BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014K10

Length=769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796830.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        338   2e-113   Nicotiana sylvestris
ref|XP_009614614.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    338   3e-113   Nicotiana tomentosiformis
ref|XP_006365593.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        336   2e-112   Solanum tuberosum [potatoes]
ref|XP_006349457.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        314   8e-104   Solanum tuberosum [potatoes]
emb|CDP06486.1|  unnamed protein product                                313   1e-103   Coffea canephora [robusta coffee]
ref|XP_009614615.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    309   1e-102   Nicotiana tomentosiformis
ref|XP_010327727.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        310   2e-102   Solanum lycopersicum
ref|XP_002280296.1|  PREDICTED: GDSL esterase/lipase CPRD49             310   3e-102   Vitis vinifera
ref|XP_008801963.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        308   2e-101   
ref|XP_010925101.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        306   1e-100   Elaeis guineensis
ref|XP_006338850.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        305   3e-100   Solanum tuberosum [potatoes]
ref|XP_004240943.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    305   4e-100   Solanum lycopersicum
ref|XP_006481035.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    303   1e-99    Citrus sinensis [apfelsine]
ref|XP_007163538.1|  hypothetical protein PHAVU_001G242700g             303   1e-99    Phaseolus vulgaris [French bean]
ref|XP_010253884.1|  PREDICTED: GDSL esterase/lipase CPRD49             302   3e-99    Nelumbo nucifera [Indian lotus]
ref|XP_010924206.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        302   3e-99    Elaeis guineensis
ref|XP_011076687.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        300   2e-98    Sesamum indicum [beniseed]
gb|EYU20016.1|  hypothetical protein MIMGU_mgv1a012192mg                300   3e-98    Erythranthe guttata [common monkey flower]
gb|AFK45704.1|  unknown                                                 300   4e-98    Lotus japonicus
ref|XP_008800894.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        298   9e-98    Phoenix dactylifera
ref|XP_009629949.1|  PREDICTED: GDSL esterase/lipase CPRD49             298   1e-97    Nicotiana tomentosiformis
ref|XP_007026708.1|  SGNH hydrolase-type esterase superfamily pro...    296   7e-97    
ref|XP_009793687.1|  PREDICTED: GDSL esterase/lipase CPRD49             295   1e-96    Nicotiana sylvestris
ref|XP_002270907.1|  PREDICTED: GDSL esterase/lipase CPRD49             295   2e-96    Vitis vinifera
ref|XP_009400020.1|  PREDICTED: GDSL esterase/lipase CPRD49             295   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007008988.1|  SGNH hydrolase-type esterase superfamily pro...    294   5e-96    Theobroma cacao [chocolate]
ref|XP_010044100.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    293   1e-95    Eucalyptus grandis [rose gum]
ref|XP_010543730.1|  PREDICTED: GDSL esterase/lipase CPRD49             293   2e-95    Tarenaya hassleriana [spider flower]
gb|KHN36379.1|  GDSL esterase/lipase CPRD49                             292   2e-95    Glycine soja [wild soybean]
ref|XP_011095009.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        292   3e-95    Sesamum indicum [beniseed]
ref|NP_001242351.1|  uncharacterized protein LOC100803959               292   4e-95    Glycine max [soybeans]
ref|XP_006481036.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    291   4e-95    Citrus sinensis [apfelsine]
gb|EPS60272.1|  hypothetical protein M569_14532                         292   4e-95    Genlisea aurea
ref|XP_003538463.1|  PREDICTED: GDSL esterase/lipase CPRD49 isofo...    291   5e-95    Glycine max [soybeans]
ref|XP_008233751.1|  PREDICTED: GDSL esterase/lipase CPRD49             291   5e-95    Prunus mume [ume]
ref|XP_008373984.1|  PREDICTED: GDSL esterase/lipase CPRD49 isofo...    291   8e-95    Malus domestica [apple tree]
ref|XP_008373975.1|  PREDICTED: GDSL esterase/lipase CPRD49 isofo...    291   9e-95    Malus domestica [apple tree]
ref|XP_010689718.1|  PREDICTED: GDSL esterase/lipase CPRD49             290   2e-94    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP14027.1|  unnamed protein product                                290   3e-94    Coffea canephora [robusta coffee]
ref|XP_007220531.1|  hypothetical protein PRUPE_ppa010281mg             289   3e-94    Prunus persica
emb|CDY36306.1|  BnaA01g31120D                                          289   3e-94    Brassica napus [oilseed rape]
ref|XP_009344873.1|  PREDICTED: GDSL esterase/lipase CPRD49 isofo...    289   3e-94    
ref|XP_004302586.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        289   4e-94    Fragaria vesca subsp. vesca
ref|XP_004506747.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        290   5e-94    Cicer arietinum [garbanzo]
ref|XP_010044099.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    289   6e-94    Eucalyptus grandis [rose gum]
gb|ACU13990.1|  unknown                                                 288   7e-94    Glycine max [soybeans]
ref|XP_009344866.1|  PREDICTED: GDSL esterase/lipase CPRD49 isofo...    288   7e-94    Pyrus x bretschneideri [bai li]
ref|XP_010031225.1|  PREDICTED: GDSL esterase/lipase CPRD49             288   1e-93    Eucalyptus grandis [rose gum]
ref|XP_009122322.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        288   1e-93    Brassica rapa
emb|CDY01003.1|  BnaC05g41970D                                          288   1e-93    
ref|XP_008785351.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    288   2e-93    Phoenix dactylifera
gb|ACJ85370.1|  unknown                                                 287   2e-93    Medicago truncatula
ref|XP_009146746.1|  PREDICTED: GDSL esterase/lipase CPRD49             287   3e-93    Brassica rapa
ref|XP_006298380.1|  hypothetical protein CARUB_v10014449mg             287   3e-93    Capsella rubella
ref|XP_004302594.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        286   4e-93    Fragaria vesca subsp. vesca
ref|XP_008463235.1|  PREDICTED: GDSL esterase/lipase CPRD49             286   4e-93    Cucumis melo [Oriental melon]
gb|KCW86123.1|  hypothetical protein EUGRSUZ_B02816                     285   4e-93    Eucalyptus grandis [rose gum]
emb|CDY08543.1|  BnaA05g27790D                                          286   5e-93    Brassica napus [oilseed rape]
ref|XP_010923042.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        286   6e-93    Elaeis guineensis
ref|XP_011095006.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        288   6e-93    Sesamum indicum [beniseed]
gb|KCW86119.1|  hypothetical protein EUGRSUZ_B02813                     285   7e-93    Eucalyptus grandis [rose gum]
ref|XP_002316215.1|  GDSL-motif lipase/hydrolase family protein         286   7e-93    
ref|XP_006486322.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        286   9e-93    Citrus sinensis [apfelsine]
ref|XP_006435730.1|  hypothetical protein CICLE_v10032177mg             288   1e-92    
emb|CDY36323.1|  BnaA01g30950D                                          285   1e-92    Brassica napus [oilseed rape]
ref|XP_004492450.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        285   1e-92    Cicer arietinum [garbanzo]
ref|XP_006407465.1|  hypothetical protein EUTSA_v10021365mg             285   1e-92    Eutrema salsugineum [saltwater cress]
ref|XP_011035959.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    285   2e-92    Populus euphratica
gb|KHN46945.1|  GDSL esterase/lipase CPRD49                             285   2e-92    Glycine soja [wild soybean]
gb|ABR17194.1|  unknown                                                 285   2e-92    Picea sitchensis
gb|KDP44775.1|  hypothetical protein JCGZ_01275                         285   2e-92    Jatropha curcas
ref|XP_002884836.1|  CPRD49                                             285   2e-92    
ref|XP_010487340.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        285   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_003520489.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        285   3e-92    
gb|KCW86118.1|  hypothetical protein EUGRSUZ_B02813                     283   3e-92    Eucalyptus grandis [rose gum]
ref|XP_010486764.1|  PREDICTED: GDSL esterase/lipase CPRD49             284   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_002322977.1|  CPRD49 family protein                              283   4e-92    Populus trichocarpa [western balsam poplar]
gb|KHG08090.1|  GDSL esterase/lipase CPRD49 -like protein               284   4e-92    Gossypium arboreum [tree cotton]
gb|KHN48499.1|  GDSL esterase/lipase CPRD49                             283   6e-92    Glycine soja [wild soybean]
gb|KHN35578.1|  GDSL esterase/lipase CPRD49                             283   7e-92    Glycine soja [wild soybean]
ref|XP_007140334.1|  hypothetical protein PHAVU_008G103700g             283   7e-92    Phaseolus vulgaris [French bean]
ref|XP_011045430.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    283   8e-92    Populus euphratica
ref|XP_010464821.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        283   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002311219.1|  GDSL-motif lipase/hydrolase family protein         283   1e-91    Populus trichocarpa [western balsam poplar]
ref|NP_001238350.1|  uncharacterized protein LOC100305638               283   1e-91    
ref|XP_004149235.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        283   2e-91    Cucumis sativus [cucumbers]
ref|XP_002533646.1|  Isoamyl acetate-hydrolyzing esterase, putative     283   2e-91    Ricinus communis
ref|XP_002528096.1|  Isoamyl acetate-hydrolyzing esterase, putative     281   2e-91    Ricinus communis
ref|XP_003604688.1|  GDSL esterase/lipase CPRD49                        282   3e-91    Medicago truncatula
ref|XP_010529894.1|  PREDICTED: GDSL esterase/lipase At2g38180 is...    282   4e-91    Tarenaya hassleriana [spider flower]
gb|KJB78772.1|  hypothetical protein B456_013G018300                    281   4e-91    Gossypium raimondii
ref|XP_004492451.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        281   4e-91    Cicer arietinum [garbanzo]
ref|XP_008785353.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    281   4e-91    Phoenix dactylifera
ref|XP_008785352.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    281   5e-91    Phoenix dactylifera
ref|XP_004307646.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        281   5e-91    Fragaria vesca subsp. vesca
ref|XP_008243738.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        280   2e-90    Prunus mume [ume]
ref|XP_011095007.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    280   2e-90    Sesamum indicum [beniseed]
ref|XP_006663137.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        279   6e-90    Oryza brachyantha
gb|AFK34685.1|  unknown                                                 278   6e-90    Medicago truncatula
ref|XP_011019116.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        278   8e-90    Populus euphratica
ref|NP_001068562.1|  Os11g0708400                                       278   9e-90    
ref|XP_010095233.1|  GDSL esterase/lipase CPRD49                        278   9e-90    
ref|XP_003600886.1|  GDSL esterase/lipase CPRD49                        277   2e-89    Medicago truncatula
gb|AAM63310.1|  CPRD49                                                  277   2e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009377766.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    277   2e-89    Pyrus x bretschneideri [bai li]
ref|XP_011045360.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    277   3e-89    Populus euphratica
ref|XP_002309140.1|  CPRD49 family protein                              276   3e-89    Populus trichocarpa [western balsam poplar]
gb|KJB78773.1|  hypothetical protein B456_013G018300                    282   3e-89    Gossypium raimondii
ref|XP_008370094.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        276   4e-89    
ref|NP_566387.1|  GDSL esterase/lipase                                  276   5e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011014736.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        275   5e-89    Populus euphratica
gb|AFK44579.1|  unknown                                                 276   7e-89    Lotus japonicus
dbj|BAJ98550.1|  predicted protein                                      275   1e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003562792.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    275   1e-88    Brachypodium distachyon [annual false brome]
ref|XP_007133895.1|  hypothetical protein PHAVU_010G001100g             275   2e-88    Phaseolus vulgaris [French bean]
ref|XP_008663734.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    274   3e-88    Zea mays [maize]
ref|XP_008663735.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    274   3e-88    Zea mays [maize]
ref|XP_002528098.1|  Isoamyl acetate-hydrolyzing esterase, putative     274   3e-88    Ricinus communis
ref|XP_007205742.1|  hypothetical protein PRUPE_ppa010192mg             274   4e-88    Prunus persica
ref|XP_004500485.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        274   5e-88    Cicer arietinum [garbanzo]
ref|XP_009377762.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    273   7e-88    Pyrus x bretschneideri [bai li]
gb|KJB76946.1|  hypothetical protein B456_012G114000                    272   2e-87    Gossypium raimondii
ref|XP_003558761.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        272   2e-87    Brachypodium distachyon [annual false brome]
gb|EYU41890.1|  hypothetical protein MIMGU_mgv1a010613mg                271   1e-86    Erythranthe guttata [common monkey flower]
ref|XP_002460017.1|  hypothetical protein SORBIDRAFT_02g020850          270   2e-86    Sorghum bicolor [broomcorn]
gb|ACG32472.1|  isoamyl acetate-hydrolyzing esterase                    270   2e-86    Zea mays [maize]
ref|NP_001281221.1|  LOC100283985                                       269   3e-86    Zea mays [maize]
ref|XP_004980097.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    269   3e-86    Setaria italica
ref|XP_010106264.1|  GDSL esterase/lipase CPRD49                        270   4e-86    
ref|XP_004980098.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    268   5e-86    Setaria italica
ref|XP_004492452.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        266   2e-85    Cicer arietinum [garbanzo]
ref|XP_002879730.1|  GDSL-motif lipase/hydrolase family protein         268   3e-85    Arabidopsis lyrata subsp. lyrata
ref|XP_011006553.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    266   6e-85    Populus euphratica
ref|XP_009133234.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     265   6e-85    Brassica rapa
ref|XP_006583655.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        265   8e-85    Glycine max [soybeans]
ref|XP_004137721.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     264   1e-84    Cucumis sativus [cucumbers]
ref|XP_010517106.1|  PREDICTED: GDSL esterase/lipase At2g38180 is...    266   1e-84    Camelina sativa [gold-of-pleasure]
gb|EYU41888.1|  hypothetical protein MIMGU_mgv1a011996mg                265   1e-84    Erythranthe guttata [common monkey flower]
gb|AAL31218.1|  At2g38180/F16M14.11                                     266   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008442421.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     263   3e-84    Cucumis melo [Oriental melon]
ref|NP_565883.1|  GDSL esterase/lipase                                  265   4e-84    Arabidopsis thaliana [mouse-ear cress]
gb|KEH23161.1|  GDSL-like lipase/acylhydrolase                          264   7e-84    Medicago truncatula
emb|CDY18401.1|  BnaA04g21860D                                          264   7e-84    Brassica napus [oilseed rape]
ref|NP_001242371.1|  uncharacterized protein LOC100792188               262   1e-83    Glycine max [soybeans]
ref|XP_010509212.1|  PREDICTED: GDSL esterase/lipase At2g38180-li...    263   2e-83    Camelina sativa [gold-of-pleasure]
ref|XP_011077558.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        262   2e-83    Sesamum indicum [beniseed]
emb|CDY07748.1|  BnaA03g17630D                                          261   3e-83    Brassica napus [oilseed rape]
ref|XP_011035964.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    260   5e-83    Populus euphratica
dbj|BAB33036.1|  CPRD49                                                 261   5e-83    Vigna unguiculata
dbj|BAI63594.1|  GDSL-motif lipase/hydrolase family protein             261   5e-83    Lotus japonicus
ref|XP_003552247.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        261   5e-83    Glycine max [soybeans]
emb|CDX93323.1|  BnaC04g45730D                                          261   6e-83    
ref|XP_009141726.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     261   6e-83    Brassica rapa
emb|CDY14483.1|  BnaC03g21120D                                          260   1e-82    Brassica napus [oilseed rape]
ref|XP_009133233.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     259   1e-82    Brassica rapa
ref|XP_004492445.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        259   2e-82    Cicer arietinum [garbanzo]
gb|KDP24452.1|  hypothetical protein JCGZ_25016                         257   8e-82    Jatropha curcas
gb|EPS60568.1|  hypothetical protein M569_14235                         256   3e-81    Genlisea aurea
gb|KDP24454.1|  hypothetical protein JCGZ_25018                         256   3e-81    Jatropha curcas
gb|ACJ85300.1|  unknown                                                 256   4e-81    Medicago truncatula
gb|KEH23169.1|  GDSL-like lipase/acylhydrolase                          256   5e-81    Medicago truncatula
gb|KEH23165.1|  GDSL-like lipase/acylhydrolase                          256   6e-81    Medicago truncatula
gb|KHN05547.1|  GDSL esterase/lipase CPRD49                             254   1e-80    Glycine soja [wild soybean]
ref|XP_007140333.1|  hypothetical protein PHAVU_008G103600g             253   3e-80    Phaseolus vulgaris [French bean]
ref|NP_001237711.1|  uncharacterized protein LOC100527807               253   4e-80    
gb|KEH23162.1|  GDSL-like lipase/acylhydrolase                          252   8e-80    Medicago truncatula
ref|XP_008355726.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        248   1e-78    
ref|XP_010236200.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    248   4e-78    
ref|XP_009377763.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    247   1e-77    Pyrus x bretschneideri [bai li]
gb|KDP24453.1|  hypothetical protein JCGZ_25017                         246   1e-77    Jatropha curcas
ref|XP_003529152.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        247   1e-77    Glycine max [soybeans]
gb|KDO68983.1|  hypothetical protein CISIN_1g0251811mg                  243   7e-77    Citrus sinensis [apfelsine]
gb|EMT30262.1|  GDSL esterase/lipase CPRD49                             246   1e-76    
ref|XP_007163539.1|  hypothetical protein PHAVU_001G242700g             243   1e-76    Phaseolus vulgaris [French bean]
gb|EMS49022.1|  GDSL esterase/lipase CPRD49                             243   4e-76    Triticum urartu
ref|XP_006435729.1|  hypothetical protein CICLE_v10032177mg             243   4e-76    
gb|KEH23163.1|  GDSL-like lipase/acylhydrolase                          242   7e-76    Medicago truncatula
ref|XP_011006554.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    242   7e-76    Populus euphratica
ref|XP_004492448.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        242   2e-75    Cicer arietinum [garbanzo]
ref|XP_007140343.1|  hypothetical protein PHAVU_008G104100g             240   5e-75    Phaseolus vulgaris [French bean]
ref|XP_009587567.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     239   8e-75    Nicotiana tomentosiformis
ref|XP_010517107.1|  PREDICTED: GDSL esterase/lipase At2g38180 is...    238   5e-74    Camelina sativa [gold-of-pleasure]
ref|XP_006584285.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    236   8e-74    
gb|KCW86116.1|  hypothetical protein EUGRSUZ_B02812                     236   2e-73    Eucalyptus grandis [rose gum]
ref|XP_009796363.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     234   8e-73    Nicotiana sylvestris
ref|XP_010509214.1|  PREDICTED: GDSL esterase/lipase At2g38180-li...    234   9e-73    Camelina sativa [gold-of-pleasure]
ref|XP_004492449.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        233   3e-72    Cicer arietinum [garbanzo]
ref|XP_004492446.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        232   2e-71    Cicer arietinum [garbanzo]
ref|XP_006294972.1|  hypothetical protein CARUB_v10024027mg             228   9e-71    
ref|XP_003548744.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        227   3e-70    
gb|AFK40200.1|  unknown                                                 228   3e-70    Medicago truncatula
gb|KEH23160.1|  GDSL-like lipase/acylhydrolase                          227   7e-70    Medicago truncatula
ref|XP_007140335.1|  hypothetical protein PHAVU_008G103700g             226   1e-69    Phaseolus vulgaris [French bean]
ref|XP_002322979.2|  hypothetical protein POPTR_0016s123402g            222   7e-69    
ref|XP_011095008.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    224   1e-68    
gb|KHN46944.1|  GDSL esterase/lipase                                    220   5e-68    Glycine soja [wild soybean]
ref|XP_009377767.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    221   1e-67    Pyrus x bretschneideri [bai li]
ref|XP_007133896.1|  hypothetical protein PHAVU_010G001100g             219   3e-67    Phaseolus vulgaris [French bean]
ref|XP_004249820.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        219   1e-66    Solanum lycopersicum
ref|XP_008355542.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        216   2e-66    
gb|KCW86120.1|  hypothetical protein EUGRSUZ_B02813                     213   3e-65    Eucalyptus grandis [rose gum]
ref|XP_006411022.1|  hypothetical protein EUTSA_v10017306mg             212   7e-65    
ref|XP_006339278.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        214   1e-64    
ref|XP_004173095.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        211   1e-63    
tpg|DAA35310.1|  TPA: hypothetical protein ZEAMMB73_058247              211   1e-63    
tpg|DAA35309.1|  TPA: hypothetical protein ZEAMMB73_058247              210   2e-63    
ref|XP_006848220.1|  hypothetical protein AMTR_s00029p00244780          206   1e-62    
ref|XP_006373986.1|  hypothetical protein POPTR_0016s123301g            204   8e-62    
gb|KJB76947.1|  hypothetical protein B456_012G114000                    202   2e-61    Gossypium raimondii
ref|XP_006481037.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    201   3e-60    Citrus sinensis [apfelsine]
ref|XP_006373987.1|  hypothetical protein POPTR_0016s123402g            198   1e-59    
gb|KHN48498.1|  GDSL esterase/lipase CPRD49                             197   5e-59    Glycine soja [wild soybean]
ref|XP_006429389.1|  hypothetical protein CICLE_v10012918mg             194   3e-58    
gb|KDO56633.1|  hypothetical protein CISIN_1g030609mg                   194   3e-58    Citrus sinensis [apfelsine]
ref|XP_009369162.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    192   3e-57    
gb|AAX20048.1|  CPRD49-like protein                                     194   4e-57    Capsicum annuum
ref|XP_001777394.1|  predicted protein                                  194   4e-57    
ref|XP_009369161.1|  PREDICTED: GDSL esterase/lipase CPRD49-like ...    191   1e-56    
ref|XP_010095231.1|  GDSL esterase/lipase CPRD49                        185   1e-53    
ref|XP_009621102.1|  PREDICTED: GDSL esterase/lipase At2g38180-like     173   7e-50    
gb|ADK60797.1|  unknown                                                 172   7e-50    Arachis diogoi
ref|XP_004492447.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        174   7e-50    Cicer arietinum [garbanzo]
ref|XP_006294971.1|  hypothetical protein CARUB_v10024027mg             171   2e-49    
ref|XP_002982002.1|  hypothetical protein SELMODRAFT_36615              159   5e-44    
ref|XP_002986082.1|  hypothetical protein SELMODRAFT_123310             160   6e-44    
ref|XP_009800647.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        155   8e-43    Nicotiana sylvestris
ref|XP_002989081.1|  hypothetical protein SELMODRAFT_447540             156   1e-42    Selaginella moellendorffii
ref|XP_002983691.1|  hypothetical protein SELMODRAFT_156096             156   1e-42    Selaginella moellendorffii
ref|XP_010494745.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     156   3e-42    
ref|XP_006281007.1|  hypothetical protein CARUB_v10027021mg             155   4e-42    Capsella rubella
ref|XP_010037557.1|  PREDICTED: GDSL esterase/lipase At5g62930          155   4e-42    Eucalyptus grandis [rose gum]
gb|KDP31089.1|  hypothetical protein JCGZ_11465                         154   8e-42    Jatropha curcas
ref|XP_011071877.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    153   2e-41    Sesamum indicum [beniseed]
gb|AAK13160.1|AC078829_12  putative esterase                            153   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010481516.1|  PREDICTED: GDSL esterase/lipase At5g45920          153   2e-41    Camelina sativa [gold-of-pleasure]
ref|XP_010546010.1|  PREDICTED: GDSL esterase/lipase At5g62930          153   2e-41    Tarenaya hassleriana [spider flower]
ref|XP_004298951.1|  PREDICTED: GDSL esterase/lipase At5g62930          153   3e-41    Fragaria vesca subsp. vesca
ref|NP_001064851.1|  Os10g0476700                                       154   3e-41    
ref|XP_010686339.1|  PREDICTED: GDSL esterase/lipase At5g45920          152   3e-41    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008439764.1|  PREDICTED: GDSL esterase/lipase At5g45920          152   5e-41    Cucumis melo [Oriental melon]
ref|XP_009140757.1|  PREDICTED: GDSL esterase/lipase At5g45920          152   5e-41    Brassica rapa
gb|AGU43760.1|  carboxylesterase ester hydrolase                        152   6e-41    Pinus massoniana [Chinese red pine]
ref|XP_008393024.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    151   1e-40    
ref|XP_004152216.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     151   1e-40    
ref|XP_008454268.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    151   2e-40    Cucumis melo [Oriental melon]
ref|XP_010441654.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     150   2e-40    Camelina sativa [gold-of-pleasure]
emb|CDX77062.1|  BnaC04g38570D                                          150   2e-40    
ref|XP_002318054.2|  GDSL-motif lipase/hydrolase family protein         150   2e-40    Populus trichocarpa [western balsam poplar]
ref|XP_004134670.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     150   3e-40    Cucumis sativus [cucumbers]
ref|XP_002865217.1|  carboxylic ester hydrolase                         149   6e-40    
ref|XP_011096415.1|  PREDICTED: GDSL esterase/lipase At5g45920          149   7e-40    Sesamum indicum [beniseed]
gb|KFK36714.1|  hypothetical protein AALP_AA4G160100                    145   7e-40    Arabis alpina [alpine rockcress]
ref|XP_011001524.1|  PREDICTED: GDSL esterase/lipase At5g62930          149   8e-40    Populus euphratica
dbj|BAB09320.1|  unnamed protein product                                149   9e-40    Arabidopsis thaliana [mouse-ear cress]
gb|AFK35811.1|  unknown                                                 149   9e-40    Lotus japonicus
ref|NP_199404.3|  GDSL esterase/lipase                                  149   1e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002282452.1|  PREDICTED: GDSL esterase/lipase At5g62930          149   1e-39    Vitis vinifera
ref|XP_010052218.1|  PREDICTED: GDSL esterase/lipase At5g45920          148   1e-39    Eucalyptus grandis [rose gum]
ref|NP_201098.1|  GDSL esterase/lipase                                  148   1e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382652.1|  PREDICTED: GDSL esterase/lipase At5g62930          148   2e-39    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007025443.1|  SGNH hydrolase-type esterase superfamily pro...    148   2e-39    
ref|XP_010248505.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    148   2e-39    Nelumbo nucifera [Indian lotus]
ref|XP_006394336.1|  hypothetical protein EUTSA_v10004836mg             147   4e-39    Eutrema salsugineum [saltwater cress]
ref|XP_010251202.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    147   4e-39    Nelumbo nucifera [Indian lotus]
ref|XP_008225202.1|  PREDICTED: GDSL esterase/lipase At5g45920          147   6e-39    Prunus mume [ume]
ref|XP_006439836.1|  hypothetical protein CICLE_v10021880mg             147   6e-39    Citrus clementina [clementine]
ref|XP_010248504.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    147   6e-39    Nelumbo nucifera [Indian lotus]
ref|XP_006279680.1|  hypothetical protein CARUB_v10026993mg             147   8e-39    Capsella rubella
ref|XP_006662440.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     147   9e-39    
ref|XP_004968618.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     146   1e-38    Setaria italica
ref|XP_002864827.1|  GDSL-motif lipase/hydrolase family protein         146   1e-38    
ref|XP_004232954.1|  PREDICTED: GDSL esterase/lipase At5g45920          146   1e-38    Solanum lycopersicum
ref|XP_010230613.1|  PREDICTED: GDSL esterase/lipase At5g45920          145   1e-38    Brachypodium distachyon [annual false brome]
ref|XP_006476788.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    146   1e-38    Citrus sinensis [apfelsine]
gb|KDO69616.1|  hypothetical protein CISIN_1g025869mg                   146   1e-38    Citrus sinensis [apfelsine]
emb|CDO96742.1|  unnamed protein product                                145   1e-38    Coffea canephora [robusta coffee]
ref|XP_010279160.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     145   2e-38    
ref|XP_008239774.1|  PREDICTED: GDSL esterase/lipase At5g62930          145   2e-38    Prunus mume [ume]
ref|XP_007209527.1|  hypothetical protein PRUPE_ppa010625mg             145   2e-38    Prunus persica
ref|XP_010444158.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     145   3e-38    
ref|XP_008374427.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     146   3e-38    
ref|XP_003567726.1|  PREDICTED: GDSL esterase/lipase At5g62930          144   1e-37    
ref|XP_011071876.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    143   2e-37    
ref|XP_003549620.1|  PREDICTED: GDSL esterase/lipase At5g62930          143   2e-37    
ref|XP_004293924.1|  PREDICTED: GDSL esterase/lipase At5g45920          142   2e-37    
gb|EYU22119.1|  hypothetical protein MIMGU_mgv1a012406mg                142   2e-37    
ref|XP_010529187.1|  PREDICTED: GDSL esterase/lipase At5g45920          142   3e-37    
ref|XP_010484007.1|  PREDICTED: GDSL esterase/lipase At5g62930          142   3e-37    
ref|XP_006840692.1|  hypothetical protein AMTR_s00096p00081560          142   4e-37    
emb|CDO96741.1|  unnamed protein product                                142   4e-37    
emb|CDM82203.1|  unnamed protein product                                142   4e-37    
ref|XP_009151416.1|  PREDICTED: GDSL esterase/lipase At5g62930          142   4e-37    
ref|XP_007155437.1|  hypothetical protein PHAVU_003G201200g             142   5e-37    
emb|CDY00339.1|  BnaA06g22400D                                          142   5e-37    
ref|XP_004508871.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     142   5e-37    
ref|XP_003525440.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     141   6e-37    
gb|KHN34322.1|  GDSL esterase/lipase                                    141   6e-37    
dbj|BAJ98713.1|  predicted protein                                      141   6e-37    
gb|KJB53160.1|  hypothetical protein B456_008G295700                    142   6e-37    
ref|XP_003632985.1|  PREDICTED: GDSL esterase/lipase At5g45920          141   8e-37    
gb|KFK31506.1|  hypothetical protein AALP_AA6G121500                    141   9e-37    
gb|AFK37491.1|  unknown                                                 141   1e-36    
ref|XP_002454944.1|  hypothetical protein SORBIDRAFT_03g001930          140   1e-36    
ref|XP_003593728.1|  GDSL esterase/lipase                               140   1e-36    
ref|XP_003546020.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     140   1e-36    
emb|CDX84368.1|  BnaC03g51320D                                          140   1e-36    
ref|NP_001042386.1|  Os01g0214200                                       140   1e-36    
ref|XP_006643903.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     140   2e-36    
ref|XP_003593727.1|  GDSL esterase/lipase                               140   2e-36    
gb|ACU20884.1|  unknown                                                 139   3e-36    
ref|XP_009409410.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     139   3e-36    
ref|XP_004485872.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     139   3e-36    
ref|XP_003542704.1|  PREDICTED: GDSL esterase/lipase At5g45920          139   4e-36    
gb|ACF82681.1|  unknown                                                 140   5e-36    
ref|XP_006449471.1|  hypothetical protein CICLE_v10016441mg             139   5e-36    
ref|XP_011071875.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    140   5e-36    
gb|KJB66751.1|  hypothetical protein B456_010G156200                    139   5e-36    
gb|EPS71510.1|  hypothetical protein M569_03248                         139   5e-36    
ref|NP_001150941.1|  LOC100284574                                       140   5e-36    
gb|KHN08459.1|  GDSL esterase/lipase                                    139   5e-36    
ref|XP_007036238.1|  SGNH hydrolase-type esterase superfamily pro...    139   6e-36    
ref|XP_006467677.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     139   6e-36    
ref|NP_001152447.1|  LOC100286087                                       139   7e-36    
gb|EAY73011.1|  hypothetical protein OsI_00883                          138   8e-36    
ref|XP_004241526.1|  PREDICTED: GDSL esterase/lipase At5g62930          139   8e-36    
ref|XP_010915596.1|  PREDICTED: GDSL esterase/lipase At5g45920          138   8e-36    
ref|XP_002316837.1|  GDSL-motif lipase/hydrolase family protein         138   9e-36    
ref|XP_011045900.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     138   9e-36    
ref|XP_010087681.1|  GDSL esterase/lipase                               140   9e-36    
ref|XP_002511388.1|  Isoamyl acetate-hydrolyzing esterase, putative     137   2e-35    
emb|CDP12424.1|  unnamed protein product                                137   2e-35    
ref|XP_010940177.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    137   3e-35    
ref|XP_010277729.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     137   4e-35    
ref|NP_001242316.1|  uncharacterized protein LOC100783724               136   5e-35    
ref|XP_009363004.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    136   6e-35    
ref|XP_002447541.1|  hypothetical protein SORBIDRAFT_06g003040          137   6e-35    
ref|XP_009347813.1|  PREDICTED: GDSL esterase/lipase At5g45920          136   8e-35    
ref|XP_006394335.1|  hypothetical protein EUTSA_v10004836mg             135   8e-35    
ref|XP_008783917.1|  PREDICTED: GDSL esterase/lipase At5g45920          135   8e-35    
ref|XP_006439835.1|  hypothetical protein CICLE_v10021880mg             135   9e-35    
ref|XP_009628365.1|  PREDICTED: GDSL esterase/lipase At5g45920          135   9e-35    
ref|XP_009783081.1|  PREDICTED: GDSL esterase/lipase At5g45920          135   1e-34    
ref|XP_008369401.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        131   1e-34    
gb|AFC88008.1|  isoamyl acetate-hydrolyzing esterase like-protein       135   1e-34    
ref|XP_002305087.1|  hypothetical protein POPTR_0004s05300g             135   1e-34    
ref|XP_009390673.1|  PREDICTED: GDSL esterase/lipase At5g45920-li...    134   2e-34    
gb|ABK96494.1|  unknown                                                 134   3e-34    
gb|EMT18225.1|  GDSL esterase/lipase                                    135   4e-34    
ref|XP_008371448.1|  PREDICTED: GDSL esterase/lipase At5g45920          133   1e-33    
ref|XP_006852496.1|  hypothetical protein AMTR_s00021p00148410          133   1e-33    
ref|XP_007148071.1|  hypothetical protein PHAVU_006G178200g             132   1e-33    
ref|XP_007140332.1|  hypothetical protein PHAVU_008G103500g             130   2e-33    
ref|XP_010678779.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    132   2e-33    
gb|KDP21065.1|  hypothetical protein JCGZ_21536                         132   2e-33    
ref|XP_003604687.1|  GDSL esterase/lipase                               136   2e-33    
ref|XP_006347451.1|  PREDICTED: GDSL esterase/lipase At5g62930-like     132   3e-33    
ref|XP_009795731.1|  PREDICTED: GDSL esterase/lipase At5g62930          131   4e-33    
ref|XP_009603625.1|  PREDICTED: GDSL esterase/lipase At5g62930          131   5e-33    
ref|XP_006476789.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    130   7e-33    
gb|AFK48807.1|  unknown                                                 129   3e-32    
gb|KJB53161.1|  hypothetical protein B456_008G295700                    128   6e-32    
gb|EPS70336.1|  hypothetical protein M569_04424                         130   6e-32    
gb|EYU22118.1|  hypothetical protein MIMGU_mgv1a012406mg                128   9e-32    
ref|XP_005646922.1|  putative esterase                                  128   9e-32    
ref|XP_010108429.1|  GDSL esterase/lipase                               129   1e-31    
ref|XP_011027714.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     127   1e-31    
ref|XP_002522541.1|  Isoamyl acetate-hydrolyzing esterase, putative     127   2e-31    
gb|KJB76948.1|  hypothetical protein B456_012G114000                    124   2e-31    
ref|XP_002437859.1|  hypothetical protein SORBIDRAFT_10g003880          127   2e-31    
ref|XP_003561087.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     127   2e-31    
gb|ACR33949.1|  unknown                                                 126   3e-31    
gb|EYU28057.1|  hypothetical protein MIMGU_mgv1a012742mg                126   3e-31    
gb|ACN26875.1|  unknown                                                 126   3e-31    
ref|XP_008812702.1|  PREDICTED: GDSL esterase/lipase At5g62930          126   3e-31    
gb|KFO95900.1|  Isoamyl acetate-hydrolyzing esterase 1                  125   4e-31    
gb|KFQ51878.1|  Isoamyl acetate-hydrolyzing esterase 1                  125   7e-31    
gb|KFP45039.1|  Isoamyl acetate-hydrolyzing esterase 1                  124   9e-31    
ref|XP_009390674.1|  PREDICTED: GDSL esterase/lipase At5g45920-li...    124   1e-30    
gb|EOB05341.1|  Isoamyl acetate-hydrolyzing esterase 1-like protein     124   1e-30    
gb|EMC90281.1|  Isoamyl acetate-hydrolyzing esterase 1 like protein     124   2e-30    
ref|XP_005014159.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    124   2e-30    
gb|KFM05031.1|  Isoamyl acetate-hydrolyzing esterase 1                  124   2e-30    
gb|KFW73090.1|  Isoamyl acetate-hydrolyzing esterase 1                  123   2e-30    
gb|KFV16916.1|  Isoamyl acetate-hydrolyzing esterase 1                  123   3e-30    
ref|XP_011279629.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    124   3e-30    
ref|XP_009481689.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    123   4e-30    
gb|KFU90787.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   5e-30    
gb|KFP26684.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   5e-30    
gb|KFQ76922.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   6e-30    
gb|KFO05674.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   6e-30    
ref|XP_007904673.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   7e-30    
gb|KFP65417.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   7e-30    
dbj|BAJ98025.1|  predicted protein                                      122   7e-30    
gb|KFW93879.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   7e-30    
gb|KFQ41287.1|  Isoamyl acetate-hydrolyzing esterase 1                  122   7e-30    
ref|XP_010125116.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   8e-30    
ref|XP_009273893.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    123   8e-30    
ref|XP_004156812.1|  PREDICTED: GDSL esterase/lipase At5g62930-li...    124   9e-30    
ref|XP_009330786.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    123   1e-29    
ref|XP_009983078.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   1e-29    
gb|KFQ97247.1|  Isoamyl acetate-hydrolyzing esterase 1                  121   1e-29    
ref|XP_009997539.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   1e-29    
ref|XP_006976680.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   1e-29    
ref|NP_001094010.1|  isoamyl acetate-hydrolyzing esterase 1 homolog     122   1e-29    
ref|XP_005506962.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   2e-29    
gb|KFP16741.1|  Isoamyl acetate-hydrolyzing esterase 1                  121   2e-29    
ref|XP_008454264.1|  PREDICTED: GDSL esterase/lipase At5g62930 is...    123   2e-29    
ref|XP_005849832.1|  hypothetical protein CHLNCDRAFT_21393              121   2e-29    
gb|KFW03275.1|  Isoamyl acetate-hydrolyzing esterase 1                  121   2e-29    
gb|KFQ34513.1|  Isoamyl acetate-hydrolyzing esterase 1                  120   2e-29    
gb|KFV84083.1|  Isoamyl acetate-hydrolyzing esterase 1                  121   2e-29    
ref|XP_009678657.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   3e-29    
ref|XP_010204524.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   3e-29    
ref|XP_010287332.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   3e-29    
gb|KFQ12948.1|  Isoamyl acetate-hydrolyzing esterase 1                  120   3e-29    
ref|NP_001148234.1|  carboxylic ester hydrolase/ hydrolase, actin...    121   3e-29    
ref|XP_008493640.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    122   3e-29    
ref|XP_003514172.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    121   4e-29    
gb|KFQ85523.1|  Isoamyl acetate-hydrolyzing esterase 1                  120   4e-29    
ref|XP_010305037.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   4e-29    
ref|XP_009699234.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   4e-29    
ref|XP_003757923.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   5e-29    
ref|XP_009508292.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   5e-29    
ref|XP_010018458.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   5e-29    
ref|XP_005905572.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   5e-29    
gb|ERE68388.1|  putative isoamyl acetate-hydrolyzing esterase 1 l...    121   5e-29    
ref|XP_005432313.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   6e-29    
ref|XP_005238264.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   6e-29    
gb|ERE68389.1|  putative isoamyl acetate-hydrolyzing esterase 1 l...    121   7e-29    
ref|XP_006073849.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   7e-29    
ref|XP_003787429.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   9e-29    
ref|XP_004005727.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   9e-29    
ref|XP_010850350.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    121   9e-29    
ref|XP_009638081.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   9e-29    
ref|XP_004609425.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   9e-29    
ref|XP_007098294.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    121   1e-28    
gb|KGL99861.1|  Isoamyl acetate-hydrolyzing esterase 1                  119   1e-28    
ref|XP_006898264.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-28    
ref|XP_009574208.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-28    
ref|XP_003639653.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-28    
gb|KFQ26831.1|  Isoamyl acetate-hydrolyzing esterase 1                  118   1e-28    
gb|KFZ68114.1|  Isoamyl acetate-hydrolyzing esterase 1                  119   1e-28    
ref|XP_010808553.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-28    
ref|XP_010181553.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-28    
ref|NP_001029930.1|  isoamyl acetate-hydrolyzing esterase 1 homolog     119   2e-28    
ref|NP_080623.2|  isoamyl acetate-hydrolyzing esterase 1 homolog        119   2e-28    
ref|XP_009951607.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    118   2e-28    
gb|KFP52293.1|  Isoamyl acetate-hydrolyzing esterase 1                  118   2e-28    
ref|XP_010724629.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    118   2e-28    
ref|XP_009463738.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    121   2e-28    
dbj|BAD69418.1|  putative CPRD49                                        119   2e-28    
ref|XP_005967892.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   2e-28    
ref|XP_005153299.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   2e-28    
ref|XP_005687076.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   2e-28    
gb|AFW75574.1|  carboxylic ester hydrolase/ hydrolase, acting on ...    119   2e-28    
ref|XP_005404453.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    120   2e-28    
gb|KFR16560.1|  Isoamyl acetate-hydrolyzing esterase 1                  118   3e-28    
ref|XP_003215454.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   3e-28    
gb|KFQ09279.1|  Isoamyl acetate-hydrolyzing esterase 1                  117   3e-28    
gb|KFO84681.1|  Isoamyl acetate-hydrolyzing esterase 1                  117   6e-28    
ref|XP_004457261.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   6e-28    
ref|XP_010877957.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   6e-28    
gb|KFV41737.1|  Isoamyl acetate-hydrolyzing esterase 1                  117   6e-28    
gb|KFO82185.1|  Isoamyl acetate-hydrolyzing esterase 1                  117   7e-28    
ref|XP_008935490.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   8e-28    
gb|KGL83618.1|  Isoamyl acetate-hydrolyzing esterase 1                  117   8e-28    
ref|XP_008647829.1|  PREDICTED: carboxylic ester hydrolase/ hydro...    117   8e-28    
ref|XP_003551554.1|  PREDICTED: GDSL esterase/lipase CPRD49-like        115   8e-28    
ref|XP_001381175.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   1e-27    
ref|NP_001264658.1|  isoamyl acetate-hydrolyzing esterase 1 homolog     117   1e-27    
ref|XP_009567350.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   1e-27    
ref|XP_005082067.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   1e-27    
ref|XP_008069387.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    119   1e-27    
ref|XP_008593018.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   1e-27    
ref|XP_003411926.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    117   2e-27    
ref|XP_010222196.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_002935071.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_009923776.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   2e-27    
ref|XP_006765232.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_008930951.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_005287798.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_010564987.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   2e-27    
ref|XP_005287799.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   3e-27    
ref|XP_004875301.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   3e-27    
ref|XP_009891569.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   3e-27    
ref|XP_006140913.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   3e-27    
ref|XP_009836529.1|  hypothetical protein H257_11332                    115   3e-27    
ref|XP_006018474.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    116   3e-27    
ref|XP_004964805.1|  PREDICTED: GDSL esterase/lipase At5g45920-like     115   3e-27    
ref|XP_010133787.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   3e-27    
ref|XP_006197160.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   3e-27    
ref|XP_007127716.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   4e-27    
ref|XP_009807529.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   4e-27    
ref|NP_001134853.1|  isoamyl acetate-hydrolyzing esterase 1 homolog     115   4e-27    
ref|XP_010962335.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   4e-27    
gb|KFW88879.1|  Isoamyl acetate-hydrolyzing esterase 1                  115   4e-27    
emb|CDQ65514.1|  unnamed protein product                                115   4e-27    
ref|XP_004436511.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   4e-27    
ref|XP_009940371.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   5e-27    
ref|XP_006626246.1|  PREDICTED: isoamyl acetate-hydrolyzing ester...    115   5e-27    



