>ref|XP_009414782.1| PREDICTED: glutamine synthetase cytosolic isozyme 2-like [Musa 
acuminata subsp. malaccensis]
Length=357

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP VG+ AGD +W ARY+LERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPCVGVSAGDQLWVARYVLERITEMA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIK+AI  L  RH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKQAIEKLGWRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEKSGKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGRHETADINTFVWGVANRGASIRVGRDTEKSGKGYFEDRRPASNMDPYAVTSMIA  348

Query  265  ettlLWQPT  239
            ETT+LW+PT
Sbjct  349  ETTILWKPT  357



>dbj|BAD99525.1| glutamine synthetase [Camellia sinensis]
 gb|AEM44626.1| theanine synthetase [Camellia sinensis]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKS R +GGFEVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKS R +GGFEVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSTRSDGGFEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>ref|XP_006482120.1| PREDICTED: glutamine synthetase nodule isozyme-like [Citrus sinensis]
 gb|KDO50818.1| hypothetical protein CISIN_1g018434mg [Citrus sinensis]
Length=356

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDQLWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+H NYSTKSMR +GGFEVIKKAI  L LRH +HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHANYSTKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>dbj|BAM84285.1| glutamine synthetase [Tulipa fosteriana]
Length=353

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITETA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTNYSTKSMR +GG+EVI KAI  L L+H++HISAYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLGLKHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYIV  343



>dbj|BAL14865.1| putative cytosolic glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84283.1| glutamine synthetase [Tulipa gesneriana]
 dbj|BAM84284.1| glutamine synthetase [Tulipa gesneriana]
Length=353

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTNYSTKSMR +GG+EVI KAI  L L+H++HISAYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVILKAIEKLGLKHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVV  343



>gb|KDP43303.1| hypothetical protein JCGZ_24224 [Jatropha curcas]
Length=356

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG  VIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGLAVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA I+TFSWGVANRG SIRVGRDTEKSGKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADIHTFSWGVANRGASIRVGRDTEKSGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_002888488.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64747.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISASDEVWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  349  ETTLLWNP  356



>gb|KCW69394.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=348

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  161  RDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYILERITEIA  220

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  221  GVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  280

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  281  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIA  340

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  341  ETTILWKP  348



>ref|XP_001755833.1| predicted protein [Physcomitrella patens]
 gb|EDQ79506.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI +AHYKACLYAGI ISG NGEVMPGQWEFQVGPS GI A D +W ARYILERITE A
Sbjct  169  RDIVNAHYKACLYAGIQISGINGEVMPGQWEFQVGPSKGIAAADQLWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPIEGDWNGAG HTNYSTKSMREEGG+EVIKKAI  L LRHR+HI++YGEGN
Sbjct  229  GVVLSLDPKPIEGDWNGAGCHTNYSTKSMREEGGYEVIKKAIEKLGLRHREHIASYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA +NTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT ++A
Sbjct  289  ERRLTGKHETADMNTFSWGVANRGASVRVGRDTEKDGKGYFEDRRPASNMDPYVVTGMIA  348

Query  265  ettlLWQP  242
             TT+LW P
Sbjct  349  YTTILWSP  356



>ref|XP_006360384.1| PREDICTED: glutamine synthetase nodule isozyme-like [Solanum 
tuberosum]
Length=356

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERI E A
Sbjct  169  RDIVDSHYKACLYAGINISGVNGEVMPGQWEFQVGPAVGISAGDEVWTARYILERIAEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+H NYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHANYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA IN+F WGVANRGCS+RVGRDTEK+GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGKHETADINSFKWGVANRGCSVRVGRDTEKAGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIVWKP  356



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERI E A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDEVWTARYILERIAEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRADGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA+INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGKHETANINTFKWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIIWKP  356



>prf||1804333C Gln synthetase
Length=430

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKA LYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYILERITE A
Sbjct  227  RDIVDAHYKASLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYILERITEIA  286

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  287  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIEKLGLRHKEHISAYGEGN  346

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  347  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  406

Query  265  ettlLWQPT  239
            ETTLLW PT
Sbjct  407  ETTLLWNPT  415



>ref|XP_010062276.1| PREDICTED: glutamine synthetase nodule isozyme-like [Eucalyptus 
grandis]
 gb|KCW69392.1| hypothetical protein EUGRSUZ_F02872 [Eucalyptus grandis]
Length=356

 Score =   317 bits (811),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGIN+SG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINVSGINGEVMPGQWEFQVGPSVGISASDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MR EGG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKTMRNEGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>gb|AIR07817.1| cytosolic glutamine synthetase 1-2, partial [Vitis labrusca x 
Vitis vinifera]
Length=321

 Score =   315 bits (807),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  134  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  193

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI+GDWNGAG+HTNYSTKSMR +GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  194  GVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  253

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  254  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  313

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  314  ESTILWKP  321



>ref|XP_007152660.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 sp|P04771.1|GLNA2_PHAVU RecName: Full=Glutamine synthetase PR-2; AltName: Full=Gln isozyme 
alpha; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27632.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW24654.1| hypothetical protein PHAVU_004G148300g [Phaseolus vulgaris]
 prf||1208270B synthetase R2,Gln
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACVYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWAARYILERITELA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G V++ DPKPI GDWNGAG+H+NYSTKSMREEGG+EVIKKAI  L LRH++HI+AYG+GN
Sbjct  229  GAVVSFDPKPIPGDWNGAGAHSNYSTKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGKGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGSSVRVGRDTEKQGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_004512771.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cicer arietinum]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVA+RG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVADRGSSIRVGRDTEKDGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQ  245
            ETT+LW+
Sbjct  349  ETTILWK  355



>gb|AAR29057.1| glutamine synthetase 1 [Datisca glomerata]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDVVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREKGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INT  WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTSLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW+P
Sbjct  349  ETTLLWKP  356



>emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus]
 gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis]
 emb|CDY52941.1| BnaCnng23850D [Brassica napus]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+E+IKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  349  ETTLLWNP  356



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEVWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  349  ETTLLWNP  356



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAADEIWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HISAYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIDKLGLRHKEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  289  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  349  ETTLLWNP  356



>gb|KHG29839.1| Glutamine synthetase cytosolic isozyme 1-1 [Gossypium arboreum]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDQIWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI GDWNGAG+HTNYSTKSMR +GG +VIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGIDVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA IN+FSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINSFSWGVANRGASIRVGRDTEKDGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   319 bits (817),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  802  DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQAG  623
            DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERIT QAG
Sbjct  230  DISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITGQAG  289

Query  622  VVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGNE  443
            VVL+LDP PIEGD NGAG HTNYST SMRE+GGFEVIKKA LNLSLRH +HI+AYGEG  
Sbjct  290  VVLSLDPLPIEGDTNGAGCHTNYSTLSMREDGGFEVIKKANLNLSLRHLEHINAYGEGIL  349

Query  442  RRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtallae  263
             +LTG HETASI+ FSWGVA RG SIRVG DTEK GKGYLEDRRPASNMDPYVVT LLA+
Sbjct  350  EKLTGNHETASIDYFSWGVAFRGASIRVGADTEKQGKGYLEDRRPASNMDPYVVTGLLAQ  409

Query  262  ttlLWQPT  239
            TT+LW+PT
Sbjct  410  TTILWEPT  417



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWAARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR  GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRANGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVV  343



>ref|XP_006374208.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa]
Length=348

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  161  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  220

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR +GGFE+IKKAI  L LRH++HI+AYGEGN
Sbjct  221  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNDGGFEIIKKAIGKLQLRHKEHIAAYGEGN  280

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA I+TFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPY+VT+++A
Sbjct  281  ERRLTGRHETADIHTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYIVTSMIA  340