>ref|XP_009796830.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Nicotiana sylvestris]
Length=254

 Score =   338 bits (867),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 203/236 (86%), Gaps = 2/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  +GWGA+LAD+Y+R+AD+VLRGY+GWNSRCALQVLD+VFPK+A VQPSLVIVYFG
Sbjct  19   QFSYSYQGWGAILADLYARKADIVLRGYAGWNSRCALQVLDEVFPKDAAVQPSLVIVYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSGL+AHVPLPEYVENMRKIAIHLKSLS+KT+IIFLS P +NEA+  EVFG 
Sbjct  79   GNDSMEPHPSGLSAHVPLPEYVENMRKIAIHLKSLSEKTQIIFLSAPTVNEAQITEVFGD  138

Query  407  -LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             LGRSN+  RKYSEACI+LC++L VKVIDLW  LQQRDDWL  CFTDGIHL+SEGSK+VV
Sbjct  139  GLGRSNDSCRKYSEACIQLCQELGVKVIDLWKTLQQRDDWLTACFTDGIHLSSEGSKLVV  198

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            KEILKVLKEA+WEP+LHW+SL  E  E SP IF+ P  +T +N SQL   WQ QW+
Sbjct  199  KEILKVLKEAEWEPNLHWRSLPIEFPEISPYIFVDPKGETAVNVSQLDLQWQTQWH  254



>ref|XP_009614614.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Nicotiana 
tomentosiformis]
Length=251

 Score =   338 bits (866),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 173/236 (73%), Positives = 202/236 (86%), Gaps = 2/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  +GWGA+L D+Y+R+AD+VLRGY+GWNSRCALQVLDQVFPK+A VQPSLVIVYFG
Sbjct  16   QFSYSYQGWGAILTDLYARKADIVLRGYAGWNSRCALQVLDQVFPKDAAVQPSLVIVYFG  75

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL+AHVPLPEYVENMRKIAIHLKSLS+KTRIIFLS P +NEA+  E+ G 
Sbjct  76   GNDSVEPHPSGLSAHVPLPEYVENMRKIAIHLKSLSEKTRIIFLSAPAVNEAQITEIHGN  135

Query  407  -LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             L RSN+  RKYSEACI+LC++L VKVIDLWT LQQRDDWL  CFTDGIHL+SEGSK+VV
Sbjct  136  GLDRSNDSCRKYSEACIQLCQELGVKVIDLWTTLQQRDDWLTACFTDGIHLSSEGSKLVV  195

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            KEILKV+KEA+WEP+LHW+SL  E  E SP IF+GP  +T +N SQL   WQ QW+
Sbjct  196  KEILKVVKEAEWEPNLHWRSLPIEFPEISPYIFVGPKGETAVNVSQLDLEWQTQWH  251



>ref|XP_006365593.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum tuberosum]
Length=253

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 198/236 (84%), Gaps = 2/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF  +GWGA+L D+Y+ +AD++LRGY+GWNSRCALQVLD+VFPK+A VQPSLVIVYFG
Sbjct  18   QFSFSHQGWGAILTDLYACKADILLRGYAGWNSRCALQVLDEVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSGL AHVPLPEYVENMRKIAIHLKSLS KTRIIFL+ PP+NEA+  EVFG 
Sbjct  78   GNDSMEPHPSGLGAHVPLPEYVENMRKIAIHLKSLSHKTRIIFLTAPPVNEAQMAEVFGN  137

Query  407  -LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             LGRSNE  RKYS+AC++LC++L VKVIDLW ALQQRDDWL  CFTDGIHL+ EGS+IV+
Sbjct  138  DLGRSNESCRKYSDACVQLCQELGVKVIDLWKALQQRDDWLTACFTDGIHLSCEGSEIVI  197

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            KEILKV+KEADWEP+LHW+SL  E  E SP IF+ P   T I  S++ F WQ QW 
Sbjct  198  KEILKVIKEADWEPNLHWRSLPTEFPEISPCIFVDPEGSTAIKVSEMDFAWQTQWQ  253



>ref|XP_006349457.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum tuberosum]
Length=250

 Score =   314 bits (804),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 194/234 (83%), Gaps = 3/234 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  EGWG++L D+YS +AD+VLRGY GWN+R ALQVLDQ+FPK+A VQPSLVIVYFG
Sbjct  18   QFSYSHEGWGSILTDLYSCKADIVLRGYGGWNTRLALQVLDQIFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM PDP+G NAHVPL EY++NM+ I +HLKSLS+KTRI+ LS PP+NE + +++FG+
Sbjct  78   GNDSMKPDPNGQNAHVPLLEYIQNMKNIVLHLKSLSEKTRILVLSTPPVNEEQIIKLFGS  137

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
              RSNE    YSEACI++C++L +KVIDLWTALQ RDDWL   FTDG+HLT+E SK+VVK
Sbjct  138  SQRSNESSHIYSEACIKMCQELGIKVIDLWTALQNRDDWLTAHFTDGVHLTAEASKVVVK  197

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            EILKV+KEADWEP+LHW+SL NE ++ SP IF+GPN  TP+N + L   WQ QW
Sbjct  198  EILKVVKEADWEPNLHWKSLPNEFAQYSPTIFVGPNGNTPVNVADLD--WQAQW  249



>emb|CDP06486.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   313 bits (802),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/237 (69%), Positives = 191/237 (81%), Gaps = 4/237 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+ Q+G+GA+L D+Y+R+AD++LRGY+GWNSR ALQVL+QVFPK+A VQPSLVIVYFG
Sbjct  18   QFSYSQDGFGAILTDVYARKADILLRGYAGWNSRGALQVLEQVFPKHAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM PDPSG   HVPL EYVENM+KIA HLKSLSDKTR++FLS PP+NEA+  E FG 
Sbjct  78   GNDSMRPDPSGQGPHVPLAEYVENMKKIAFHLKSLSDKTRVLFLSTPPVNEAQICEFFGR  137

Query  410  ---TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NE  R YSEACI+LC++LD+KV+DLWTALQQRD+WL  CF DGIHL+SE SK
Sbjct  138  TCDQLCRTNESCRIYSEACIKLCRELDIKVVDLWTALQQRDNWLDVCFVDGIHLSSEASK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            IVVKEILKVLKEA WEP LHW+SL  E SE SP   IGP     N + L  +WQ QW
Sbjct  198  IVVKEILKVLKEAQWEPCLHWKSLPTEFSEDSPYDVIGPGGDTKNVADLNLHWQIQW  254



>ref|XP_009614615.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Nicotiana 
tomentosiformis]
Length=217

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = -3

Query  707  ADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPE  528
            AD+VLRGY+GWNSRCALQVLDQVFPK+A VQPSLVIVYFGGNDS+ P PSGL+AHVPLPE
Sbjct  2    ADIVLRGYAGWNSRCALQVLDQVFPKDAAVQPSLVIVYFGGNDSVEPHPSGLSAHVPLPE  61

Query  527  YVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT-LGRSNELGRKYSEACIELC  351
            YVENMRKIAIHLKSLS+KTRIIFLS P +NEA+  E+ G  L RSN+  RKYSEACI+LC
Sbjct  62   YVENMRKIAIHLKSLSEKTRIIFLSAPAVNEAQITEIHGNGLDRSNDSCRKYSEACIQLC  121

Query  350  KQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQS  171
            ++L VKVIDLWT LQQRDDWL  CFTDGIHL+SEGSK+VVKEILKV+KEA+WEP+LHW+S
Sbjct  122  QELGVKVIDLWTTLQQRDDWLTACFTDGIHLSSEGSKLVVKEILKVVKEAEWEPNLHWRS  181

Query  170  LANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            L  E  E SP IF+GP  +T +N SQL   WQ QW+
Sbjct  182  LPIEFPEISPYIFVGPKGETAVNVSQLDLEWQTQWH  217



>ref|XP_010327727.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum lycopersicum]
Length=252

 Score =   310 bits (795),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/234 (66%), Positives = 192/234 (82%), Gaps = 1/234 (0%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  EGWG++L D+YS +AD+VLRGY GWN+R AL VLDQ+FPK+A +QPSLVIVYFG
Sbjct  18   QFSYSHEGWGSILTDLYSCKADIVLRGYGGWNTRLALLVLDQIFPKDATIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM PDP+GLNAHVPL EY++NM+ I +H+KSLS+KTRII LS PP+NE + +++FG 
Sbjct  78   GNDSMKPDPNGLNAHVPLLEYIQNMKNIVLHIKSLSEKTRIIVLSTPPVNEEKIIKLFGI  137

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
              RSNE    YSEACI++CK+L +KVIDLWTALQ R+DWL   FTDGIHLT+E SK+VVK
Sbjct  138  SRRSNESSHIYSEACIKMCKELGIKVIDLWTALQNRNDWLSAHFTDGIHLTAEASKVVVK  197

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            EILKV+KEADWEP+LHW+SL NE ++ SP IF+G +  TP+N + L   WQ QW
Sbjct  198  EILKVVKEADWEPNLHWKSLPNEFAQCSPTIFVGTDGNTPLNVADLDLDWQAQW  251



>ref|XP_002280296.1| PREDICTED: GDSL esterase/lipase CPRD49 [Vitis vinifera]
 emb|CBI30390.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   310 bits (794),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 195/239 (82%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  +GWGA+LAD+Y+R+ADVVLRGYSGWNSR ALQVLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QFSYSNQGWGAILADLYARKADVVLRGYSGWNSRRALQVLDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P PSGL  HVPLPEYVENM+KIA+HLKSLS++TR+IFLS PPINEA+  E    
Sbjct  78   GNDSMHPHPSGLGPHVPLPEYVENMKKIAVHLKSLSEQTRVIFLSAPPINEAQIRETLSG  137

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              GTLGR+NE    YSEAC+ELCK++ VK IDLWTA+QQ+DDWL  CFTDGIHL+SEGSK
Sbjct  138  RLGTLGRTNECCGIYSEACLELCKEVGVKAIDLWTAIQQQDDWLNVCFTDGIHLSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGP-NKTPINTSQLTFYWQPQWN  66
            +VVKEILKVL+EA+WEPSLHW+SL +E  + SP     P  KT +  + +  + + +WN
Sbjct  198  VVVKEILKVLEEAEWEPSLHWKSLPSEFDDDSPYNPGSPVGKTTLKVADINLHREIEWN  256



>ref|XP_008801963.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Phoenix dactylifera]
Length=267

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF  EGWGA LADIY+R+AD++LRGY+GWNSR ALQV+D++FPK+A VQPSLVIVYFG
Sbjct  29   QFSFSNEGWGATLADIYARKADILLRGYAGWNSRLALQVIDKIFPKDAAVQPSLVIVYFG  88

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA--RALE--  420
            GNDSM P PSGL  HVPLPEY+ENM +IA HLKSLS+KTRIIFLSCPPINE   R L   
Sbjct  89   GNDSMGPHPSGLGPHVPLPEYIENMTRIAEHLKSLSEKTRIIFLSCPPINEEMLRQLRSP  148

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            V G + RSNEL RKYSEACI+LC  +D+KV+DLWTA+Q+RDDW   CFTDGIH +SEGSK
Sbjct  149  VLGEIVRSNELCRKYSEACIQLCNDMDLKVVDLWTAIQKRDDWATVCFTDGIHFSSEGSK  208

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+WEPSLHW+SL  E  E S    +  +  +  N S+ TF+ + QW+
Sbjct  209  IVVAEILKVLKEAEWEPSLHWKSLPTEFGEDSRYYLVASDGASTFNPSEWTFHREIQWD  267



>ref|XP_010925101.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Elaeis guineensis]
Length=256

 Score =   306 bits (783),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF  EGWGA LADIY+R+AD++LRGY GWNSR ALQV+D++FPK+A VQPSLVIVYFG
Sbjct  18   QFSFSNEGWGATLADIYARKADILLRGYCGWNSRRALQVIDKIFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P PSGL  HVPLPEY+ENM +IA HLKSLS+KTRIIFLSCPPINE    ++   
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYIENMNRIAKHLKSLSEKTRIIFLSCPPINEEMVCQLESP  137

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              G + R+NEL RKYSEACI+LC  +D+KVIDLWTA+Q+RDDW   CFTDGIH +SEGSK
Sbjct  138  FIGKIERTNELCRKYSEACIQLCNDMDLKVIDLWTAMQKRDDWATVCFTDGIHFSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+WEPSLHW+SL  E +E SP   +  +  +  N S+ T + + QW+
Sbjct  198  IVVAEILKVLKEAEWEPSLHWKSLPTEFAEDSPYYLVASDGLSTFNPSEWTSHREIQWD  256



>ref|XP_006338850.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum tuberosum]
Length=256

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 192/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+L+DIY+R+ADV+LRGY GWNSR A+QVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QISYSNGGWGAILSDIYARKADVLLRGYYGWNSRRAIQVLDQVFPKDATVQPTLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+ENMRKIA HLKSLS+  RIIFLSCPP++EAR  E    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRKIATHLKSLSENIRIIFLSCPPVDEARIRENTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R+YSEACIELCK++++KV+DLWTALQ+R+DWL  CFTDGIHL  EGSK
Sbjct  138  YFSELVRTNELCRQYSEACIELCKEMNLKVVDLWTALQKREDWLAACFTDGIHLAEEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+W PSLHW+S+A E  E SP  + +   K+ IN S  T++ Q QW+
Sbjct  198  IVVEEILKVLKEAEWTPSLHWKSMATEFPEDSPYDLVLADGKSTINPSDWTYHRQIQWD  256



>ref|XP_004240943.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322203.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Solanum 
lycopersicum]
Length=256

 Score =   305 bits (780),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/239 (67%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+L+DIY+R+AD++LRGY GWNSR A+QVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QISYSNGGWGAILSDIYARKADILLRGYYGWNSRRAIQVLDQVFPKDATVQPTLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+ENMRKIA HLKS+S+  RIIFLSCPP++EAR  E    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRKIATHLKSISENIRIIFLSCPPVDEARIRENTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R+YSEACIELCK++++KV+DLWTALQ+R DWL  CFTDGIHL  EGSK
Sbjct  138  YFSELVRTNELCRQYSEACIELCKEMNLKVVDLWTALQKRKDWLTACFTDGIHLAEEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+W PSLHW+S+A E  E SP  + +   KT IN S  T++ Q QW+
Sbjct  198  IVVEEILKVLKEAEWTPSLHWKSMATEFPEDSPYDLVLADGKTTINPSDWTYHRQIQWD  256



>ref|XP_006481035.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Citrus 
sinensis]
Length=255

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 187/234 (80%), Gaps = 6/234 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+ FG EGWGA+LAD+Y+R+AD++LRGY+GWNSR A+QVLD+VFPK++ VQPSLVIVYFG
Sbjct  18   QYGFGNEGWGAILADLYARKADILLRGYAGWNSRRAVQVLDRVFPKDSAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSMLP  +GL  HVPLPEY+ENMRKIA+HLKSLS KTRIIFLS PPIN+ +  E    
Sbjct  78   GNDSMLPHSTGLGPHVPLPEYIENMRKIALHLKSLSAKTRIIFLSAPPINKQQIFESHLS  137

Query  416  --FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
              F   GR+NE  R YSEAC++LC+++DVK IDLWTA+QQRDDWL TCF DGIH +SEGS
Sbjct  138  TDFAVWGRTNESCRIYSEACLKLCQEMDVKAIDLWTAMQQRDDWLTTCFMDGIHFSSEGS  197

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFY  84
            KIVV EILKVL+EADWEPSLHW+SL  E  E S    + P+ ++ +N S    Y
Sbjct  198  KIVVTEILKVLREADWEPSLHWRSLPTEFDEDSSYYPVAPDGQSTVNVSDTNIY  251



>ref|XP_007163538.1| hypothetical protein PHAVU_001G242700g [Phaseolus vulgaris]
 gb|ESW35532.1| hypothetical protein PHAVU_001G242700g [Phaseolus vulgaris]
Length=256

 Score =   303 bits (776),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/239 (67%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA L+DIYSR+AD+VLRGY GWNSR AL+V+DQVFPK+A  QPSLVIVYFG
Sbjct  18   QLSFGHGGWGAHLSDIYSRKADIVLRGYYGWNSRRALEVMDQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPLPEY+ENMRKI IH++ LS++TRII LSCPP+NE +       
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRKILIHIQGLSERTRIIVLSCPPVNEEKVRGNTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            V   L R+NEL + YSEACI+LCK+LDVKV+DL+TALQ+RDDW   CFTDGIHL +EGSK
Sbjct  138  VLSELVRTNELCQSYSEACIKLCKELDVKVVDLFTALQKRDDWRNACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEIL VLKEADWEP LHW+SL+ E SE SP   +  + KT +N S+ TFY + QW+
Sbjct  198  IVVKEILSVLKEADWEPCLHWKSLSTEFSENSPYDLVAADGKTTLNPSEWTFYREIQWD  256



>ref|XP_010253884.1| PREDICTED: GDSL esterase/lipase CPRD49 [Nelumbo nucifera]
Length=256

 Score =   302 bits (774),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA+LADIY+R+AD+++RGYSGWNSR ALQV+DQVFPK+A VQPSLVIVYFG
Sbjct  18   QFSFANGGWGAILADIYARKADILVRGYSGWNSRRALQVVDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEYVENMRKIA HLKSLS+ TRIIFLSCPP+NE    +    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYVENMRKIAFHLKSLSENTRIIFLSCPPVNEEVVRKGTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NE   +YS+AC+ELC+++DVK +DL+ A+Q+RDDW+  CFTDGIH ++EGSK
Sbjct  138  IFSEIDRTNEACHRYSDACLELCREIDVKAVDLFNAIQKRDDWMNVCFTDGIHFSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EIL++LKEA+WEP LHW+SL  E  E SP   +  + KT IN S+ TF+ + QW+
Sbjct  198  IVVEEILRILKEAEWEPCLHWKSLPTEFGEDSPCDMVAADGKTTINISECTFHREIQWD  256



>ref|XP_010924206.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Elaeis guineensis]
Length=256

 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF  EGWG++LADIYSR+AD+ LRGY+GWN+R ALQV+D++FPK+A VQPSLVIVYFG
Sbjct  18   QFSFSNEGWGSILADIYSRKADIFLRGYAGWNTRRALQVIDKIFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPLPEY+ENM +IA HLKSLS+KTRIIFLSCPPI+E    +    
Sbjct  78   GNDSMAPHPSGLGPHVPLPEYIENMSRIAKHLKSLSEKTRIIFLSCPPISEEMLHQSTSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   + R+NE  RKYSEACI+LCK +D+KVIDLWTA+Q+RDDW   CFTDGIH + EGSK
Sbjct  138  ILRQVARTNETCRKYSEACIQLCKDMDLKVIDLWTAIQKRDDWATVCFTDGIHFSPEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+WEPSLHW+SL  E  E S    +  +  + IN S+ TFY + QW+
Sbjct  198  IVVEEILKVLKEAEWEPSLHWKSLPTEFGEDSLYNLVAADGISTINPSEWTFYREIQWD  256



>ref|XP_011076687.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
 ref|XP_011076688.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
Length=256

 Score =   300 bits (769),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 192/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+D+Y+R+AD++ RGY GWNSR A+Q+LDQVFPK+  +QPSLVIVYFG
Sbjct  18   QLSFSNGGWGAILSDVYARKADIITRGYYGWNSRRAVQILDQVFPKDTAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM    SGL  HVPLPEY+ENM+KIAIHLK+LSD  RIIFLSCPP+NEA+  E    
Sbjct  78   GNDSMGAHSSGLGPHVPLPEYIENMKKIAIHLKNLSDNIRIIFLSCPPVNEAKLRENTSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R YSEACIELC+++D+KVIDLWTA+Q+R+DW   CFTDG+HL++EGSK
Sbjct  138  YFSELVRTNELCRIYSEACIELCREMDLKVIDLWTAIQKREDWSNACFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EILKVLK+A+WEPSLHW+S+  E SE SP   +  + KT IN S+ TF+ + +W+
Sbjct  198  VVVEEILKVLKQAEWEPSLHWKSMPTEFSEDSPYDLVAADGKTTINPSEWTFHREIKWD  256



>gb|EYU20016.1| hypothetical protein MIMGU_mgv1a012192mg [Erythranthe guttata]
Length=259

 Score =   300 bits (767),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+DIY+R+AD++ RGY GWNSR AL++LDQVFPK+A VQPSL+IVYFG
Sbjct  21   QLSFSNGGWGAILSDIYARKADIITRGYYGWNSRRALKILDQVFPKDAAVQPSLIIVYFG  80

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM    SGL  HVPLPEY++NMRKIA HLK+LSDKTR+IFLSCPP+NE +  E    
Sbjct  81   GNDSMGAHSSGLGPHVPLPEYIDNMRKIATHLKNLSDKTRLIFLSCPPVNEVKLRENTSS  140

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R YSEACI +C+++D+KVIDLWTA+Q+R+DW   CFTDG+HL+ EGSK
Sbjct  141  YFSELVRTNELCRIYSEACINVCQEMDIKVIDLWTAIQKREDWSNACFTDGVHLSGEGSK  200

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EILKVLKEA+WEP LHW+S+A E SE SP   +  + KT IN S+ TF+   QW+
Sbjct  201  VVVEEILKVLKEAEWEPKLHWKSMATEFSEDSPYDLVASDGKTTINPSEWTFHRDIQWD  259



>gb|AFK45704.1| unknown [Lotus japonicus]
Length=256

 Score =   300 bits (767),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 188/232 (81%), Gaps = 5/232 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+LA++Y+R+AD+++RGYSGWNSR ALQVLD++FPK+A VQPSLVIVYFG
Sbjct  18   QLSYNNEGWGAILANLYARKADIIMRGYSGWNSRRALQVLDKIFPKDAVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+ P PSGL  HVPL EY ENMRKIA HLKSLS KTR+IFL+ PPINEA+  E    
Sbjct  78   GNDSIHPHPSGLGPHVPLEEYTENMRKIATHLKSLSKKTRVIFLTSPPINEAQISETLSN  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            V G + R+NE  R YSEAC+ELC++++VK IDLW+ALQQRDDWL  CFTDGIHL+SEGSK
Sbjct  138  VLGKIRRTNESCRIYSEACLELCREMNVKAIDLWSALQQRDDWLDVCFTDGIHLSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            IVVKEILKVLKEADWEPSLHW+S+  E  E SP   I  + KT +N S  +F
Sbjct  198  IVVKEILKVLKEADWEPSLHWKSMPTEFEEDSPYDPIAVDGKTTVNVSNWSF  249



>ref|XP_008800894.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Phoenix dactylifera]
Length=256

 Score =   298 bits (764),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF  EGWG +LADIY+R+AD++LRGY+GWNSR ALQV+D++FPK+A V PSLVIVYFG
Sbjct  18   QYSFSNEGWGGILADIYARKADILLRGYAGWNSRRALQVIDKIFPKDAAVHPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPLPEY+ENM KIA HLKSLS+KTRIIFLSCPP++E    +    
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYIENMSKIAKHLKSLSEKTRIIFLSCPPMSEEMLRQSTSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   L R NE  R+YSEACI +CK +D+KVIDLWTA+Q+RDDW   CFTDGIH + EGSK
Sbjct  138  ILRELARKNETCREYSEACIRVCKDMDLKVIDLWTAMQKRDDWATVCFTDGIHFSPEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-INTSQLTFYWQPQWN  66
            IV  EILKVLKEA+WEPSLHW SL  E  E SP   +  + T  IN S+ TFY + QW+
Sbjct  198  IVAAEILKVLKEAEWEPSLHWTSLPTEFGEDSPYNPVTADGTSTINPSEWTFYRKIQWD  256



>ref|XP_009629949.1| PREDICTED: GDSL esterase/lipase CPRD49 [Nicotiana tomentosiformis]
Length=256

 Score =   298 bits (763),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWG++L+DIY+R+ADV+LRGY GWNSR ALQVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QISYSNGGWGSILSDIYARKADVILRGYYGWNSRRALQVLDQVFPKDAAVQPTLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+ENMR IA HLKSLS+  RIIFLSCPP++EAR  E    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRIIATHLKSLSENIRIIFLSCPPVDEARVRENTSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R+YSEACIELCK++++KV+DLWTALQ+R+DW+  CFTDGIHL   GSK
Sbjct  138  YFSELVRTNELCRQYSEACIELCKEMNLKVVDLWTALQKREDWVTACFTDGIHLAEAGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            IVV+EI+K+LKEA+W PSL+W+S+  E +E SP  + +   KT IN S+ T++ + QW+
Sbjct  198  IVVEEIIKILKEAEWTPSLYWKSMPTEFAEDSPYDLVLADGKTTINPSEWTYHREIQWD  256



>ref|XP_007026708.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
 gb|EOY07210.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
Length=252

 Score =   296 bits (758),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 186/237 (78%), Gaps = 5/237 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  +GWGA+LADIY+R+AD+VLRGYSGWNSR AL+VL QVFPK+AG QPSLVIVYFG
Sbjct  18   QFSYSNQGWGAILADIYARKADIVLRGYSGWNSRRALKVLHQVFPKDAGAQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P P GL  HVPLPEYVENM+KIA+HLK LSDKTR++FLS PP+NE +  +  G 
Sbjct  78   GNDSMEPHPLGLGPHVPLPEYVENMKKIAMHLKGLSDKTRVMFLSTPPVNEEQISQTLGV  137

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
             GRSNE  + YSEAC++LCK+LDV+ IDLWTA+QQR DW   CFTDGIHL+SEGSKIV K
Sbjct  138  QGRSNEACQIYSEACLKLCKELDVEGIDLWTAIQQRADWKTACFTDGIHLSSEGSKIVAK  197

Query  227  eilkvlkEADWEPSLHWQSLANESSETS---PIIFIGPNKTPINTSQLTFYWQPQWN  66
            EILK L+EA W+PSL+W++L  E  E S   PI   G  ++ +N S+L F    QW 
Sbjct  198  EILKALREAKWKPSLYWRTLPTEFEEDSAYDPICQDG--RSTLNISELEFSRSVQWE  252