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  341  ETTILWKP  348



>emb|CAN68162.1| hypothetical protein VITISV_015673 [Vitis vinifera]
Length=356

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI+GDWNGAG+HTNYSTKSMR +GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            E+T+LW+P
Sbjct  349  ESTILWKP  356



>emb|CAA63963.1| glutamate synthetase [Lotus japonicus]
Length=356

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAG+NISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTK+MRE+GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIKGDWNGAGAHTNYSTKTMREDGGYEVIKKAIDKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPAS MDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASYMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            +TT+LW+P
Sbjct  349  DTTILWKP  356



>ref|XP_011022058.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Populus 
euphratica]
Length=356

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERI E A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEVWVARYILERIAEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMR EGG  VIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMRNEGGIAVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIIWKP  356



>gb|KHG00636.1| Glutamine synthetase cytosolic isozyme 1 [Gossypium arboreum]
Length=356

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMR +GG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMRSDGGYEVIKKAIAKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INT+ WGVANRG SIRVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTYLWGVANRGASIRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>ref|XP_006649656.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like [Oryza 
brachyantha]
Length=356

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKAC+YAGINISG NGEVMPGQWEFQVGPSVGI A D +W ARYILER+TE A
Sbjct  169  RDIVDAHYKACIYAGINISGINGEVMPGQWEFQVGPSVGIAAADQVWVARYILERVTEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+LDPKPI+GDWNGAG+HTN+STKSMRE GG+EVIKKAI  L+LRH++HI+AYGEGN
Sbjct  229  GVVLSLDPKPIQGDWNGAGAHTNFSTKSMREPGGYEVIKKAIDKLALRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT ++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIA  348

Query  265  ettlLWQ  245
            ETTLLW+
Sbjct  349  ETTLLWK  355



>emb|CAA06383.1| glutamine synthetase [Pinus sylvestris]
Length=355

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGP+VGI +GD +W ARY+LERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPTVGISSGDQVWAARYLLERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+HTNYSTKSMREEGG +VIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVLSFDPKPIQGDWNGAGAHTNYSTKSMREEGGIKVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTG+HETA INTFSWGVANRG SIRVGRDTE+ GKGY EDRRPASNMDPY+V
Sbjct  289  ERRLTGRHETADINTFSWGVANRGASIRVGRDTEREGKGYFEDRRPASNMDPYIV  343



>sp|P38563.2|GLNA5_MAIZE RecName: Full=Glutamine synthetase root isozyme 5; AltName: Full=GS117; 
AltName: Full=Glutamate--ammonia ligase [Zea mays]
Length=357

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDVVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEMA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            G+VL+LDPKPI+GDWNGAG+HTNYSTKSMRE GG+EVIK+AI  L  RHR+HI+AYGEGN
Sbjct  229  GIVLSLDPKPIKGDWNGAGAHTNYSTKSMREAGGYEVIKEAIEKLGRRHREHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT ++A
Sbjct  289  ERRLTGRHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTGMIA  348

Query  265  ettlLWQ  245
            +TT+LW+
Sbjct  349  DTTILWK  355



>emb|CAJ87510.1| putative glutamine synthetase [Pisum sativum]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RD+ +AHYKACL+AGINISG NGEVMPGQWEFQVGPSVGI AGD IW ARYILERITE A
Sbjct  169  RDVVEAHYKACLFAGINISGINGEVMPGQWEFQVGPSVGISAGDEIWVARYILERITEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVLT DPKPI+GDWNGAG+HTNYSTKSMRE+GG+E+IKKAI  L  RH +HISAYGEGN
Sbjct  229  GVVLTFDPKPIKGDWNGAGAHTNYSTKSMREDGGYEIIKKAIEKLGKRHAEHISAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVV  281
            ERRLTGKHETA INTFSWGVANRG S+RVGRDTEK GKGY EDRRPASNMDPYVV
Sbjct  289  ERRLTGKHETADINTFSWGVANRGASVRVGRDTEKEGKGYFEDRRPASNMDPYVV  343