>ref|XP_009793687.1| PREDICTED: GDSL esterase/lipase CPRD49 [Nicotiana sylvestris]
Length=256

 Score =   295 bits (756),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWG++L+DIY+R+ADV+LRGY GWNSR ALQVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QISYSNGGWGSILSDIYARKADVILRGYYGWNSRRALQVLDQVFPKDAAVQPTLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+ENMRKIA HLKSLS+  RIIFLSCPP++EAR  E    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRKIATHLKSLSENIRIIFLSCPPVDEARVRENTSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R+YS+ACIELC ++++KV+DLWTALQ+R+DWL  CF+DG HL   GSK
Sbjct  138  YFSELVRTNELCRQYSDACIELCNEMNLKVVDLWTALQKREDWLTACFSDGTHLAEAGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            IVV+EI+KVLKEA+W PSL+W+S+  E +E SP  + +   KT IN S+ T++ + QW+
Sbjct  198  IVVEEIIKVLKEAEWTPSLYWKSMPTEFAEDSPYDLVLADGKTTINPSEWTYHREIQWD  256



>ref|XP_002270907.1| PREDICTED: GDSL esterase/lipase CPRD49 [Vitis vinifera]
 emb|CBI25488.3| unnamed protein product [Vitis vinifera]
Length=256

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+L+D+Y+R+AD+VLRGY GWNSR A++VL QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSYANGGWGAILSDVYARKADIVLRGYYGWNSRRAVEVLHQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+E+MR IA HL+SLSD TR+IFLSCPP+NEA+       
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIEHMRSIAAHLQSLSDTTRVIFLSCPPVNEAKVRAGVSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL R+YSEACIELC+++ VKV+DLWTA Q+RDDWL  CFTDG+HL++EGSK
Sbjct  138  IFSELVRTNELCRQYSEACIELCQEVGVKVVDLWTAFQKRDDWLNACFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIG-PNKTPINTSQLTFYWQPQWN  66
            IVV+EILKVLK A+WEPSLHW+S+  E  + SP   +    KT +N S  TF+ + QW+
Sbjct  198  IVVEEILKVLKGAEWEPSLHWKSMLTEFGDDSPYDLVAFDGKTTLNPSDWTFHREIQWD  256



>ref|XP_009400020.1| PREDICTED: GDSL esterase/lipase CPRD49 [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   295 bits (754),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 186/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+   GWGA+LAD+Y+R+AD+ LRGY GWNSR A+QVLD++FPK+A VQPSLVIVYFG
Sbjct  18   QFSYSNGGWGAILADVYARKADIFLRGYLGWNSRRAVQVLDKIFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPLPEY+ENMRKIA HLK LS+KTRIIFLS PP+NE         
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYIENMRKIATHLKGLSEKTRIIFLSSPPLNEEMLRRSRSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NE  ++YSEACIELCK++DVKV+DL+ A+Q+RDDW   CFTDGIHL+SEGSK
Sbjct  138  ALSELVRTNERCQRYSEACIELCKEMDVKVVDLYNAIQKRDDWSTACFTDGIHLSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKV+KEA+WEPSLHW+SL  E  E SP   +  +  + IN S  TF+   QW+
Sbjct  198  IVVEEILKVIKEAEWEPSLHWKSLPTEFGEDSPYDVVSSDGMSTINISNCTFHRDMQWD  256



>ref|XP_007008988.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
 gb|EOY17798.1| SGNH hydrolase-type esterase superfamily protein [Theobroma cacao]
Length=256

 Score =   294 bits (752),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y+R+AD++LRGY GWNSR A++VLD VFPK+A  QPSL+I YFG
Sbjct  18   QLSFSNGGWGAILADVYARKADILLRGYYGWNSRRAVEVLDHVFPKDAATQPSLIITYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P PSGL  HVPL EY+E+MRKIAIHLKSLSD TR+IFL+CPP++E R      E
Sbjct  78   GNDSMGPHPSGLGPHVPLNEYIEHMRKIAIHLKSLSDSTRLIFLTCPPVDEDRVSKNTSE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL +KYSEAC++LC++LDVKV+DL+TA Q+RD+W   CFTDG+HL++EGSK
Sbjct  138  FFSHLIRTNELCQKYSEACVKLCQELDVKVVDLFTAFQRRDNWTADCFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+W+PSLHW+++  E SE SP   +  + KT +N S+ TF+   QW+
Sbjct  198  IVVAEILKVLKEAEWQPSLHWKAMPTEFSEDSPYDLVAADGKTTLNPSEWTFHRAIQWD  256



>ref|XP_010044100.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW86117.1| hypothetical protein EUGRSUZ_B02812 [Eucalyptus grandis]
Length=265

 Score =   293 bits (751),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 184/228 (81%), Gaps = 5/228 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA LAD+Y+R+AD++LRGYSGWNSR AL+VL++VFPK+A  QPSLVIVYFG
Sbjct  18   QLSFGNGGWGASLADLYARKADIILRGYSGWNSRLALEVLEKVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P PSGL  HVPLPEY+ENMRKIA +LKSLSD TR+IFLS PPINE +  E    
Sbjct  78   GNDSMRPHPSGLGPHVPLPEYIENMRKIAKYLKSLSDCTRVIFLSAPPINEEKIRESLSD  137

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  LGR+N+  R YSEAC++LC+++++K +DLWTA+Q+RDDW   CFTDGIH +SE S+
Sbjct  138  KFQDLGRTNDACRVYSEACLKLCREMNIKAVDLWTAIQKRDDWATACFTDGIHFSSEASE  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTS  99
            IVV+EIL+VLKEADWEPSL+W+S+  E  E SP   +GP+ KT +N S
Sbjct  198  IVVEEILRVLKEADWEPSLYWESMPAEFGEDSPYYPVGPDGKTTVNLS  245



>ref|XP_010543730.1| PREDICTED: GDSL esterase/lipase CPRD49 [Tarenaya hassleriana]
 ref|XP_010543731.1| PREDICTED: GDSL esterase/lipase CPRD49 [Tarenaya hassleriana]
Length=256

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 192/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+ADV+LRGY GWNSR A++V+D+VFPK+A VQPSLVIVYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADVILRGYYGWNSRRAVEVVDKVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYVENMRKIA+HLKSLSD TRII LSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLNEYVENMRKIALHLKSLSDSTRIIVLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL +KYS+AC++LCK+L ++V+DL++ LQ+ DDW   CFTDGIHL++EGSK
Sbjct  138  YLSEVIRTNELCQKYSDACVDLCKELGLQVVDLFSTLQKPDDWETVCFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W+PSLHW+S+  E SE SP   +  + K+ +N+S+ T++W  QW+
Sbjct  198  LVAAEILRVIKEAEWDPSLHWKSMPTEFSENSPYDLVSADGKSTLNSSEWTYFWDHQWD  256



>gb|KHN36379.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=256

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+ L+DIYSR+AD++LRGY GWNSR ALQ+L QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSFSHGGWGSHLSDIYSRKADILLRGYYGWNSRRALQILYQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKI IH++ LS+KTRII LSCPP+NE +       
Sbjct  78   GNDSMGPHFSGLGPHVPLHEYIENMRKILIHIQGLSEKTRIIVLSCPPVNEEKVRANTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL + YSEACI+LCK+LDVKV+DL+ ALQ+RDDW+  CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELCQSYSEACIKLCKELDVKVVDLFNALQKRDDWMNVCFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEIL+VLKEADWEP LHW+SL  E +E SP   +  + KT +N S+ TFY + QW+
Sbjct  198  IVVKEILRVLKEADWEPCLHWKSLPTEFAEDSPYDLVAADGKTTLNPSEWTFYREIQWD  256



>ref|XP_011095009.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
Length=258

 Score =   292 bits (748),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 187/238 (79%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+LAD+Y+R+AD VLRGYSGWN+R ALQVLDQVFPK+A VQPSLV+VYFG
Sbjct  18   QMSYNIGGWGAILADLYARKADFVLRGYSGWNTRMALQVLDQVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+    PSGL AHVPLPE+VENMRKI  H+KSLSDKTR+I LS PP+NEA+  E+FG 
Sbjct  78   GNDATKAHPSGLGAHVPLPEFVENMRKIIDHIKSLSDKTRVICLSSPPVNEAKIHEIFGN  137

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE  R YSEA +ELC+++DV+ I+LWTA+QQRDDW   CF DGIHL+++GSK
Sbjct  138  ALDDQARTNEGCRIYSEALVELCQEMDVEAINLWTAIQQRDDWANACFIDGIHLSADGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKE+LKVLK+ADWEPSL+W S+ +E  E SP   +GP+ KT +N S     WQ +W
Sbjct  198  IVVKEMLKVLKKADWEPSLYWLSMPSEFPEDSPYYVVGPDGKTTVNVSGHICTWQKEW  255



>ref|NP_001242351.1| uncharacterized protein LOC100803959 [Glycine max]
 gb|ACU24024.1| unknown [Glycine max]
Length=256

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+ L+DIYSR+AD++LRGY GWNSR ALQ+L QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSFSHGGWGSHLSDIYSRKADILLRGYYGWNSRRALQILYQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKI IH++ LS+KTRII LSCPP+NE +       
Sbjct  78   GNDSMGPHFSGLGPHVPLHEYIENMRKILIHIQGLSEKTRIIVLSCPPVNEEKVRANTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL + YSEACI+LCK+LDVKV+DL+ ALQ+RDDW+  CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELWQSYSEACIKLCKELDVKVVDLFNALQKRDDWMNVCFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEIL+VLK+ADWEP LHW+SL  E +E SP   +  + KT +N S+ TFY + QW+
Sbjct  198  IVVKEILRVLKKADWEPCLHWKSLPTEFAEDSPYDLVAADGKTTLNPSEWTFYREIQWD  256



>ref|XP_006481036.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Citrus 
sinensis]
Length=250

 Score =   291 bits (746),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 183/234 (78%), Gaps = 11/234 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+ FG EGWGA+LAD+Y+R+AD++LRGY+GWNSR A+QVLD+VFPK     PSLVIVYFG
Sbjct  18   QYGFGNEGWGAILADLYARKADILLRGYAGWNSRRAVQVLDRVFPK-----PSLVIVYFG  72

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSMLP  +GL  HVPLPEY+ENMRKIA+HLKSLS KTRIIFLS PPIN+ +  E    
Sbjct  73   GNDSMLPHSTGLGPHVPLPEYIENMRKIALHLKSLSAKTRIIFLSAPPINKQQIFESHLS  132

Query  416  --FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
              F   GR+NE  R YSEAC++LC+++DVK IDLWTA+QQRDDWL TCF DGIH +SEGS
Sbjct  133  TDFAVWGRTNESCRIYSEACLKLCQEMDVKAIDLWTAMQQRDDWLTTCFMDGIHFSSEGS  192

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFY  84
            KIVV EILKVL+EADWEPSLHW+SL  E  E S    + P+ ++ +N S    Y
Sbjct  193  KIVVTEILKVLREADWEPSLHWRSLPTEFDEDSSYYPVAPDGQSTVNVSDTNIY  246



>gb|EPS60272.1| hypothetical protein M569_14532 [Genlisea aurea]
Length=256

 Score =   292 bits (747),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/239 (64%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+DIY+R+AD+V RGY GWNSR AL++L QVFPK+A  QPSLVIVYFG
Sbjct  18   QISFSNGGWGAMLSDIYARKADIVTRGYYGWNSRRALKILHQVFPKDAAKQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EYVENMRKIA HL+SLS   RIIFLSCPP+NEA+  E    
Sbjct  78   GNDSMGPHSSGLGPHVPLEEYVENMRKIATHLQSLSPDIRIIFLSCPPVNEAKIRENTSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL R+YSEACIELC ++ VKV+DLWTA+Q+R DWL  CFTDGIHL  EGS 
Sbjct  138  YFSELVRTNELCRQYSEACIELCNEMGVKVVDLWTAIQKRVDWLDVCFTDGIHLAEEGSI  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+E+LKVLKEADW+PSLHW+S+  E SE SP   +  + KT IN S+ T++ + QW+
Sbjct  198  VVVEEVLKVLKEADWKPSLHWKSIPTEFSEDSPYDLVASDGKTTINPSEWTYHRKIQWD  256



>ref|XP_003538463.1| PREDICTED: GDSL esterase/lipase CPRD49 isoform 1 [Glycine max]
 gb|KHN34723.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=256

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+ L+DIYSR+AD++LRGY GWNSR ALQVL+QVFPK+A +QPSLVIVYFG
Sbjct  18   QLSFSHGGWGSHLSDIYSRKADILLRGYYGWNSRRALQVLNQVFPKDAAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPL EY+ENMRKI IH++ LS+K RII LSCPP+NE +       
Sbjct  78   GNDSMGPHSSGLGPHVPLHEYIENMRKILIHIQGLSEKIRIIVLSCPPVNEEKVRGNTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL + YSEACI+LCK+LDVKV+DL+ ALQ+RDDW+  CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELCQSYSEACIKLCKELDVKVVDLFNALQKRDDWMNACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEIL+VLKEA+WEP LHW+S+  E +E SP   +  + KT +N S+ TFY + QW+
Sbjct  198  IVVKEILRVLKEAEWEPCLHWKSMPTEFAEDSPYDLVAADGKTTLNPSEWTFYREIQWD  256



>ref|XP_008233751.1| PREDICTED: GDSL esterase/lipase CPRD49 [Prunus mume]
Length=256

 Score =   291 bits (746),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+L+DIYSR AD++LRGY GWNSR A++VLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QMSYDHGGWGAILSDIYSRRADILLRGYFGWNSRRAVEVLDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALE  420
            GNDSM P  SGL  HVPLPEY++NMRKIA H+KSLS  TR IFLSCPP+NEA        
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIDNMRKIASHVKSLSASTRTIFLSCPPVNEAIIRGSTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL ++YSEACI+LC+++D+KV+DL+TA Q+ DDWL  CFTDGIHL++EGSK
Sbjct  138  IFSEIVRTNELCQQYSEACIKLCQEMDIKVVDLFTAFQKTDDWLNACFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVL+EADW+PSLHW+S+  E +E SP   +  + KT +N S  TFY + QW+
Sbjct  198  IVVEEILKVLREADWKPSLHWKSMPLEFAEDSPYDLVAADGKTTLNPSGWTFYREIQWD  256



>ref|XP_008373984.1| PREDICTED: GDSL esterase/lipase CPRD49 isoform X2 [Malus domestica]
Length=256

 Score =   291 bits (744),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/239 (64%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+LADIYSR AD+++RGY GWNSR A+ VLDQVFPK+A V+PSLVIVYFG
Sbjct  18   QMSYDVGGWGAILADIYSRRADILVRGYFGWNSRRAVNVLDQVFPKDAAVKPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE----ARALE  420
            GNDSM P PSGL  HVPLPEYVENMRKIAIHLKSLSD TRIIFLSCPP+NE      +  
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRKIAIHLKSLSDSTRIIFLSCPPVNETLINGSSSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL ++YSEACI+LC++++V  +DL+TA Q++DDW   CFTDGIH ++EGSK
Sbjct  138  IFSEIIRTNELCQQYSEACIKLCQEINVPFVDLFTACQRKDDWRNACFTDGIHFSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EILKVL+EADW+PSLHW+S+  E SE SP   +  + KT +N S  T+Y + QW+
Sbjct  198  VVVEEILKVLREADWKPSLHWKSMPIEFSEDSPDDLVAADGKTTLNPSSWTYYREIQWD  256



>ref|XP_008373975.1| PREDICTED: GDSL esterase/lipase CPRD49 isoform X1 [Malus domestica]
Length=257

 Score =   291 bits (744),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/240 (63%), Positives = 191/240 (80%), Gaps = 6/240 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+LADIYSR AD+++RGY GWNSR A+ VLDQVFPK+A V+PSLVIVYFG
Sbjct  18   QMSYDVGGWGAILADIYSRRADILVRGYFGWNSRRAVNVLDQVFPKDAAVKPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-----ARAL  423
            GNDSM P PSGL  HVPLPEYVENMRKIAIHLKSLSD TRIIFLSCPP+NE     + + 
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRKIAIHLKSLSDSTRIIFLSCPPVNETLINGSSSS  137

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
             +F  + R+NEL ++YSEACI+LC++++V  +DL+TA Q++DDW   CFTDGIH ++EGS
Sbjct  138  GIFSEIIRTNELCQQYSEACIKLCQEINVPFVDLFTACQRKDDWRNACFTDGIHFSAEGS  197

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            K+VV+EILKVL+EADW+PSLHW+S+  E SE SP   +  + KT +N S  T+Y + QW+
Sbjct  198  KVVVEEILKVLREADWKPSLHWKSMPIEFSEDSPDDLVAADGKTTLNPSSWTYYREIQWD  257



>ref|XP_010689718.1| PREDICTED: GDSL esterase/lipase CPRD49 [Beta vulgaris subsp. 
vulgaris]
Length=256

 Score =   290 bits (742),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LADIY+R+AD+ +RGY+ WNSR ALQVLDQVFPK+A   PSLVIVYFG
Sbjct  18   QYSFSNGGWGAILADIYARKADIFVRGYTCWNSRRALQVLDQVFPKDAVTHPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM    SGL  HVPLPEYVENMRKIA H+K LSD TRIIFLS PP+NE    E    
Sbjct  78   GNDSMGGHASGLGPHVPLPEYVENMRKIATHIKGLSDTTRIIFLSSPPVNEVHVQENKSV  137

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NE  ++YSEA IELC+++D+KV+DLWTA+Q+RDDWL  CFTDGIH ++EGS+
Sbjct  138  HILELVRTNEQCQRYSEALIELCREMDIKVVDLWTAIQKRDDWLTACFTDGIHFSAEGSE  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-INTSQLTFYWQPQWN  66
            IVV+EILKVLKEADWEPSLHW+S+A E SE SP   +  + T  +N S  TF+ + QW+
Sbjct  198  IVVEEILKVLKEADWEPSLHWKSMATEFSEDSPHYLLSVDGTSTLNASDWTFHRKRQWD  256



>emb|CDP14027.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 185/238 (78%), Gaps = 6/238 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF  EGWGA L DIY R+AD++LRGY GWNSR ALQVLDQVFPK+A +QP+LVIVYFG
Sbjct  18   QLSFSNEGWGATLTDIYPRKADIILRGYYGWNSRRALQVLDQVFPKDAAIQPALVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+ P PSGL  HVPL EYVENMRKIAIHLKSLSD TR+IFLSCPP+NEA        
Sbjct  78   GNDSIGPHPSGLGPHVPLAEYVENMRKIAIHLKSLSDSTRLIFLSCPPVNEAVLQASHNP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   + R+NEL + YSEA IELCK++ +KVIDL+ A+Q+RDDWL  CFTDG+H ++EGS 
Sbjct  138  MLSEIVRTNELCQMYSEALIELCKEMGLKVIDLFNAIQKRDDWLTACFTDGVHFSAEGSN  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVV+E+LKVL+EADW PSLHW+S+  E SE SP   +  + K+ IN S+   +W+ QW
Sbjct  198  IVVEEVLKVLREADWVPSLHWKSMPAEFSEGSPYDLVAADGKSTINASEWN-HWEGQW  254



>ref|XP_007220531.1| hypothetical protein PRUPE_ppa010281mg [Prunus persica]
 gb|EMJ21730.1| hypothetical protein PRUPE_ppa010281mg [Prunus persica]
Length=256

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+L+DIYSR AD++LRGY GWNSR A++VLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QMSYDHGGWGAILSDIYSRRADILLRGYFGWNSRRAVEVLDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALE  420
            GNDSM    SGL  HVPLPEY++NMRKIA H+KSLS  TR IFLSCPP+NEA        
Sbjct  78   GNDSMGSHSSGLGPHVPLPEYIDNMRKIASHVKSLSASTRTIFLSCPPVNEAIIRGSTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL ++YSEACI+LC+++D+KV+DL+TA Q+ DDWL  CFTDGIHL++EGSK
Sbjct  138  IFSEIVRTNELCQQYSEACIKLCQEMDIKVVDLFTAFQKTDDWLNACFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVL+EADW+PSLHW+S+  E +E SP   +  + KT +N S  TFY + QW+
Sbjct  198  IVVEEILKVLREADWKPSLHWKSMPLEFAEDSPYDLVAADGKTTLNPSSWTFYREIQWD  256



>emb|CDY36306.1| BnaA01g31120D [Brassica napus]
Length=256

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAVVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL +YV+NM+KIA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMGPHPSGLGPHVPLTQYVDNMKKIALHLQSLSDSTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELCK+LD++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCKELDLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + KT +N+S+ T++W+ QW 
Sbjct  198  LVAAEILRVVKEAEWRPSLHWKSMPTEFSEDSPYDLVAADGKTTLNSSEWTYFWEEQWE  256



>ref|XP_009344873.1| PREDICTED: GDSL esterase/lipase CPRD49 isoform X2 [Pyrus x bretschneideri]
Length=256

 Score =   289 bits (740),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+ ADIYSR AD+++RGY GWNSR A+ VLDQVFPK+A V+PSLVIVYFG
Sbjct  18   QMSYDVGGWGAIFADIYSRRADILVRGYFGWNSRRAVNVLDQVFPKDAAVKPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALE  420
            GNDSM P PSGL  HVPLPEYVENMRKIAIHLKSLSD TRIIFLSCPP+NEA     +  
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRKIAIHLKSLSDSTRIIFLSCPPVNEALINGSSSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL ++YSEACI+LC++++V  +DL+TA Q++DDW   CFTDGIH ++EGSK
Sbjct  138  IFSEIIRTNELCQQYSEACIKLCQEINVPFVDLFTACQRKDDWRNACFTDGIHFSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EIL+VL+EADW+PSLHW+S+  E SE SP   +  + KT +N S  T++ + QW+
Sbjct  198  VVVEEILRVLREADWKPSLHWKSMPIEFSEDSPYDLVAADGKTTLNPSGWTYFREIQWD  256



>ref|XP_004302586.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   289 bits (740),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 185/237 (78%), Gaps = 4/237 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LAD+YSR+AD+++RGY+GWNSR A+QVL+QVFPK+A +QPSLV+VYFG
Sbjct  18   QYSFSNGGWGAILADLYSRKADILVRGYAGWNSRRAVQVLEQVFPKDATIQPSLVMVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P+P GL  HVPLPEY+ENMRKIA HL+SLS+KTRIIFLS PP+NE    E    
Sbjct  78   GNDSMRPNPLGLGPHVPLPEYIENMRKIATHLQSLSEKTRIIFLSAPPVNEEHIREQLSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            + G L R+N+L + YS+AC+ELC+++D+K +DL T++Q+R DW  TCFTDGIHL+SEGSK
Sbjct  138  IIGELNRTNKLCKIYSDACLELCREMDIKAVDLCTSIQKRKDWETTCFTDGIHLSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            IV +EILKVLKEADWEPSL W SLA E  E SP   +G +   +N S        QW
Sbjct  198  IVAEEILKVLKEADWEPSLQWNSLATEFGEDSPYDPVGTDGKTMNVSDDGVARLMQW  254



>ref|XP_004506747.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=279

 Score =   290 bits (741),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 186/238 (78%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+L ++Y+R+AD++LRGY GWNSR AL+VLD +FPK+A  QPSLVIVYFG
Sbjct  18   QLSYSDEGWGAILTNLYARKADIILRGYCGWNSRRALKVLDTIFPKDAAEQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EY+ENM+KI IHLKSLS KTRII LS PP+NEA+  E    
Sbjct  78   GNDSMHPHPSGLGPHVPLEEYIENMKKIIIHLKSLSKKTRIILLSSPPVNEAQIHETFSN  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +FG + R+NE  R YSEAC+ELC +++VK IDLW+ALQQRDDW   CF DGIHL+ EG+K
Sbjct  138  IFGPIKRTNESCRLYSEACLELCHEMNVKAIDLWSALQQRDDWSNVCFIDGIHLSHEGNK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKEILKVL+EADWEPSLHW+S+ NE +E SP   +G + KT +N S   F  + QW
Sbjct  198  IVVKEILKVLEEADWEPSLHWKSMPNEFAEDSPYDPVGMDEKTTVNISNWYFEKKFQW  255



>ref|XP_010044099.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Eucalyptus 
grandis]
Length=266

 Score =   289 bits (739),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 184/229 (80%), Gaps = 6/229 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA LAD+Y+R+AD++LRGYSGWNSR AL+VL++VFPK+A  QPSLVIVYFG
Sbjct  18   QLSFGNGGWGASLADLYARKADIILRGYSGWNSRLALEVLEKVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLK-SLSDKTRIIFLSCPPINEARALEV--  417
            GNDSM P PSGL  HVPLPEY+ENMRKIA +LK SLSD TR+IFLS PPINE +  E   
Sbjct  78   GNDSMRPHPSGLGPHVPLPEYIENMRKIAKYLKQSLSDCTRVIFLSAPPINEEKIRESLS  137

Query  416  --FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
              F  LGR+N+  R YSEAC++LC+++++K +DLWTA+Q+RDDW   CFTDGIH +SE S
Sbjct  138  DKFQDLGRTNDACRVYSEACLKLCREMNIKAVDLWTAIQKRDDWATACFTDGIHFSSEAS  197

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTS  99
            +IVV+EIL+VLKEADWEPSL+W+S+  E  E SP   +GP+ KT +N S
Sbjct  198  EIVVEEILRVLKEADWEPSLYWESMPAEFGEDSPYYPVGPDGKTTVNLS  246



>gb|ACU13990.1| unknown [Glycine max]
Length=256

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 186/238 (78%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GW + L+DIYSR+AD++LRGY GWNSR ALQVL+QVFPK+A +QPSLVIVYFG
Sbjct  18   QLSFSHGGWSSHLSDIYSRKADILLRGYYGWNSRRALQVLNQVFPKDAAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPL EY+ENMRKI IH++ LS+K RII LSCPP+NE +       
Sbjct  78   GNDSMGPHSSGLGPHVPLHEYIENMRKILIHIQGLSEKIRIIVLSCPPVNEEKVRGNTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL + YSEACI+LCK+LDVKV+DL+ ALQ+RDDW+  CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELCQSYSEACIKLCKELDVKVVDLFNALQKRDDWMNACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKEIL+VLKEA+WEP LHW+S+  E +E SP   +  + KT +N S+ TFY + QW
Sbjct  198  IVVKEILRVLKEAEWEPCLHWKSMPTEFAEDSPYDLVAADGKTTLNPSEWTFYREIQW  255



>ref|XP_009344866.1| PREDICTED: GDSL esterase/lipase CPRD49 isoform X1 [Pyrus x bretschneideri]
Length=257

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/240 (63%), Positives = 190/240 (79%), Gaps = 6/240 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+ ADIYSR AD+++RGY GWNSR A+ VLDQVFPK+A V+PSLVIVYFG
Sbjct  18   QMSYDVGGWGAIFADIYSRRADILVRGYFGWNSRRAVNVLDQVFPKDAAVKPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA-----RAL  423
            GNDSM P PSGL  HVPLPEYVENMRKIAIHLKSLSD TRIIFLSCPP+NEA      + 
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRKIAIHLKSLSDSTRIIFLSCPPVNEALINGSSSG  137

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
             +F  + R+NEL ++YSEACI+LC++++V  +DL+TA Q++DDW   CFTDGIH ++EGS
Sbjct  138  GIFSEIIRTNELCQQYSEACIKLCQEINVPFVDLFTACQRKDDWRNACFTDGIHFSAEGS  197

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            K+VV+EIL+VL+EADW+PSLHW+S+  E SE SP   +  + KT +N S  T++ + QW+
Sbjct  198  KVVVEEILRVLREADWKPSLHWKSMPIEFSEDSPYDLVAADGKTTLNPSGWTYFREIQWD  257



>ref|XP_010031225.1| PREDICTED: GDSL esterase/lipase CPRD49 [Eucalyptus grandis]
 gb|KCW50487.1| hypothetical protein EUGRSUZ_J00215 [Eucalyptus grandis]
Length=256

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/239 (63%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  +   GWGA+L+D+Y+R+AD+VLRGY GWNSR ALQVLDQVFPK+A VQPSL+IVYFG
Sbjct  18   QLGYSNGGWGAILSDVYARKADIVLRGYYGWNSRRALQVLDQVFPKDAAVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P  SGL  HVPL EYVENMRKI  HLKSLSD TRIIFLSCPP+NE +    + E
Sbjct  78   GNDSMGPHSSGLGPHVPLHEYVENMRKIGEHLKSLSDTTRIIFLSCPPVNEDKVRQTSSE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL + YSEAC+ELCK++ V  +DL+ A+Q+R DWL TCFTDG+HL +EGSK
Sbjct  138  YFSELVRTNELCQMYSEACLELCKEIGVPAVDLFNAIQRRPDWLNTCFTDGVHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EILKVLKEA+W+PSLHW+S+  E +E SP   +  + KT +N S+ TF+   QW+
Sbjct  198  VVVEEILKVLKEAEWKPSLHWKSMPTEFAEDSPYDLVAADGKTTLNPSEWTFHRAIQWD  256



>ref|XP_009122322.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Brassica rapa]
Length=256

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+++VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVEKVFPKDAVVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL +YV+NM+KIA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMGPHPSGLGPHVPLTQYVDNMKKIALHLQSLSDSTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELCK+LD++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCKELDLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + KT +N+S+ T++W+ QW 
Sbjct  198  LVAAEILRVVKEAEWRPSLHWKSMPTEFSEDSPYDLVAADGKTTLNSSEWTYFWEEQWE  256



>emb|CDY01003.1| BnaC05g41970D [Brassica napus]
Length=256

 Score =   288 bits (736),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/239 (59%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+DQVFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDQVFPKDAEVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIAIHL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLSEYVDNMKKIAIHLQSLSDTTRIIFLSCPPVDEAKLRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLEVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAAEILRVIKEAEWTPSLHWKSMPTEFSEDSPYDLVSADGKNTVNSSEWTYFWEEQWD  256



>ref|XP_008785351.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Phoenix 
dactylifera]
Length=256

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LAD+Y+R+AD++LRGY+GWNSR ALQV+D++FPK+A VQPSL+IVYFG
Sbjct  18   QYSFSNGGWGAILADVYARKADILLRGYTGWNSRRALQVVDKIFPKDAAVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+ P PSGL  HVPLPEY ENM +IA HLKSLS+KTRIIFL+CPPINE    +    
Sbjct  78   GNDSIGPHPSGLGPHVPLPEYTENMSRIADHLKSLSEKTRIIFLTCPPINEELLRQSTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  ++YSEACI+LC  +DVK IDLWTA+Q++DDW   CFTDGIHL+S GS+
Sbjct  138  ALSEIVRTNETCQRYSEACIKLCNDMDVKAIDLWTAIQKQDDWANICFTDGIHLSSAGSR  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTFYWQPQWN  66
            IV +EILKVLKEA+WEPSLHW+SL  E  E SP   +  +  + IN S+ TF+ + QW+
Sbjct  198  IVAEEILKVLKEAEWEPSLHWKSLPTEFGEDSPYDLVTSDGISTINPSEWTFHREIQWD  256



>gb|ACJ85370.1| unknown [Medicago truncatula]
 gb|KEH23167.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=253

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/232 (64%), Positives = 186/232 (80%), Gaps = 8/232 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF +EGWGA+L+ +YSR+AD+VLRGYSGWN+R A+QVLD +FPKNA  QPSL+IVYFG
Sbjct  18   QLSFLKEGWGAILSHLYSRKADIVLRGYSGWNTRRAVQVLDTIFPKNATEQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+L  PSGL  HVPL EY++NM+KIA HLKSLS KTR+IFLS PP+NEA   +++G 
Sbjct  78   GNDSVLSHPSGLGQHVPLQEYIDNMKKIANHLKSLSKKTRLIFLSAPPVNEA---QIYGN  134

Query  407  L-----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
                   R+NE  R YSEAC+ELC+++++K IDLW+A+Q+RD+W   CFTDGIHLTSEGS
Sbjct  135  SCVKRPPRNNESCRIYSEACLELCREMNIKAIDLWSAIQKRDNWRNVCFTDGIHLTSEGS  194

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTF  87
            KIVVKEIL +LKEADWEP LHW+SL +E  E SP   +GP++  +N S LTF
Sbjct  195  KIVVKEILNILKEADWEPCLHWKSLPDEFGEDSPYDPLGPDEKTLNVSSLTF  246



>ref|XP_009146746.1| PREDICTED: GDSL esterase/lipase CPRD49 [Brassica rapa]
Length=256

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+DQVFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDQVFPKDAEVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLSEYVDNMKKIALHLQSLSDTTRIIFLSCPPVDEAKLRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAAEILRVIKEAEWTPSLHWKSMPTEFSEDSPYDLVSADGKNTVNSSEWTYFWEEQWD  256



>ref|XP_006298380.1| hypothetical protein CARUB_v10014449mg [Capsella rubella]
 gb|EOA31278.1| hypothetical protein CARUB_v10014449mg [Capsella rubella]
Length=256

 Score =   287 bits (734),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHSGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+H+KSLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMGPHPSGLGPHVPLTEYVDNMKKIALHIKSLSDSTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKAYSDACVELCQELGLEVVDLFSTLQKADDWKSVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W+PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAAEILRVIKEAEWKPSLHWKSMPTEFSEDSPYDLVSADGKETLNSSEWTYFWEEQWD  256



>ref|XP_004302594.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Fragaria vesca subsp. 
vesca]
Length=242

 Score =   286 bits (732),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 174/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA+LAD+YSR+AD+V+RGY+GWNSR  LQVL+QVFPK+A +QPSLVIVYFG
Sbjct  18   QFSFSNGGWGAILADLYSRKADIVVRGYAGWNSRQGLQVLEQVFPKDASIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSMLPDP GL+ HVPLPEYVENMRKIA HLK+LS+KTR IFL+ PP+NE +  + F  
Sbjct  78   GNDSMLPDPLGLSPHVPLPEYVENMRKIATHLKNLSEKTRFIFLTAPPVNEEQMRKAFSG  137

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +     R+N+L + YS+AC+ELC+ +D+K +DL+T++Q+R DW   CFTDGIH +SEGSK
Sbjct  138  IMRENSRTNKLCQMYSDACVELCRDMDIKAVDLFTSMQKRKDWSTMCFTDGIHFSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVL+EADWEPSL W SL  E  E SP
Sbjct  198  IVAEEILKVLEEADWEPSLQWNSLPTEFEEYSP  230



>ref|XP_008463235.1| PREDICTED: GDSL esterase/lipase CPRD49 [Cucumis melo]
Length=256

 Score =   286 bits (733),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA+LAD+Y+R+AD++LRGY  WNSR A+QVLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QFSFANGGWGAILADVYARKADILLRGYLSWNSRRAVQVLDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPLPEYV+NMRKIA H++SLSDKTR+IFL+CPP+NE +  E    
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVDNMRKIATHIQSLSDKTRLIFLTCPPVNETKVRESQSK  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NEL + Y++ACI+LC+++ +KV+DL+TA+Q+RDDW+  CFTDGIHL++EGSK
Sbjct  138  FLSELVRTNELCKVYAQACIKLCQEIGIKVVDLFTAIQKRDDWMNVCFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-INTSQLTFYWQPQWN  66
            +VV+EI+KVLKEA+W+PSL W+SL  E +E SP   I  + T  +N S    +    W+
Sbjct  198  VVVEEIMKVLKEAEWKPSLFWKSLPTEFAEDSPYDLIAADGTKTLNGSDWIIHRDIMWD  256



>gb|KCW86123.1| hypothetical protein EUGRSUZ_B02816 [Eucalyptus grandis]
Length=231

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSFG  GWGA LAD+Y+READ++LRGYSGWNSR AL+VL++VFPK+A  QPSLVIVYFG
Sbjct  18   QFSFGDGGWGASLADLYAREADIILRGYSGWNSRLALEVLEKVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSGL  HVPLPEYVENMRKIA +LKSLSD TR+IFLS PP+NE +  E +  
Sbjct  78   GNDSMRPHPSGLGPHVPLPEYVENMRKIAKYLKSLSDCTRVIFLSAPPVNEEKIRESWSD  137

Query  410  ---TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+N+L R YSEACI+LC+++++K +DLWTA+Q+RDDW   CFTDGIH + EGS+
Sbjct  138  KNQELRRTNDLCRVYSEACIKLCREMNIKAVDLWTAMQKRDDWATACFTDGIHFSPEGSE  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IVV+EIL+VLKEADW+PSL+W+S+  E  E SP
Sbjct  198  IVVEEILRVLKEADWKPSLYWESMPTEFGEDSP  230



>emb|CDY08543.1| BnaA05g27790D [Brassica napus]
Length=256

 Score =   286 bits (732),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+DQVFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDQVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+ IA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLSEYVDNMKNIALHLQSLSDTTRIIFLSCPPVDEAKLRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + K+ +N+S+ T++W+ QW+
Sbjct  198  LVAAEILRVIKEAEWTPSLHWKSMPTEFSEDSPYDLVSADGKSTVNSSEWTYFWEEQWD  256



>ref|XP_010923042.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Elaeis guineensis]
Length=256

 Score =   286 bits (732),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 186/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LAD+Y+R+AD++LRGY GWNSR ALQV+D++FPK+A VQPSL+IVYFG
Sbjct  18   QYSFSNGGWGAILADVYARKADILLRGYVGWNSRRALQVVDKIFPKDAAVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPLPEY ENM +IA HLKSLS+KTRIIFL+CPPINE    +   T
Sbjct  78   GNDSIGPHPSGLGPHVPLPEYTENMSRIADHLKSLSEKTRIIFLTCPPINEELLRQSTST  137

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  ++YSEACI+LC  +DVK IDLWTA+Q++DDW   CFTDGIH +S GS+
Sbjct  138  ALSEIVRTNETCQRYSEACIKLCNDMDVKAIDLWTAIQKQDDWANICFTDGIHFSSAGSR  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTFYWQPQWN  66
            IV +EILKVLKEA+WEPSLHW+SL  E  E SP   +  +  + IN S+ TF+ + QW+
Sbjct  198  IVAEEILKVLKEAEWEPSLHWKSLPTEFGEDSPYDLVASDGISTINPSEWTFHREIQWD  256



>ref|XP_011095006.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
Length=300

 Score =   288 bits (736),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/238 (64%), Positives = 181/238 (76%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y R+AD++LRGYSGWNSR ALQVL Q+FPK A V PSLVIVYFG
Sbjct  54   QMSFNVGGWGAILADLYDRKADILLRGYSGWNSRRALQVLYQIFPKEAAVHPSLVIVYFG  113

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+M P PSGL AHVPL EY+ENM+KI +HLKSLS+KTRIIFL+ PP+NEA   E FG 
Sbjct  114  GNDAMHPHPSGLGAHVPLREYLENMKKIYLHLKSLSEKTRIIFLTSPPVNEAMIREHFGN  173

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+N+  R Y+EA ++LCKQLD KV++LWTA+QQ++DW  TC TDGIH + EGSK
Sbjct  174  AHDNQDRTNKSCRVYAEALVDLCKQLDAKVVNLWTAIQQKEDWATTCLTDGIHFSPEGSK  233

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKEILKV+KEADWEPSLHW S+  E  E SP     P+ KT IN S     W+ +W
Sbjct  234  IVVKEILKVIKEADWEPSLHWMSMPIEFGEDSPYYMARPDGKTTINYSNAISSWKTEW  291



>gb|KCW86119.1| hypothetical protein EUGRSUZ_B02813 [Eucalyptus grandis]
Length=231

 Score =   285 bits (729),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 175/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSFG  GWGA LAD+Y+R+AD++LRGYSGWNSR AL+VL++VFPK+A  QPSLVIVYFG
Sbjct  18   QFSFGDGGWGASLADLYARKADIILRGYSGWNSRLALEVLEKVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSGL +HVPLPEYVENMRKIA +LKSLSD TR+IFLS PP+NE +  E +  
Sbjct  78   GNDSMRPQPSGLGSHVPLPEYVENMRKIAKYLKSLSDCTRVIFLSAPPVNEEKIRESWSD  137

Query  410  ---TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NEL R YSEACI+LC ++++K +DLWTA+Q+RDDW   CFTDGIH + EGSK
Sbjct  138  KNQELRRTNELCRVYSEACIKLCGEMNIKAVDLWTAMQKRDDWATACFTDGIHFSPEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IVV+EIL+VLKEADW PSL+W+S+  E  E SP
Sbjct  198  IVVEEILRVLKEADWRPSLYWESMPTEFGEDSP  230



>ref|XP_002316215.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEF02386.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=256

 Score =   286 bits (732),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWG++L+DIYSR+AD++LRGY GWNSR A+QVLDQVFPK A VQPSLVIVYFG
Sbjct  18   QLCFSHGGWGSVLSDIYSRKADILLRGYYGWNSRRAIQVLDQVFPKEAPVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKIAIHLKSLSD TRIIFLSCPP++E R       
Sbjct  78   GNDSMGPHSSGLGPHVPLNEYIENMRKIAIHLKSLSDTTRIIFLSCPPVDETRVGSGLSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL + YS ACI+LC+++ V+V+DL++A Q+RDDW   CFTDG+HL++EGSK
Sbjct  138  IFSELIRTNELCQNYSNACIKLCQEMGVEVVDLFSAFQKRDDWTKACFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVL+EA+W PSLHW+S+  E SE SP   +  + K  +N S+ TF+ + QW+
Sbjct  198  IVVEEILKVLREAEWVPSLHWKSMPTEFSEDSPYYLVTADGKRTLNPSEWTFHREVQWD  256



>ref|XP_006486322.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Citrus sinensis]
Length=256

 Score =   286 bits (731),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWGA+L+DIY+R+AD++LRGY GWNSR ALQVLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDAPIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P PSGL  HVPLPEYVENMR+IA HLKSLS  TRIIFLS PP++EAR      E
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPPVDEARINQGTSE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL +KYS+ACI LC  L VK +DL+TA+Q+RDDW   CFTDGIHL+ EGSK
Sbjct  138  IFSELVRTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDWKNACFTDGIHLSEEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLK+A+W+PSLHW+S+  E SE S    +  + +  +N S  TF+ + QW+
Sbjct  198  IVVAEILKVLKQAEWKPSLHWKSMPTEFSEDSLYDLVAASGERTLNPSDWTFHREIQWD  256



>ref|XP_006435730.1| hypothetical protein CICLE_v10032177mg [Citrus clementina]
 gb|ESR48970.1| hypothetical protein CICLE_v10032177mg [Citrus clementina]
Length=311

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/239 (64%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWGA+L+DIY+R+AD++LRGY GWNSR ALQVLDQVFPK+A +QPSLVIVYFG
Sbjct  73   QLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDAPIQPSLVIVYFG  132

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P PSGL  HVPLPEYVENMR+IA HLKSLS  TRIIFLS PP++EAR      E
Sbjct  133  GNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPPVDEARINQGTSE  192

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL +KYS+ACI LC  L VK +DL+TA+Q+RDDW   CFTDGIHL+ EGSK
Sbjct  193  IFSELVRTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDWKNACFTDGIHLSEEGSK  252

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLK+A+W+PSLHW+S+  E SE S    +  + +  +N S  TF+ + QW+
Sbjct  253  IVVAEILKVLKQAEWKPSLHWKSMPTEFSEDSLYDLVAASGERTLNPSDWTFHREIQWD  311



>emb|CDY36323.1| BnaA01g30950D [Brassica napus]
Length=256

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDALVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+HL+SLS+ TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMGPHPSGLGPHVPLTEYVDNMKKIALHLQSLSESTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELCK+L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCKELGLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E SE SP   +  + KT +N+S+ T++W+ QW 
Sbjct  198  LVAAEILRVVKEAEWRPSLHWKSMPTEFSEDSPCDLVAADGKTTLNSSEWTYFWEEQWE  256



>ref|XP_004492450.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=254

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 184/233 (79%), Gaps = 9/233 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+ +EGWGA+LA +Y+R+AD+VLRGYSGWN+R ALQVLD +FPKNA VQPSL+IVYFG
Sbjct  18   QLSYLKEGWGAMLAHLYARKADIVLRGYSGWNTRRALQVLDTIFPKNATVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSMLP PSGL  HVPL EY+ENM+ IA HLKSLS KTR+IFLS PP+NE    +++G 
Sbjct  78   GNDSMLPHPSGLGQHVPLQEYIENMKTIANHLKSLSKKTRLIFLSAPPVNER---QIYGN  134

Query  407  L-----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
                   R+NE  + YSEAC+ELC+++++K IDLW+ LQ+R DW   CFTDGIHLTSE S
Sbjct  135  RFVERPRRNNESCQIYSEACMELCREMNIKAIDLWSTLQKRSDWRDVCFTDGIHLTSEAS  194

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            KIVVKEILK++KEADWEP LHW+SL  E  E SP   +GP+ KT +N S +TF
Sbjct  195  KIVVKEILKIIKEADWEPCLHWKSLPIEFGEDSPYDPVGPHGKTTMNVSSMTF  247



>ref|XP_006407465.1| hypothetical protein EUTSA_v10021365mg [Eutrema salsugineum]
 gb|ESQ48918.1| hypothetical protein EUTSA_v10021365mg [Eutrema salsugineum]
Length=256

 Score =   285 bits (730),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVP+ +YV+NM+KIA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPVTQYVDNMKKIALHLQSLSDSTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLQVVDLFSTLQKADDWETVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  E+L+V+KEA+W PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAAEVLRVVKEAEWRPSLHWKSMPTEFSEDSPYDLVSADGKKTVNSSEWTYFWEEQWD  256



>ref|XP_011035959.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
 ref|XP_011035960.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
 ref|XP_011035962.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
 ref|XP_011035963.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
Length=256

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/239 (63%), Positives = 186/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWG++L+DIYSR+AD++LRGY GWNSR A+QVLDQVFPK A VQPSLVIVYFG
Sbjct  18   QLCFSHGGWGSILSDIYSRKADILLRGYYGWNSRRAIQVLDQVFPKEAPVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKIAIHLKSLSD TRIIFLSCPP++E R       
Sbjct  78   GNDSMGPHSSGLGPHVPLNEYIENMRKIAIHLKSLSDTTRIIFLSCPPVDETRVGSGLSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            VF  L R+NEL + YS ACI+LC+++ V+V+DL++A Q+RDDW   CFTDG+HL++EGSK
Sbjct  138  VFSELIRTNELCQNYSNACIKLCQEMGVEVVDLFSAFQKRDDWTKACFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVL+EA+W PSLHW+S+  E SE SP   +  + K  +N S+ TF+ +  W+
Sbjct  198  IVVEEILKVLREAEWVPSLHWKSMPTEFSEDSPYYLVTADGKRTLNPSEWTFHREVHWD  256