>gb|ABK51388.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKSMR++GG++VIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKDGGYQVIKKAIEKLGLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
             TT+LW+P
Sbjct  349  ATTILWKP  356



>ref|XP_004240034.1| PREDICTED: glutamine synthetase-like [Solanum lycopersicum]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERI E A
Sbjct  169  RDIVDSHYKACLYAGINISGVNGEVMPGQWEFQVGPAVGISAGDEVWAARYILERIAEVA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+H NYSTKSMRE+GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHANYSTKSMREDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA IN+F WGVANRGCS+RVGRDTEK+GKGY EDRRPASNMDPY VT+++A
Sbjct  289  ERRLTGKHETADINSFKWGVANRGCSVRVGRDTEKAGKGYFEDRRPASNMDPYTVTSMIA  348

Query  265  ettlLWQP  242
            ETT++W+P
Sbjct  349  ETTIVWKP  356



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI DAHYKACLYAGINISG NGEVMPGQWEFQVGPSVGI A D IW ARYILERITE A
Sbjct  169  RDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISASDEIWIARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI GDWNGAG+HTNYSTKSMREEGG+EVIKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRP+SNMDPYVVT+++A
Sbjct  289  ERRLTGHHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPSSNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETTLLW P
Sbjct  349  ETTLLWNP  356



>emb|CBI33470.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGPSVGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPI+GDWNGAG+HTNYSTKSMR +GG+E+IKKAI  L LRH++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIQGDWNGAGAHTNYSTKSMRNDGGYEIIKKAIEKLGLRHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  349  ETTILWKP  356



>dbj|BAD99526.1| glutamine synthetase [Camellia sinensis]
 gb|ADK46866.1| cytosolic glutamine synthetase [Camellia sinensis]
Length=356

 Score =   316 bits (809),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  169  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDELWVARYILERITEIA  228

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVV++ DPKPIEGDWNGAG+HTNYSTKSMR++GG++VIKKAI  L L+H++HI+AYGEGN
Sbjct  229  GVVVSFDPKPIEGDWNGAGAHTNYSTKSMRKDGGYQVIKKAIEKLGLKHKEHIAAYGEGN  288

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTG+HETA INTF WGVANRG S+RVGRDTEK+GKGY EDRRPASNMDPYVVT+++A
Sbjct  289  ERRLTGRHETADINTFLWGVANRGASVRVGRDTEKAGKGYFEDRRPASNMDPYVVTSMIA  348

Query  265  ettlLWQP  242
             TT+LW+P
Sbjct  349  ATTILWKP  356



>ref|XP_006430603.1| hypothetical protein CICLE_v10011785mg [Citrus clementina]
 gb|ESR43843.1| hypothetical protein CICLE_v10011785mg [Citrus clementina]
Length=429

 Score =   318 bits (815),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -1

Query  805  RDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYILERITEQA  626
            RDI D+HYKACLYAGINISG NGEVMPGQWEFQVGP+VGI AGD +W ARYILERITE A
Sbjct  242  RDIVDSHYKACLYAGINISGINGEVMPGQWEFQVGPAVGISAGDQLWVARYILERITEIA  301

Query  625  GVVLTLDPKPIEGDWNGAGSHTNYSTKSMREEGGFEVIKKAILNLSLRHRDHISAYGEGN  446
            GVVL+ DPKPI+GDWNGAG+H NYSTKSMR +GGFEVIKKAI  L LRH +HI+AYGEGN
Sbjct  302  GVVLSFDPKPIQGDWNGAGAHANYSTKSMRNDGGFEVIKKAIEKLGLRHSEHIAAYGEGN  361

Query  445  ERRLTGKHETASINTFSWGVANRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVtalla  266
            ERRLTGKHETA INTF WGVANRG SIRVGRDTEK GKGY EDRRPASNMDPYVVT+++A
Sbjct  362  ERRLTGKHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYVVTSMIA  421

Query  265  ettlLWQP  242
            ETT+LW+P
Sbjct  422  ETTILWKP  429



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005