>gb|KHN46945.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=255

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 185/241 (77%), Gaps = 10/241 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF  +GWGA+LA +Y+R+AD++LRGYSGWNSR A+QVLD++FPKNA  QP L+IVYFG
Sbjct  18   QLSFSLQGWGAILAHLYARKADIILRGYSGWNSRRAVQVLDEIFPKNATEQPELIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+LP PSGL  HVPL EY+ENMRKI IHLKSLS KTR+IFL  PP+NEA   +++GT
Sbjct  78   GNDSLLPHPSGLGQHVPLQEYIENMRKIVIHLKSLSKKTRLIFLGAPPVNEA---QIYGT  134

Query  407  ------LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
                    R+NE  R YSEAC+ELC+++++  IDLW+ALQ+R DW   CFTDGIHLTSEG
Sbjct  135  SVLQGQRLRNNESCRIYSEACLELCREMNIMAIDLWSALQKRVDWREVCFTDGIHLTSEG  194

Query  245  SkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            S IV KE+LKV+KEA+WEP LHW+S+  E  E SP   +GP+ KT +N S  TF    +W
Sbjct  195  SNIVAKEVLKVIKEANWEPCLHWRSMPTEYGEDSPYDPVGPDGKTSLNISNWTFLETKEW  254

Query  68   N  66
            +
Sbjct  255  D  255



>gb|ABR17194.1| unknown [Picea sitchensis]
Length=256

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 185/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+AD+++RGYS WNSR ALQV+DQ+FPK+A  QPSL+IVYFG
Sbjct  18   QYSFANGGWGAALADIYARKADILVRGYSAWNSRRALQVIDQIFPKDAIEQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDS+ P  SGL  HVPL EY++NMRKIA +LK LS+ TR+IFLSCPPINE      +  
Sbjct  78   GNDSVGPHTSGLGPHVPLSEYIDNMRKIATYLKELSESTRLIFLSCPPINEDMLNNDSSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   + R+NE  R YSEACIE+CK +D+KV+DLW+A+Q R DW  +CFTDGIH ++EGS 
Sbjct  138  ILSPIVRTNEASRHYSEACIEVCKDMDLKVVDLWSAIQTRPDWRTSCFTDGIHFSAEGSV  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+WEPSLHW+S+  E  E+SP  +    NK+ +N S+ TF+ + QW+
Sbjct  198  IVVEEILKVLKEAEWEPSLHWKSIPAEFGESSPYDVVASDNKSTVNVSEFTFHREKQWD  256



>gb|KDP44775.1| hypothetical protein JCGZ_01275 [Jatropha curcas]
Length=256

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG++L DIYSR+AD++LRGY GWNSR A++V+DQ+FPK+A VQP LVIVYFG
Sbjct  18   QLSFSYGGWGSILTDIYSRKADILLRGYYGWNSRRAVEVIDQIFPKDASVQPDLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEYVENMRKIA HLKSLS  TRIIFL+CPP++E    +    
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYVENMRKIAFHLKSLSKTTRIIFLTCPPVDEEMIHKNTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL +KY+EAC++LC+++DVKV+DL+TALQ+R DW  +CFTDG+H+++EGSK
Sbjct  138  IFSELVRTNELCQKYAEACVKLCQEIDVKVVDLFTALQRRSDWKTSCFTDGVHISAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILK+LKEADW PSLHW+S+ +E  E SP   +  + KT +N ++ T + +  W+
Sbjct  198  IVVEEILKLLKEADWTPSLHWKSMPSEFPEDSPYYLVAADGKTTLNPTEWTIHREILWD  256



>ref|XP_002884836.1| CPRD49 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61095.1| CPRD49 [Arabidopsis lyrata subsp. lyrata]
Length=256

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 189/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSSRALEVVDKVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+HL+SLSD TRIIFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLTEYVDNMKKIALHLQSLSDSTRIIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++  Q+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLEVVDLFSTFQKADDWKTVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W PSLHW+S+  E +E SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAAEILRVIKEAEWNPSLHWKSMPTEFAEDSPYDLVSADGKQTVNSSEWTYFWEEQWD  256



>ref|XP_010487340.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Camelina sativa]
Length=256

 Score =   285 bits (728),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAEVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+HL+SLSD TR+IFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLTEYVDNMKKIALHLQSLSDSTRLIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLEVVDLFSTLQKADDWKSVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W+PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAGEILRVIKEAEWKPSLHWKSMPTEFSEDSPYDLVSADGKQTVNSSEWTYFWEEQWD  256



>ref|XP_003520489.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Glycine max]
 gb|KHN42507.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=271

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 185/229 (81%), Gaps = 5/229 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            +FS+  EGWGA+LA++Y+R+AD+VLRGY+GWNSR ALQ LD++FPK+A  QPSL+IVYFG
Sbjct  18   EFSYSDEGWGAILANLYARKADIVLRGYAGWNSRRALQNLDKIFPKDATDQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL+ HVPL EY+ENM+KIAIHLKSLS KTRIIFLS PPINE +  E    
Sbjct  78   GNDSMHPHPSGLSPHVPLQEYIENMKKIAIHLKSLSKKTRIIFLSSPPINEVQMHETLSD  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            + G L R+NE  R YSEAC+ELC +++VK IDLW+AL+QR DWL  CFTDGIHL++EGSK
Sbjct  138  LLGPLRRTNEACRTYSEACLELCHEMNVKAIDLWSALRQRHDWLDVCFTDGIHLSNEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQ  96
            IV KEILKVL+EADWEPSL W+S+  E +E SP   IG ++ T I+ S 
Sbjct  198  IVAKEILKVLREADWEPSLDWKSMPVEFAEDSPYEPIGADENTHIDVSN  246



>gb|KCW86118.1| hypothetical protein EUGRSUZ_B02813 [Eucalyptus grandis]
Length=231

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 174/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA LAD+Y+R+AD++LRGYSGWNSR AL+VL++VFPK+A  QPSLVIVYFG
Sbjct  18   QLSFGNGGWGASLADLYARKADIILRGYSGWNSRLALEVLEKVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSGL +HVPLPEYVENMRKIA +LKSLSD TR+IFLS PP+NE +  E +  
Sbjct  78   GNDSMRPQPSGLGSHVPLPEYVENMRKIAKYLKSLSDCTRVIFLSAPPVNEEKIRESWSD  137

Query  410  ---TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NEL R YSEACI+LC ++++K +DLWTA+Q+RDDW   CFTDGIH + EGSK
Sbjct  138  KNQELRRTNELCRVYSEACIKLCGEMNIKAVDLWTAMQKRDDWATACFTDGIHFSPEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IVV+EIL+VLKEADW PSL+W+S+  E  E SP
Sbjct  198  IVVEEILRVLKEADWRPSLYWESMPTEFGEDSP  230



>ref|XP_010486764.1| PREDICTED: GDSL esterase/lipase CPRD49 [Camelina sativa]
Length=256

 Score =   284 bits (727),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 191/239 (80%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAAVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+K+A+HL+SLSD TR+IFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLTEYVDNMKKMALHLQSLSDSTRLIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLEVVDLFSTLQKADDWKSVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W+PSLHW+S+  E SE SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAGEILRVIKEAEWKPSLHWKSMPTEFSEDSPYDLVSADGKQTVNSSEWTYFWEEQWD  256



>ref|XP_002322977.1| CPRD49 family protein [Populus trichocarpa]
 gb|EEF04738.1| CPRD49 family protein [Populus trichocarpa]
Length=242

 Score =   283 bits (725),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 179/224 (80%), Gaps = 1/224 (0%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+LAD Y+R+AD+V+RGY GWNSR ALQVLDQ+FPK+A VQPSLVI YFG
Sbjct  18   QKSFGNGGWGAILADTYARKADIVMRGYGGWNSRNALQVLDQIFPKDAAVQPSLVITYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P P+ L++HVPLPE++ENM+KIA HLKSLS+KTR+IFL  PP N+   ++ +G 
Sbjct  78   GNDSMKPIPAELSSHVPLPEFIENMKKIATHLKSLSEKTRVIFLGVPPANDEMIIQFYGE  137

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               RSNE GR YSEA ++LC++L+VK IDLWT +QQ++DWL TCFTDG+HL SEGSKIV 
Sbjct  138  RAARSNEGGRIYSEATLKLCQELEVKAIDLWTIMQQKNDWLTTCFTDGVHLASEGSKIVA  197

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTS  99
            KEI++ L+EA+WEPSL+W+ + +E    SP    G N T IN++
Sbjct  198  KEIMRALEEAEWEPSLYWKLMPSEFVGISPFDSEGNNGTIINSN  241



>gb|KHG08090.1| GDSL esterase/lipase CPRD49 -like protein [Gossypium arboreum]
Length=256

 Score =   284 bits (726),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y+R+ADV+LRGY GWNSR A+QVLD VFPK+A  QP L+I YFG
Sbjct  18   QLSFSNGGWGAILADVYARKADVLLRGYFGWNSRRAIQVLDHVFPKDASTQPELIITYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM   PSGL  HVPLPEY+ENM++I  +LK LSD TR+IFL+ PP+NE R    A E
Sbjct  78   GNDSMGAHPSGLGPHVPLPEYIENMKQIVNYLKGLSDSTRLIFLTSPPVNEERVNKYASE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL + Y++AC++LC++LDVKV++L+TA QQR++W+  CFTDG+HL++EGSK
Sbjct  138  HFSHLVRTNELCQTYADACVKLCQELDVKVVNLFTAFQQRENWMTDCFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+W+PSLHW+S+  E SE SP   +G + KT +N S+ TF+ + QW+
Sbjct  198  IVVAEILKVLKEAEWKPSLHWKSMPTEFSEDSPYDIVGADGKTTLNASEWTFHREIQWD  256



>gb|KHN48499.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=255

 Score =   283 bits (725),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/238 (62%), Positives = 182/238 (76%), Gaps = 4/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  +GWGA+LA +Y+R+AD++LRGYSGWNSR A+QVLD++FPKNA  QP LVIVYFG
Sbjct  18   QLSYSLQGWGAILAHLYARKADIILRGYSGWNSRRAVQVLDEIFPKNATEQPDLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+LP PSGL  HVPL EY+ENMRKI  HLKSLS KTR+IFLS PP+NEA+       
Sbjct  78   GNDSLLPHPSGLGQHVPLQEYIENMRKIGTHLKSLSKKTRLIFLSAPPVNEAQIYGTSVP  137

Query  407  LG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            LG   R+NE  +KYSE C++LC ++++K IDLW+ALQ+R +W   CFTDGIHLTSEGS I
Sbjct  138  LGQRLRNNESCQKYSEVCLKLCHEMNIKAIDLWSALQKRGNWRDVCFTDGIHLTSEGSNI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            V KEILKV+KEA+WEP LHW S+  E  E SP   +GP+ KT +N S  TF    +W+
Sbjct  198  VAKEILKVIKEAEWEPCLHWNSMPTEYGEDSPYDPVGPDGKTTVNVSNWTFLETKEWD  255



>gb|KHN35578.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=246

 Score =   283 bits (724),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 182/228 (80%), Gaps = 5/228 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            +FS+  +GWGA+LA++Y+R+AD++LRGY+GWNSR ALQ LD++FPK+A  Q SLVIVYFG
Sbjct  18   EFSYSDQGWGAILANLYARKADIILRGYAGWNSRRALQNLDKIFPKDATDQTSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL+ HVPL EY+ENMRKI IHLKSLS KTRIIFLS PPINE +  E    
Sbjct  78   GNDSMHPHPSGLSPHVPLQEYIENMRKIVIHLKSLSKKTRIIFLSSPPINEVQMHETLSD  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            + G L R+NE  R YSEAC+ELC++++VK IDLW+ALQQR DWL  CFTDGIHL++EGSK
Sbjct  138  LLGPLKRTNEACRIYSEACLELCREMNVKAIDLWSALQQRHDWLDVCFTDGIHLSNEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTS  99
            IV KEILKVL EADWEPSLHW S+  E +E S    I  ++ TPI+ S
Sbjct  198  IVAKEILKVLGEADWEPSLHWNSMPIEFAEDSLYEPISADENTPIDVS  245



>ref|XP_007140334.1| hypothetical protein PHAVU_008G103700g [Phaseolus vulgaris]
 gb|ESW12328.1| hypothetical protein PHAVU_008G103700g [Phaseolus vulgaris]
Length=255

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/238 (63%), Positives = 181/238 (76%), Gaps = 4/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+ Q+GWGA LA +Y+R+ADV++RGYSGWNSR A+QVLD++FPKNA  QPSLVIVYFG
Sbjct  18   QFSYSQQGWGAALAHLYARKADVIVRGYSGWNSRRAVQVLDEIFPKNATEQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---V  417
            GNDS+LP PSGL  HVPL EY+ENMRKI  HLKSLS KTRIIFLS PP+NEA       +
Sbjct  78   GNDSLLPHPSGLGQHVPLQEYIENMRKIGTHLKSLSQKTRIIFLSAPPVNEAHLYGDSVL  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCF-TDGIHLTSEGSk  240
             G   R+NE  R YSEAC+ELC+++++  IDLW+ LQ+RDDW   CF  DG+HL +EGS 
Sbjct  138  PGQQLRTNESCRIYSEACLELCREMNINAIDLWSVLQKRDDWRDVCFMKDGVHLGAEGSN  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQWN  66
            IV KEILKV+KEADWEPSL W+S+ +E  E SP   IGP+ T +N S  TF     W+
Sbjct  198  IVAKEILKVIKEADWEPSLQWRSMPSEYGEDSPFDPIGPDGTTVNVSNSTFLEAMLWD  255



>ref|XP_011045430.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Populus 
euphratica]
Length=256

 Score =   283 bits (724),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWG++L+DIYSR+AD++LRGY GWNSR A+QVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QLCFSHGGWGSILSDIYSRKADILLRGYYGWNSRRAVQVLDQVFPKDAPVQPALVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKIAIHLKSLSD TRIIF+SCPP++EAR       
Sbjct  78   GNDSMGPHSSGLGPHVPLDEYMENMRKIAIHLKSLSDTTRIIFMSCPPVDEARVSSSTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL + YS +CI+LC++L VKV+DL++A Q+RD W   CFTDGIHL++EGSK
Sbjct  138  IFSEVVRTNELCQIYSNSCIKLCQELGVKVVDLFSAFQKRDGWTTACFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+W PSLHW+S+  E SE SP   +  + K  +N S+ TF+ +  W+
Sbjct  198  IVVEEILKVLKEAEWVPSLHWKSMPTEFSEDSPYDLVAADGKRTLNPSEWTFHREVHWD  256



>ref|XP_010464821.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Camelina sativa]
Length=256

 Score =   283 bits (724),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 190/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+D+VFPK+A VQPSLV+VYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSTRALEVVDKVFPKDAEVQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P PSGL  HVPL EYV+NM+KIA+HL+SLSD TR+IFLSCPP++EA+  +    
Sbjct  78   GNDSMAPHPSGLGPHVPLTEYVDNMKKIALHLQSLSDSTRLIFLSCPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL + YS+AC+ELC++L ++V+DL++ LQ+ DDW   CFTDGIHL++EGSK
Sbjct  138  YLSEVIRTNELCKTYSDACVELCQELGLEVVDLFSTLQKADDWKSVCFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +V  EIL+V+KEA+W+PSLHW+S+  E SE S    +  + K  +N+S+ T++W+ QW+
Sbjct  198  LVAGEILRVIKEAEWKPSLHWKSMPTEFSEDSSYDLVSADGKETVNSSEWTYFWEEQWD  256



>ref|XP_002311219.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE88586.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=256

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWG++L+DIYSR+AD++LRGY GWNSR A+QVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QLCFSHGGWGSILSDIYSRKADILLRGYYGWNSRRAVQVLDQVFPKDAPVQPALVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EY+ENMRKIA+HLKSLSD TRIIF+SCPP++EAR       
Sbjct  78   GNDSMGPHSSGLGPHVPLDEYMENMRKIAVHLKSLSDTTRIIFMSCPPVDEARVSSSTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  + R+NEL + YS +CI+LC++L VKV+DL++A Q+RD W   CFTDGIHL++EGSK
Sbjct  138  IFSEVVRTNELCQIYSNSCIKLCQELGVKVVDLFSAFQKRDGWTTACFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+W PSLHW+S+  E SE SP   +  + K  +N S+ TF+ +  W+
Sbjct  198  IVVEEILKVLKEAEWVPSLHWKSMPTEFSEDSPYDLVAADGKQTLNPSEWTFHREVHWD  256



>ref|NP_001238350.1| uncharacterized protein LOC100305638 [Glycine max]
 gb|ACU13423.1| unknown [Glycine max]
Length=254

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 183/234 (78%), Gaps = 10/234 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  +GWGA+LA +Y+R+AD++LRGYSGWNSR A+QVLD++FPKNA  QP LVIVYFG
Sbjct  18   QLSYSLQGWGAILAHLYARKADIILRGYSGWNSRRAVQVLDEIFPKNATEQPDLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+LP PSGL  HVPL EY+ENMRKI  HLKSLS KTR+IFLS PP+NEA   +++GT
Sbjct  78   GNDSLLPHPSGLGQHVPLQEYIENMRKIGTHLKSLSKKTRLIFLSAPPVNEA---QIYGT  134

Query  407  ---LG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
               LG   R+NE  +KYSE C++LC ++++K IDLW+ALQ+R +W   CFTDGIHLTSEG
Sbjct  135  SVPLGQRLRNNESCQKYSEVCLKLCHEMNIKAIDLWSALQKRGNWRDVCFTDGIHLTSEG  194

Query  245  SkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            S IV KEILKV+KEA+WEP LHW S+  E  E SP   +GP+ KT +N S  TF
Sbjct  195  SNIVAKEILKVIKEAEWEPCLHWNSMPTEYGEDSPYDPVGPDGKTTVNVSNWTF  248



>ref|XP_004149235.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cucumis sativus]
 gb|KGN50652.1| hypothetical protein Csa_5G202360 [Cucumis sativus]
Length=256

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA+LAD+Y+R+AD++LRGY  WNSR A+QVLDQVFPK+  VQPSLVIVYFG
Sbjct  18   QFSFANGGWGAILADVYARKADILLRGYLSWNSRRAVQVLDQVFPKDTVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P PSGL  HVPLPEY++NMRKIA H++SLSDKTR+IFL+CPP+NE +      +
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYIDNMRKIATHIQSLSDKTRLIFLTCPPVNETKVRGSQSK  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NEL + Y++ACI+LC+++ VKV+DL+TA+Q+RDDW+  CFTDGIHL++EGSK
Sbjct  138  FLSELVRTNELCKAYAQACIKLCQEIGVKVVDLFTAIQKRDDWMNVCFTDGIHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-INTSQLTFYWQPQWN  66
            +VV+EI+KVLKEA+W+PSL+W+SL  E +E SP   +  + T  +N S    +    W+
Sbjct  198  VVVEEIMKVLKEAEWKPSLYWKSLPTEFAEDSPYDLVTADGTKTLNGSDWIIHRDIMWD  256



>ref|XP_002533646.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
 gb|EEF28734.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
Length=256

 Score =   283 bits (723),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 184/241 (76%), Gaps = 9/241 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+ L+DIY+R+AD++LRGY  WNSR A++V+DQ+FPK+A +QP LVIVYFG
Sbjct  18   QLSFSHGGWGSHLSDIYARKADILLRGYYAWNSRRAVEVMDQIFPKDADIQPDLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPLPEY+ENMRKIAIHLKSLS+KTRIIFLSCPP++E R       
Sbjct  78   GNDSMGPHSSGLGPHVPLPEYIENMRKIAIHLKSLSEKTRIIFLSCPPVDEERVRSNTSG  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL +KYSEACI LC +LDVKVIDL+ A Q+R DW   CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELCQKYSEACITLCDELDVKVIDLFHAFQKRSDWKTACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETS---PIIFIGPNKTPINTSQLTFYWQPQW  69
            IVV+EILKVLKEA+W PSLHW+S+  E  E S   P+   G  +T +N S+ TF+ +  W
Sbjct  198  IVVEEILKVLKEAEWTPSLHWKSIPTEFPEDSSYYPVAVDG--ETTLNPSEWTFHREVHW  255

Query  68   N  66
             
Sbjct  256  E  256



>ref|XP_002528096.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
 gb|EEF34275.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
Length=245

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 178/226 (79%), Gaps = 3/226 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  +GWGA LAD+Y+R+AD++LRGY+GWNSR A+QVLD+VFPK+A +QPSLV+VYFG
Sbjct  18   QFSYSNDGWGATLADLYARKADILLRGYAGWNSRRAVQVLDKVFPKDAAIQPSLVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE---ARALEV  417
            GNDS+ P P+GL  HVPLPEY++NMRKIA+HLKSLS K RIIF+S PP+NE   A+ L  
Sbjct  78   GNDSVHPHPTGLGPHVPLPEYIDNMRKIAVHLKSLSKKIRIIFMSAPPVNEVQIAKDLSD  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
               + R+NE  R YSEAC+ELC ++++K +DLWTA+QQ D W   CFTDGIH +SEGSKI
Sbjct  138  KFDMVRTNESCRIYSEACLELCHEMNLKAVDLWTAMQQIDGWQNVCFTDGIHFSSEGSKI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTS  99
            VVKEI+KV++EADWEP LHW ++  E +E SP   I PN    N S
Sbjct  198  VVKEIMKVIEEADWEPDLHWMAMPTEFAEDSPYDPISPNGVAANVS  243



>ref|XP_003604688.1| GDSL esterase/lipase CPRD49 [Medicago truncatula]
 gb|AES86885.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=271

 Score =   282 bits (722),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 180/238 (76%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWG++L ++YSR+AD++LRGY GWNSR A+QVLD +FPKNA  QPSLVIVYFG
Sbjct  18   QLSYSDEGWGSILTNLYSRKADIILRGYCGWNSRRAVQVLDTIFPKNAVEQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF--  414
            GNDS+ P PSGL  HVPL EY ENM+KI IHLKSLS KTRII LS PP+NEA+  E F  
Sbjct  78   GNDSIHPHPSGLGPHVPLEEYRENMKKIIIHLKSLSKKTRIILLSSPPVNEAQIHETFSN  137

Query  413  --GTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              G L R+NE  R YSEAC++LC  ++VK IDLW+ALQQRDDW   CFTDGIHL+ EGSK
Sbjct  138  ILGPLKRTNESCRLYSEACLDLCHDMNVKAIDLWSALQQRDDWSDVCFTDGIHLSHEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKEILKVL +ADW PSLHW+S+ NE +E SP   +  + KT +N S   F    +W
Sbjct  198  IVVKEILKVLDDADWNPSLHWKSMPNEFAEDSPYDPVAIDEKTTVNVSNWNFQKNFEW  255



>ref|XP_010529894.1| PREDICTED: GDSL esterase/lipase At2g38180 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529895.1| PREDICTED: GDSL esterase/lipase At2g38180 isoform X2 [Tarenaya 
hassleriana]
Length=264

 Score =   282 bits (721),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 178/228 (78%), Gaps = 6/228 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA+LAD+Y+R AD++LRGY+GWNSR  LQV+DQVFPKNA VQP+LVIVYFG
Sbjct  35   QFSFINGGWGAILADLYARRADIILRGYAGWNSRFGLQVIDQVFPKNAAVQPALVIVYFG  94

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSGL AHVPLPEY++NMRKIA HL SLSDKTR+IFL+ PP+NE +  E  G 
Sbjct  95   GNDSMHPHPSGLGAHVPLPEYIQNMRKIAEHLLSLSDKTRVIFLTSPPVNEKQIQESIGD  154

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
            +  GR NEL R YS+A ++LC++++VK IDLWTA QQ DDWL TCFTDGIH T   S+IV
Sbjct  155  VARGRKNELCRIYSDALVDLCEEINVKAIDLWTAFQQHDDWLNTCFTDGIHFTELASEIV  214

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLT  90
            V+EILKVL+EADW+P+LHW+SL  E     P  F  PN   +   +LT
Sbjct  215  VREILKVLREADWKPNLHWKSLPVE----FPFDFGTPNSPSLFDLELT  258



>gb|KJB78772.1| hypothetical protein B456_013G018300 [Gossypium raimondii]
Length=256

 Score =   281 bits (720),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y+R+AD++LRGY GWNSR A+QVLD VFPK+A  QP L+I YFG
Sbjct  18   QLSFSNGGWGAILADVYARKADILLRGYFGWNSRRAIQVLDHVFPKDASTQPELIITYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM   PSGL  HVPLPEY+ENM++I  +LK LSD TR+IFL+ PP+NE R    A E
Sbjct  78   GNDSMGAHPSGLGPHVPLPEYIENMKQIVNYLKGLSDSTRLIFLTSPPVNEERVNKYASE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL + Y++AC++LC++LDVKV++L+TA QQR++W+  CFTDG+HL++EGSK
Sbjct  138  HFSHLVRTNELCQTYADACVKLCQELDVKVVNLFTAFQQRENWMTDCFTDGVHLSAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+W+PSLHW+S+  E +E SP   +G + KT +N S+ TF+ + QW+
Sbjct  198  IVVAEILKVLKEAEWKPSLHWKSMPTEFAEDSPYDIVGADGKTTLNPSEWTFHQEIQWD  256



>ref|XP_004492451.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=254

 Score =   281 bits (719),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 182/233 (78%), Gaps = 9/233 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+ +EGWGA+LA +Y+R+AD+VLRGYSGWNSR ALQVLD +FPKNA VQPSL+IVYFG
Sbjct  18   QLSYLKEGWGAMLAHLYARKADIVLRGYSGWNSRRALQVLDTIFPKNATVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSML  PSGL  HVPL EY+ENM+ IA HLKSLS  TR+IFLS PP+NE    +++G 
Sbjct  78   GNDSMLSHPSGLGQHVPLQEYIENMKTIANHLKSLSKNTRLIFLSAPPVNER---QIYGN  134

Query  407  L-----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
                   R+NE  + YSEAC+ELC+++++K IDLW+ LQ+R DW   CFTDGIHLTSE S
Sbjct  135  SFVERPQRNNESCQIYSEACMELCREMNIKAIDLWSTLQKRSDWRDVCFTDGIHLTSEAS  194

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            KIVVKEILK+LKEADWEP LHW+SL  E  E SP   +GP+ KT +N S +TF
Sbjct  195  KIVVKEILKILKEADWEPCLHWKSLPIEFGEDSPYDPVGPDGKTTMNVSSMTF  247



>ref|XP_008785353.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X3 [Phoenix 
dactylifera]
Length=243

 Score =   281 bits (718),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LAD+Y+R+AD++LRGY+GWNSR ALQV+D++FPK+A VQPSL+IVYFG
Sbjct  18   QYSFSNGGWGAILADVYARKADILLRGYTGWNSRRALQVVDKIFPKDAAVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+ P PSGL  HVPLPEY ENM +IA HLKSLS+KTRIIFL+CPPINE    +    
Sbjct  78   GNDSIGPHPSGLGPHVPLPEYTENMSRIADHLKSLSEKTRIIFLTCPPINEELLRQSTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  ++YSEACI+LC  +DVK IDLWTA+Q++DDW   CFTDGIHL+S GS+
Sbjct  138  ALSEIVRTNETCQRYSEACIKLCNDMDVKAIDLWTAIQKQDDWANICFTDGIHLSSAGSR  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVLKEA+WEPSLHW+SL  E  E SP
Sbjct  198  IVAEEILKVLKEAEWEPSLHWKSLPTEFGEDSP  230



>ref|XP_008785352.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Phoenix 
dactylifera]
Length=244

 Score =   281 bits (718),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 173/213 (81%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LAD+Y+R+AD++LRGY+GWNSR ALQV+D++FPK+A VQPSL+IVYFG
Sbjct  18   QYSFSNGGWGAILADVYARKADILLRGYTGWNSRRALQVVDKIFPKDAAVQPSLIIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+ P PSGL  HVPLPEY ENM +IA HLKSLS+KTRIIFL+CPPINE    +    
Sbjct  78   GNDSIGPHPSGLGPHVPLPEYTENMSRIADHLKSLSEKTRIIFLTCPPINEELLRQSTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  ++YSEACI+LC  +DVK IDLWTA+Q++DDW   CFTDGIHL+S GS+
Sbjct  138  ALSEIVRTNETCQRYSEACIKLCNDMDVKAIDLWTAIQKQDDWANICFTDGIHLSSAGSR  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVLKEA+WEPSLHW+SL  E  E SP
Sbjct  198  IVAEEILKVLKEAEWEPSLHWKSLPTEFGEDSP  230



>ref|XP_004307646.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 188/239 (79%), Gaps = 9/239 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+D+Y+R+AD++LRGY GWNSR AL+VL+QVFPK+A VQPSLVIVYFG
Sbjct  18   QLSFSHGGWGAILSDLYARKADILLRGYFGWNSRRALEVLEQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA--RALE--  420
            GNDSM   PSGL  HVPLPEY+ENMRKIA H++SLSD TRII LSCPP+NEA  RA +  
Sbjct  78   GNDSMGAHPSGLGPHVPLPEYIENMRKIASHIQSLSDSTRIIVLSCPPVNEATIRANKSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                L R+NEL ++YSEACI LC+++D+KV+DL+TA+Q+ D+    CFTDGIHL++EGSK
Sbjct  138  YLSELVRTNELCQQYSEACIRLCQEMDIKVVDLFTAIQKGDN----CFTDGIHLSAEGSK  193

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IV +E+LKVL+EADW+PSLHW+S+  E +E SP   +  + KT +N S+  FY    WN
Sbjct  194  IVAEEVLKVLREADWKPSLHWKSMPTEFAEDSPYHLVAADGKTTLNPSEWAFYRDSHWN  252



>ref|XP_008243738.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Prunus mume]
Length=260

 Score =   280 bits (716),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 175/213 (82%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS    GWGA+LAD+YSR+ADVVLRGY+GWNSR ALQVL+QVFPK+A +QPSLVIVYFG
Sbjct  18   QFSCSNGGWGAILADLYSRKADVVLRGYAGWNSRRALQVLEQVFPKDAAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSMLP  SGL  HVPLPEYVENMRKI  +LKSLS+K RIIFL+ PP+NE + LE    
Sbjct  78   GNDSMLPHSSGLGPHVPLPEYVENMRKIGKYLKSLSEKIRIIFLTAPPVNEEQILENLRD  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +     R+NE  + YS+AC+E+C++LDVK +DLWT++Q+R DW   CFTDGIH ++ GSK
Sbjct  138  IIPERNRTNESCKIYSDACLEVCRELDVKAVDLWTSIQRRKDWSTVCFTDGIHFSAAGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IVV+EILKVL+EADWEPSLHW+SL  E +E+SP
Sbjct  198  IVVEEILKVLREADWEPSLHWKSLPTEFAESSP  230



>ref|XP_011095007.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Sesamum 
indicum]
Length=274

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/238 (61%), Positives = 183/238 (77%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+LL D+Y R+AD+VLRGYSGWNSR AL+VL+Q+FP++A  QPSLVIVYFG
Sbjct  18   QMSFCDGGWGSLLTDLYHRKADIVLRGYSGWNSRNALEVLNQIFPQDAADQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+M P PSGL  HVPLPEY+ENM+KIA+HL+SLS+KTR++FL+ PP++EA   + FG 
Sbjct  78   GNDAMQPHPSGLGPHVPLPEYLENMKKIALHLRSLSEKTRVVFLTSPPVDEAMIRQCFGN  137

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE  R YS+A +++CKQLDVKVI++W A Q RDDW      DGIHLTS GS+
Sbjct  138  AFDKQERTNESCRIYSDALVDMCKQLDVKVINVWKAFQHRDDWAEAYLADGIHLTSGGSR  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            +V+KEILKVLKEA+WEPSLHW S+  E SE SP   +GP+ KT IN S +   W+ +W
Sbjct  198  VVLKEILKVLKEAEWEPSLHWMSMPAEFSEDSPYFPVGPDGKTTINVSDIISQWKTEW  255



>ref|XP_006663137.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Oryza brachyantha]
Length=260

 Score =   279 bits (713),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 184/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA LADIY+R+AD++LRGY GWNSR ALQV+D+VFPK++ VQPSLVIVYFG
Sbjct  22   QFSFSNGGWGAALADIYARKADILLRGYIGWNSRRALQVIDKVFPKDSPVQPSLVIVYFG  81

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+    SGL  HVPL EY++NMRKIA HLKSLS+KTR+IFLSCPP+NE    +    
Sbjct  82   GNDSVAAHSSGLGPHVPLEEYIDNMRKIAKHLKSLSEKTRVIFLSCPPLNEETLRKSTST  141

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            V   + R+NE  R YSEAC+ LCK++D+KV+DLW  +Q+RDDW   CFTDG+HL+ EGSK
Sbjct  142  VLSEIVRTNETCRLYSEACVSLCKEMDLKVVDLWNGMQKRDDWATACFTDGLHLSEEGSK  201

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EIL+VLKEA+W+P LHW+++  E  E SP   +  + ++ IN S  TF+ + QW+
Sbjct  202  IVVEEILRVLKEAEWDPCLHWKAMPTEFGEDSPYDLVSSSGQSTINPSDWTFHRRIQWD  260



>gb|AFK34685.1| unknown [Medicago truncatula]
Length=256

 Score =   278 bits (712),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 180/239 (75%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWG+ L+DIYSR+AD++LRGY GWNSR ALQVL QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSYSHSGWGSFLSDIYSRKADILLRGYYGWNSRRALQVLHQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPL EY+ NMRKI +H++SLS+KTRII LSCPP++E +       
Sbjct  78   GNDSMGPHSSGLGPHVPLQEYIANMRKILVHIQSLSEKTRIIVLSCPPVHEEKVRGNTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL R YS+ACI+LCK+L VKV+DL+ ALQ  DDW   CFTDGIHL +EGSK
Sbjct  138  IFSELARTNELCRSYSDACIKLCKELGVKVVDLFNALQSIDDWENACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEILKVLKEADW P LHW+S+  E SE S    +  + K  +N S+ TF+ + QW+
Sbjct  198  IVVKEILKVLKEADWRPCLHWKSMHTEFSEDSQYDLVAADGKRTLNPSEWTFHREVQWD  256



>ref|XP_011019116.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Populus euphratica]
 ref|XP_011019117.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Populus euphratica]
Length=254

 Score =   278 bits (711),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/236 (61%), Positives = 180/236 (76%), Gaps = 3/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  EGWGALLA IY+R+AD+VLRGYSGWNSR A+Q+LDQVFPK+A  QPSLVIVYFG
Sbjct  18   QFSYSNEGWGALLAHIYARKADIVLRGYSGWNSRRAVQILDQVFPKDAAKQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS+ P  SGL  HVPL EY+EN+RKIAIHLKSLS+KTR+IFL+ PP+++ +    L  
Sbjct  78   GNDSIHPHASGLGPHVPLSEYIENVRKIAIHLKSLSEKTRVIFLTAPPVSDEQIRAHLSD  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
               + R+NE  R YSEAC+E+C+++++K IDLWTA+QQ D+W   C TDG+H   EG+KI
Sbjct  138  LIDMVRTNESCRIYSEACLEVCREMNLKAIDLWTAMQQIDNWETACLTDGVHFAPEGNKI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            VVKEILKV+KEA WEPSLHW+++  E SE SP   + P    +N S+L      QW
Sbjct  198  VVKEILKVIKEATWEPSLHWKAMPTEFSEDSPYDMVSPEGKTVNVSELDLLGSFQW  253



>ref|NP_001068562.1| Os11g0708400 [Oryza sativa Japonica Group]
 dbj|BAC78577.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAX95425.1| GDSL-like Lipase/Acylhydrolase, putative [Oryza sativa Japonica 
Group]
 gb|ABA95533.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28925.1| Os11g0708400 [Oryza sativa Japonica Group]
 gb|EAZ19341.1| hypothetical protein OsJ_34891 [Oryza sativa Japonica Group]
 dbj|BAG88194.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90415.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98728.1| unnamed protein product [Oryza sativa Japonica Group]
Length=260

 Score =   278 bits (711),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 184/239 (77%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWGA LADIY+R+AD++LRGY GWNSR ALQV+D++FPK++ VQPSLVIVYFG
Sbjct  22   QFSFSNGGWGAALADIYARKADILLRGYIGWNSRRALQVIDKIFPKDSPVQPSLVIVYFG  81

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+    SGL  HVPL EY++NMRKIA HLKSLS+KTR+IFLSCPP+NE    +    
Sbjct  82   GNDSVAAHSSGLGPHVPLEEYIDNMRKIADHLKSLSEKTRVIFLSCPPLNEETLRKSTST  141

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            V   + R+NE  R YSEAC+ LCK++D+KV+DLW A+Q+RDDW   CFTDG+HL+ EGSK
Sbjct  142  VLSEIVRTNETCRLYSEACVSLCKEMDLKVVDLWNAMQKRDDWATACFTDGLHLSEEGSK  201

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EIL++LKEA+W+P LHW+++  E  E SP   +  + ++ +N S  TF+   QW+
Sbjct  202  IVVEEILRILKEAEWDPCLHWKAMPTEFGEDSPYDLVSSSGQSTVNPSDWTFHRTIQWD  260



>ref|XP_010095233.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
 gb|EXB59001.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
Length=248

 Score =   278 bits (710),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 150/234 (64%), Positives = 179/234 (76%), Gaps = 15/234 (6%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG++L D+YSR+AD+VLRGYSGWNSR AL VLDQVFP++A VQPSLVIVYFG
Sbjct  18   QLSFSDGGWGSILGDLYSRKADIVLRGYSGWNSRHALLVLDQVFPEDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPLPEYVENMRKIAIHLK LS+KTRIIFL+ PPINE +  E +  
Sbjct  78   GNDSVKPHPSGLGQHVPLPEYVENMRKIAIHLKGLSEKTRIIFLTAPPINEDQIREFY--  135

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
                    R+YSEAC+ELCK++D+K IDLWTA+Q+  DW  TCF DGIH ++EGSK+VVK
Sbjct  136  --------REYSEACLELCKEMDIKAIDLWTAIQKGKDWQSTCFLDGIHFSAEGSKVVVK  187

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF----YW  81
            EILKVLKE DWEP+LH+ SL  E  E SP   +  + KT +N S+ +F    YW
Sbjct  188  EILKVLKEKDWEPNLHYNSLPAEFGEDSPYYPLSSDGKTTLNLSEFSFDRIIYW  241



>ref|XP_003600886.1| GDSL esterase/lipase CPRD49 [Medicago truncatula]
 gb|AES71137.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
 gb|AFK48492.1| unknown [Medicago truncatula]
Length=256

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 181/239 (76%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWG+ L+DIYSR+AD++LRGY GWNSR ALQVL QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSYSHSGWGSFLSDIYSRKADILLRGYYGWNSRRALQVLHQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPL EY+ NMRKI +H++SLS+KTRII LSCPP++E +       
Sbjct  78   GNDSMGPHSSGLGPHVPLQEYIANMRKILVHIQSLSEKTRIIVLSCPPVHEEKVRGNTSA  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL R YS+ACI+LCK+L VKV+DL+ ALQ  DDW   CFTDGIHL +EGSK
Sbjct  138  IFSELVRTNELCRSYSDACIKLCKELGVKVVDLFNALQSIDDWENACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEILKVLKEADW+P LHW+S+  E SE S    +  + K  +N S+ TF+ + QW+
Sbjct  198  IVVKEILKVLKEADWKPCLHWKSMHTEFSEDSQYDLVAADGKRTLNPSEWTFHREVQWD  256



>gb|AAM63310.1| CPRD49 [Arabidopsis thaliana]
Length=256

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+DQVFPK+A VQPSLVIVYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSSRALEVVDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EYV+NM+KIA+HL+SLSD TRIIFLS PP++EA+  +    
Sbjct  78   GNDSMAPHSSGLGPHVPLTEYVDNMKKIALHLQSLSDSTRIIFLSSPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+N+L + YS+AC+ELC++L ++V+DL++  Q+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNDLCKTYSDACVELCQELGLEVVDLFSTFQKADDWKTVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IV  EIL+V+KEA+W PSLHW+S+  E ++ SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  IVAGEILRVVKEAEWHPSLHWKSMPTEFADDSPYDLVSADGKQTVNSSEWTYFWEEQWD  256



>ref|XP_009377766.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Pyrus 
x bretschneideri]
Length=261

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 181/230 (79%), Gaps = 4/230 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GW A+LAD Y+R+ADV++RGY+GWNSR AL VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QLSFGNGGWSAILADFYARKADVLVRGYAGWNSRRALLVLDQVFPKDATIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL AHVPLPEY ENMRKI  HLKSLS+KTR+IFL+ PP+NE +  E    
Sbjct  78   GNDSVDPHPSGLGAHVPLPEYKENMRKIGKHLKSLSEKTRVIFLTAPPVNEEQIHEASDY  137

Query  407  L---GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            +    R+NE  + YS+AC+++C++LD+K +DLWT++Q+R DW  TCFTDG+H +SEGSKI
Sbjct  138  VPPKNRTNESCKAYSDACLDVCRELDIKGVDLWTSIQKRKDWSTTCFTDGVHFSSEGSKI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLT  90
            V +EILKVL+EADWEP LHW+SL  E SE SP      + KT IN ++++
Sbjct  198  VGEEILKVLREADWEPRLHWKSLPTEFSEDSPYDPPAADGKTTINIAEIS  247



>ref|XP_011045360.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
Length=261

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/244 (61%), Positives = 187/244 (77%), Gaps = 10/244 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWG++L+DIYSR+AD++LRGY GWNSR A+QVLDQVFPK+A VQP+LVIVYFG
Sbjct  18   QLCFSHGGWGSILSDIYSRKADILLRGYYGWNSRRAVQVLDQVFPKDAPVQPALVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLK-----SLSDKTRIIFLSCPPINEARAL  423
            GNDSM P  SGL  HVPL EY+ENMRKIAIHLK     SLSD TRIIF+SCPP++EAR  
Sbjct  78   GNDSMGPHSSGLGPHVPLDEYMENMRKIAIHLKIFENQSLSDTTRIIFMSCPPVDEARVS  137

Query  422  E----VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
                 +F  + R+NEL + YS +CI+LC++L VKV+DL++A Q+RD W   CFTDGIHL+
Sbjct  138  SSTSGIFSEVVRTNELCQIYSNSCIKLCQELGVKVVDLFSAFQKRDGWTTACFTDGIHLS  197

Query  254  SEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQ  78
            +EGSKIVV+EILKVLKEA+W PSLHW+S+  E SE SP   +  + K  +N S+ TF+ +
Sbjct  198  AEGSKIVVEEILKVLKEAEWVPSLHWKSMPTEFSEDSPYDLVAADGKRTLNPSEWTFHRE  257

Query  77   PQWN  66
              W+
Sbjct  258  VHWD  261



>ref|XP_002309140.1| CPRD49 family protein [Populus trichocarpa]
 gb|EEE92663.1| CPRD49 family protein [Populus trichocarpa]
Length=254

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 179/236 (76%), Gaps = 3/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  EGWGALLA IY+R+AD++LRGYSGWNSR A+Q+LDQVFPK+A  QPSLVIVYFG
Sbjct  18   QFSYSNEGWGALLAHIYARKADIILRGYSGWNSRRAVQILDQVFPKDAAKQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P  +GL  HVPL EY+EN+RKIAIHLKSLS+KTR+IFL+ PP+++ +     G 
Sbjct  78   GNDSTHPHATGLGPHVPLSEYIENVRKIAIHLKSLSEKTRVIFLTAPPVSDEQIRAHLGD  137

Query  407  L---GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            L    R+NE  R YSEAC+E+C+++++K IDLWTA QQ D+W   C TDG+H   EGSKI
Sbjct  138  LLDMVRTNESCRIYSEACLEVCREMNLKAIDLWTATQQIDNWETVCLTDGVHFAPEGSKI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            VVKEILKV+KEA+WEPSLHW+++  E SE SP   I P    +N S+L      QW
Sbjct  198  VVKEILKVIKEANWEPSLHWKAMPTEFSEDSPYDPISPEGKTVNVSELDLLGSFQW  253



>gb|KJB78773.1| hypothetical protein B456_013G018300 [Gossypium raimondii]
Length=403

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 188/239 (79%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y+R+AD++LRGY GWNSR A+QVLD VFPK+A  QP L+I YFG
Sbjct  165  QLSFSNGGWGAILADVYARKADILLRGYFGWNSRRAIQVLDHVFPKDASTQPELIITYFG  224

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM   PSGL  HVPLPEY+ENM++I  +LK LSD TR+IFL+ PP+NE R    A E
Sbjct  225  GNDSMGAHPSGLGPHVPLPEYIENMKQIVNYLKGLSDSTRLIFLTSPPVNEERVNKYASE  284

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  L R+NEL + Y++AC++LC++LDVKV++L+TA QQR++W+  CFTDG+HL++EGSK
Sbjct  285  HFSHLVRTNELCQTYADACVKLCQELDVKVVNLFTAFQQRENWMTDCFTDGVHLSAEGSK  344

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV EILKVLKEA+W+PSLHW+S+  E +E SP   +G + KT +N S+ TF+ + QW+
Sbjct  345  IVVAEILKVLKEAEWKPSLHWKSMPTEFAEDSPYDIVGADGKTTLNPSEWTFHQEIQWD  403



>ref|XP_008370094.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Malus domestica]
Length=262

 Score =   276 bits (707),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 170/213 (80%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+   GWGA+LAD+Y+R+ADV+LRGY+GWNSR ALQVL QVFPK+A  QPSLVIVYFG
Sbjct  18   QFSYSHGGWGAILADLYARKADVLLRGYAGWNSRRALQVLXQVFPKDATTQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF--  414
            GNDSM P PSGL AHVPL EYVENMRKIA HLKSLS+KTR+IFL+ PP+NE +  E    
Sbjct  78   GNDSMHPHPSGLGAHVPLKEYVENMRKIAKHLKSLSEKTRVIFLTAPPVNEEQIRENLSD  137

Query  413  --GTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE  + YS+AC+E+C++ DVK +DLWT++Q+  DW  TCF DGIH +SEGSK
Sbjct  138  QTSPQKRTNESCKIYSDACLEVCREFDVKGVDLWTSIQKTKDWSTTCFRDGIHFSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVL+EADWEP LHW+SL  E SE SP
Sbjct  198  IVAEEILKVLREADWEPCLHWKSLPTEFSEDSP  230



>ref|NP_566387.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SRM5.1|CPR49_ARATH RecName: Full=GDSL esterase/lipase CPRD49; AltName: Full=Extracellular 
lipase CPRD49; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF01505.1|AC009991_1 unknown protein [Arabidopsis thaliana]
 gb|AAG50959.1|AC073395_1 unknown protein; 50065-48267 [Arabidopsis thaliana]
 gb|ABD59113.1| At3g11210 [Arabidopsis thaliana]
 dbj|BAF00764.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75014.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=256

 Score =   276 bits (706),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 187/239 (78%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+L+++Y+R+AD++LRGY GWNS  AL+V+DQVFPK+A VQPSLVIVYFG
Sbjct  18   QMSFGHGGWGAILSEVYARKADIILRGYYGWNSSRALEVVDQVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSM P  SGL  HVPL EYV+NM+KIA+HL+SLSD TRIIFLS PP++EA+  +    
Sbjct  78   GNDSMAPHSSGLGPHVPLTEYVDNMKKIALHLQSLSDFTRIIFLSSPPVDEAKVRQNQSP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+N+L + YS+AC+ELC++L ++V+DL++  Q+ DDW   CFTDGIHL+++GSK
Sbjct  138  YLSEVIRTNDLCKTYSDACVELCQELGLEVVDLFSTFQKADDWKTVCFTDGIHLSAQGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IV  EIL+V+KEA+W PSLHW+S+  E ++ SP   +  + K  +N+S+ T++W+ QW+
Sbjct  198  IVAGEILRVVKEAEWHPSLHWKSMPTEFADDSPYDLVSADGKQTVNSSEWTYFWEEQWD  256



>ref|XP_011014736.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Populus euphratica]
Length=241

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 177/223 (79%), Gaps = 2/223 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA+LAD Y+R+AD+V+RGY GWNSR ALQVLD++FPK+A VQPSLVI YFG
Sbjct  18   QKSFGNGGWGAILADTYARKADIVMRGYGGWNSRNALQVLDKIFPKDAAVQPSLVITYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P P+ L+ HVPLPE++ENM+KIA HLKSLS+KTR+IFL  PP N+   ++++G 
Sbjct  78   GNDSMKPIPAELSPHVPLPEFIENMKKIATHLKSLSEKTRVIFLGVPPANDEMIIQLYGE  137

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               RSNE  R YSEA ++LC++L+VK IDLWT +QQ++DWL TCFTDG+HL SEGSKIV 
Sbjct  138  RAARSNEGARIYSEATLKLCQELEVKAIDLWTIMQQKNDWLTTCFTDGVHLASEGSKIVA  197

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINT  102
            KEI++ L+EA+WEPSL+W+ + +E    SP    G N T IN+
Sbjct  198  KEIMRALEEAEWEPSLYWKLMPSEFVGISPFDSEG-NGTIINS  239



>gb|AFK44579.1| unknown [Lotus japonicus]
Length=256

 Score =   276 bits (705),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/239 (62%), Positives = 182/239 (76%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+DIYSR+AD+ LRGY GWNSR ALQVL+QVFPK+A  QPSLVIVY G
Sbjct  18   QMSFSHGGWGAILSDIYSRKADISLRGYYGWNSRRALQVLNQVFPKDAAAQPSLVIVYLG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P  SGL  HVPL EYV NMRKI +H++SLS+KTRII LSCPP+NE +    A  
Sbjct  78   GNDSMGPHSSGLGPHVPLEEYVANMRKILVHIQSLSEKTRIIVLSCPPVNEEKVRGNASP  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NEL   YSEAC++LC++L VKV+DL+ A+Q+ DDW+  CFTDGIHL +EGSK
Sbjct  138  YLSEVIRTNELCGSYSEACVKLCQELGVKVVDLFRAIQEGDDWMDACFTDGIHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEILKVLKEADWEP LHW+S+  E SE SP   +  + K+ +N  + TFY + QW+
Sbjct  198  IVVKEILKVLKEADWEPCLHWRSVPTEFSEDSPYDLVTADGKSTLNPFEWTFYREVQWD  256



>dbj|BAJ98550.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94978.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=254

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 180/238 (76%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+Y+R+AD+VLRGY  WNSR ALQV+ ++FPK++ VQPSLV+VYFG
Sbjct  16   QYSFSNGGWGATLADVYARKADIVLRGYIAWNSRRALQVITKIFPKDSAVQPSLVVVYFG  75

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EY+ NMRKI  HLKSLSDKTR+IFLSCPP+NE    +   T
Sbjct  76   GNDSIAPHPSGLGPHVPLEEYMNNMRKIGEHLKSLSDKTRVIFLSCPPLNEEVLKKSTST  135

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  R YSEACI + K++D+KV+DLW A+Q+R+DW   CFTDG+HL+ EGS 
Sbjct  136  ALSEIVRTNETCRLYSEACISVSKEMDIKVVDLWNAMQKREDWATACFTDGLHLSEEGSN  195

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVV+EIL++LKEA+W+P LHWQ++  E  E SP   +  + K+ IN S+ TF+ +  W
Sbjct  196  IVVEEILRILKEAEWDPCLHWQAMPTEFGEDSPYDLVASSGKSTINPSEWTFHRKISW  253



>ref|XP_003562792.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Brachypodium 
distachyon]
Length=259

 Score =   275 bits (704),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/239 (59%), Positives = 181/239 (76%), Gaps = 6/239 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+AD++LRGY GWNSR ALQV+++VFPK++ VQPSLVIVYFG
Sbjct  20   QYSFSNGGWGATLADIYARKADIILRGYIGWNSRRALQVIEKVFPKDSEVQPSLVIVYFG  79

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+    SGL  HVPL EY ENMRKIA HLKSLSDKTR+IFLSC PINE    +   T
Sbjct  80   GNDSIAEHSSGLGPHVPLEEYTENMRKIAKHLKSLSDKTRVIFLSCAPINEETLRKTMST  139

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  R YSEACI +CK++D+K++DLW A+Q+RDDW  TCFTDG+H + EGS 
Sbjct  140  ELSEVIRTNEACRLYSEACISVCKEMDIKMVDLWNAIQKRDDWATTCFTDGVHFSEEGSN  199

Query  239  ivvkeilkvlk-EADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVV++IL+VLK  A+WEPSLHW+++  E  E SP   +  + ++ IN ++LTF  +  W
Sbjct  200  IVVEQILRVLKDAAEWEPSLHWKAMPTEFDEDSPYDPVASSGQSTINPTKLTFLTKIPW  258



>ref|XP_007133895.1| hypothetical protein PHAVU_010G001100g [Phaseolus vulgaris]
 gb|ESW05889.1| hypothetical protein PHAVU_010G001100g [Phaseolus vulgaris]
Length=256

 Score =   275 bits (702),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 170/212 (80%), Gaps = 4/212 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            + S+  EGWGA LA++Y+R+ADV+LRGY GWNSR ALQ LD++FPKNA  QPSLVIVYFG
Sbjct  18   ELSYSCEGWGATLANLYARKADVMLRGYCGWNSRRALQALDKIFPKNASDQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P P+  + HVPL EY+ENMRKIAIHLKSLS KTR+IFLS PPINE +  E+   
Sbjct  78   GNDSMHPHPTAHSPHVPLQEYIENMRKIAIHLKSLSKKTRLIFLSSPPINEVQMHEMLSD  137

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              G L R+NE  R YSEAC+ELC++++VK IDLW+A+QQR DW   CFTDGIHL+ EG+K
Sbjct  138  LLGPLKRTNESCRIYSEACLELCREMNVKAIDLWSAVQQRHDWSDVCFTDGIHLSHEGNK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETS  144
            IV KEILKVL+EADWEPSLHW S+  E +E S
Sbjct  198  IVAKEILKVLREADWEPSLHWNSMPTEFAEDS  229



>ref|XP_008663734.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Zea mays]
 gb|ADT92197.1| isoamyl acetate-hydrolyzing esterase-like protein [Zea mays]
 gb|AFW59925.1| isoamyl acetate-hydrolyzing esterase [Zea mays]
Length=258

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/242 (56%), Positives = 186/242 (77%), Gaps = 8/242 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LADIY+R+AD++LRGY+GWN+R A+QV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAVLADIYARKADILLRGYTGWNTRRAVQVMDKVFPKDSAVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-------AR  429
            GNDS+    SGL  HVPL EY+ NMRKIA HLKSLS+KTR+IFLSCPP+NE       + 
Sbjct  77   GNDSIAAHSSGLGPHVPLDEYIANMRKIAEHLKSLSEKTRVIFLSCPPLNEEMLRKSTSS  136

Query  428  ALEVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            ++ +   + R+NE  R YS+AC+ LCK++++KV+DLW A+Q+R+DW+  CFTDG+HL+ E
Sbjct  137  SIAILSEIVRTNETCRLYSDACVALCKEMELKVVDLWHAMQKREDWMTACFTDGLHLSEE  196

Query  248  GSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQ  72
            GS +VV+EILKVLKEA+WEP LHW+++  E +E SP   +  +    +N S+ T + +  
Sbjct  197  GSNVVVEEILKVLKEAEWEPCLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTVHRRIP  256

Query  71   WN  66
            W+
Sbjct  257  WD  258



>ref|XP_008663735.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Zea mays]
Length=257

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 185/241 (77%), Gaps = 7/241 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA+LADIY+R+AD++LRGY+GWN+R A+QV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAVLADIYARKADILLRGYTGWNTRRAVQVMDKVFPKDSAVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARA  426
            GNDS+    SGL  HVPL EY+ NMRKIA HLKSLS+KTR+IFLSCPP+NE        +
Sbjct  77   GNDSIAAHSSGLGPHVPLDEYIANMRKIAEHLKSLSEKTRVIFLSCPPLNEEMLRKSTSS  136

Query  425  LEVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
            + +   + R+NE  R YS+AC+ LCK++++KV+DLW A+Q+R+DW+  CFTDG+HL+ EG
Sbjct  137  IAILSEIVRTNETCRLYSDACVALCKEMELKVVDLWHAMQKREDWMTACFTDGLHLSEEG  196

Query  245  SkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            S +VV+EILKVLKEA+WEP LHW+++  E +E SP   +  +    +N S+ T + +  W
Sbjct  197  SNVVVEEILKVLKEAEWEPCLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTVHRRIPW  256

Query  68   N  66
            +
Sbjct  257  D  257



>ref|XP_002528098.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
 gb|EEF34277.1| Isoamyl acetate-hydrolyzing esterase, putative [Ricinus communis]
Length=257

 Score =   274 bits (701),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWGA+LA++Y+R+AD++LRGY GWNSR AL +LDQVFP+NA VQP+L IVYFG
Sbjct  18   QLSYSNGGWGAILANLYARKADILLRGYGGWNSRNALHILDQVFPENAPVQPALAIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF-G  411
            GNDS+ P  +G + HVPLPEY+ENM+KI  HLKSLS+KTR+IFLS PP+NE    + F G
Sbjct  78   GNDSVQPLSTGFSPHVPLPEYIENMKKIVQHLKSLSEKTRLIFLSAPPVNEEMIRQYFGG  137

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             +GR+NE  R YSEAC++LC+++ V  IDLWTA+QQRDDWL  CFTDGIHL+ EGSKIVV
Sbjct  138  NIGRTNETCRIYSEACLKLCREIGVTAIDLWTAMQQRDDWLTACFTDGIHLSEEGSKIVV  197

Query  230  keilkvlkEADWEPSLHWQSLANESSETSP  141
             EI+KVL+ ADWEP+LHW +L +E    +P
Sbjct  198  NEIMKVLRNADWEPNLHWTALPSEFVGVTP  227



>ref|XP_007205742.1| hypothetical protein PRUPE_ppa010192mg [Prunus persica]
 gb|EMJ06941.1| hypothetical protein PRUPE_ppa010192mg [Prunus persica]
Length=260

 Score =   274 bits (701),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 170/213 (80%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS    GWGA+LAD+YSR+ADV+LRGY+GWNSR ALQVL+QVFPK+A +QPSLVIVYFG
Sbjct  18   QFSCSNGGWGAILADLYSRKADVLLRGYAGWNSRRALQVLEQVFPKDAAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDSMLP  SGL  HVPLPEY ENMRKI  +LKSLS+  RIIFL+ PP+NE + LE    
Sbjct  78   GNDSMLPHSSGLGPHVPLPEYAENMRKIGKYLKSLSENIRIIFLTAPPVNEKQILENLSD  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +     R+NE  + YS+AC+E+C++LDVK +DLWT++Q+R DW   CFTDGIH ++  SK
Sbjct  138  IIPKRNRTNESCKIYSDACLEVCRELDVKAVDLWTSIQKRKDWSTACFTDGIHFSAAASK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVL+EADWEPSLHW+SL  E +E SP
Sbjct  198  IVAEEILKVLREADWEPSLHWKSLPTEFAENSP  230



>ref|XP_004500485.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=256

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 182/239 (76%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+   GWG+ L+DIYSR+AD++LRGY GWNSR AL+VL+QVFPK+A  QPSLVIVYFG
Sbjct  18   QLSYSHTGWGSFLSDIYSRKADILLRGYYGWNSRRALEVLEQVFPKDAATQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM P  SGL  HVPL EY+ NMRKI +H++SLS+ TRII LSCPP+NE +       
Sbjct  78   GNDSMGPHSSGLGPHVPLQEYIANMRKILVHIQSLSENTRIIVLSCPPVNEEKVRGNTSS  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+N+L   YS+ACI+LC++L VKVIDL+ ALQ +DDW   CFTDG+HL +EGSK
Sbjct  138  IFSELVRTNDLCGSYSDACIKLCQELGVKVIDLFNALQSKDDWENACFTDGVHLAAEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVVKEILKVLKEADW+P LHW+S+  E SE SP   +  + +  +N S+ TF+ + QW+
Sbjct  198  IVVKEILKVLKEADWKPCLHWKSMHTEFSEDSPYDLVAADGQKTLNPSEWTFHREIQWD  256



>ref|XP_009377762.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Pyrus 
x bretschneideri]
Length=262

 Score =   273 bits (699),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 170/213 (80%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+   GWGA+LAD+Y+R+ADV+LRGY+GWNSR ALQVL+QVFPK+A  QPSLVIVYFG
Sbjct  18   QFSYSHGGWGAVLADLYARKADVLLRGYAGWNSRRALQVLEQVFPKDATTQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSGL AHVPL EYVENMRKIA HLKSLS+KTR+IFL+ PP+NE +  E    
Sbjct  78   GNDSMHPHPSGLGAHVPLNEYVENMRKIAKHLKSLSEKTRVIFLTAPPVNEEQIRENLSV  137

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE  + YS+AC+E+C++ DVK +DLWT++Q+  DW  TCF DGIH +SEGSK
Sbjct  138  QTSPQKRTNESCKIYSDACLEVCQEFDVKGVDLWTSIQKIKDWSTTCFRDGIHFSSEGSK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            IV +EILKVL+EADWEP LHW+SL  E  E SP
Sbjct  198  IVAEEILKVLREADWEPCLHWKSLPTEFLEDSP  230



>gb|KJB76946.1| hypothetical protein B456_012G114000 [Gossypium raimondii]
Length=239

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 170/225 (76%), Gaps = 3/225 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+  EGWGA+LA  Y+R+AD++LRGY GWNSR AL+VL +VFPK+A VQPSLVIVYFG
Sbjct  18   QFSYSNEGWGAILAHAYARKADIILRGYGGWNSRRALEVLHKVFPKDAAVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P PSGL  HVPLPEYVENM+KIA+HLK LS+ T ++FLS PP+NE +  E FG 
Sbjct  78   GNDSTEPHPSGLGPHVPLPEYVENMKKIAMHLKGLSENTHVMFLSTPPMNEGQTGESFGK  137

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
              R+NE  R YSEAC++LC+++D+K IDLWTA+QQRDDW   CFTDGIHL+SEGSK+V +
Sbjct  138  CARTNEGCRIYSEACLKLCQEVDIKCIDLWTAIQQRDDWKTVCFTDGIHLSSEGSKLVGE  197

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQL  93
            EILK L E   EPSL W+SL  E  E S    +      IN S L
Sbjct  198  EILKALAE---EPSLCWRSLPTEFDEDSVFDPVDEEGKNINISNL  239



>ref|XP_003558761.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Brachypodium distachyon]
Length=258

 Score =   272 bits (696),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/239 (59%), Positives = 180/239 (75%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+AD+VLRGY GWNSR ALQV+D+VFPK++ VQPSLVIVYFG
Sbjct  20   QYSFSNGGWGATLADIYARKADIVLRGYIGWNSRRALQVIDKVFPKDSAVQPSLVIVYFG  79

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+   PSGL  HVPL EY+ NM+KIA HLKSLSDKTR+IFLSCPP+NE    +   T
Sbjct  80   GNDSIAAHPSGLGPHVPLEEYINNMKKIAEHLKSLSDKTRVIFLSCPPLNEETLRKSTST  139

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                + R+NE  R YSEACI +CK++D+K +DLW A+Q+RDDW   CFTDG+HL+ EGS 
Sbjct  140  ALSEIVRTNETCRLYSEACISVCKEMDLKCVDLWNAIQKRDDWATACFTDGLHLSEEGSN  199

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            +VV+EIL+VLK+   E  LHW+++  E  E SP   +  + ++ IN SQ TF+ + QW+
Sbjct  200  LVVEEILRVLKDDAAEWGLHWKAMPTEFDEDSPYDLVASSGQSTINPSQWTFHRKIQWD  258



>gb|EYU41890.1| hypothetical protein MIMGU_mgv1a010613mg [Erythranthe guttata]
Length=307

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 178/238 (75%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  +   GWGA+LAD+Y+R+ADVVLRGYSGWN+R ALQ+LD+VFPK+   QPSLVI+YFG
Sbjct  67   QMCYNVGGWGAILADLYARKADVVLRGYSGWNTRMALQILDKVFPKDEATQPSLVILYFG  126

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+  P PSGL  HVPLPE++ENM+K+ +H+K+LSDKTRII L+ PPINE +   +FG 
Sbjct  127  GNDATNPHPSGLGTHVPLPEFLENMKKMILHIKNLSDKTRIICLTSPPINEKQIHAIFGD  186

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+ E  R YSEA  ELC++LDV  I+LWTA+QQ+DDW  TCF DGIHL++EGSK
Sbjct  187  ALSDQARTKEGCRIYSEALAELCQELDVVPINLWTAIQQKDDWADTCFIDGIHLSAEGSK  246

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVV EILKVLK+ DWEPSL+W S+ +E  E SP   +GP+ K   N S     WQ +W
Sbjct  247  IVVGEILKVLKKVDWEPSLYWLSMESEFPEDSPYYVVGPDGKNTFNVSTHICTWQREW  304



>ref|XP_002460017.1| hypothetical protein SORBIDRAFT_02g020850 [Sorghum bicolor]
 gb|EER96538.1| hypothetical protein SORBIDRAFT_02g020850 [Sorghum bicolor]
Length=256

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 182/240 (76%), Gaps = 6/240 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+ F   GWGA LADIY+R+AD++LRGY GWN+R A+QV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYGFSNGGWGAALADIYARKADILLRGYIGWNTRRAVQVMDKVFPKDSAVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR-----AL  423
            GNDS+    SGL  HVPL EY+ NMRKIA HLKSLS+KTR+IFLSCPP+NE R     + 
Sbjct  77   GNDSIAAHSSGLGPHVPLDEYIGNMRKIAAHLKSLSEKTRVIFLSCPPLNEERLRNSTSS  136

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
             +   + R+NE    YS+AC+ LCK++++KV+DLW A+Q+R+DW+  CFTDG+HL+ EGS
Sbjct  137  TILSEIVRTNETCHLYSDACVALCKEMNLKVVDLWHAIQKREDWITACFTDGLHLSEEGS  196

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
             IVV+EILKVLKEA+WEP LHW+++  E +E SP   +  +  T +N S+ T + +  W+
Sbjct  197  NIVVEEILKVLKEAEWEPCLHWKAMPTEFAEDSPFDLVSSSGDTTVNPSEWTIHRKLPWD  256



>gb|ACG32472.1| isoamyl acetate-hydrolyzing esterase [Zea mays]
 gb|ACG38776.1| isoamyl acetate-hydrolyzing esterase [Zea mays]
Length=256

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 183/240 (76%), Gaps = 6/240 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+ADV+LRGY GWN+R A+QV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAALADIYARKADVLLRGYIGWNTRRAVQVMDKVFPKDSAVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-----ARAL  423
            GNDS+    SGL  HVPL EY+ NMRKIA HLKSLS+KTR++FLSCPP+NE     + + 
Sbjct  77   GNDSIDAHCSGLGPHVPLDEYIGNMRKIAEHLKSLSEKTRVLFLSCPPLNEEMLRNSTSS  136

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
             +   + R+NE  R YS+AC+ LCK++ +KV+DLW A+Q+R+DW   CFTDG+HL+ EGS
Sbjct  137  TILSEIVRTNETCRLYSDACVALCKEMHLKVVDLWHAMQKREDWKTACFTDGLHLSEEGS  196

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
             IVV+EILKVLKEA+WEPSLHW+++  E +E SP   +  +    +N S+ T + + QW+
Sbjct  197  NIVVEEILKVLKEAEWEPSLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTIHRKIQWS  256



>ref|NP_001281221.1| LOC100283985 [Zea mays]
 gb|ACN26082.1| unknown [Zea mays]
 gb|ACR37822.1| unknown [Zea mays]
Length=255

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 180/239 (75%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+ADV+LRGY GWN+R A+QV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAALADIYARKADVLLRGYIGWNTRRAVQVMDKVFPKDSAVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALE  420
            GNDS+    SGL  HVPL EY+ NMRKIA HLKSLS+KTR++FLSCPP+NE         
Sbjct  77   GNDSIDAHCSGLGPHVPLDEYIGNMRKIAEHLKSLSEKTRVLFLSCPPLNEEMLRNSTST  136

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   + R+NE  R YS+ C+ LCK++ +KV+DLW A+Q+R+DW   CFTDG+HL+ EGS 
Sbjct  137  ILSEIVRTNETCRLYSDVCVALCKEMHLKVVDLWHAMQKREDWKTACFTDGLHLSEEGSN  196

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEA+WEPSLHW+++  E +E SP   +  +    +N S+ T + + QWN
Sbjct  197  IVVEEILKVLKEAEWEPSLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTIHRKIQWN  255



>ref|XP_004980097.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Setaria 
italica]
Length=256

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 183/240 (76%), Gaps = 6/240 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+AD++LRGY GWN+R ALQV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAALADIYARKADILLRGYIGWNTRRALQVMDKVFPKDSPVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-----ARAL  423
            GNDS+    SGL  HVP+ EY++NMRKIA HLKSLS+KTR+IFLSCPP+NE     + + 
Sbjct  77   GNDSIAAHSSGLGPHVPVDEYIDNMRKIAEHLKSLSEKTRVIFLSCPPLNEEMLRRSTSS  136

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
             +   + R+NE  R YS+AC+ LCK++++KV+DLW A+Q R+DW+  CFTDG+HL+ EGS
Sbjct  137  TILSEIVRTNETCRLYSDACVALCKEMNLKVVDLWHAMQTREDWMTACFTDGLHLSEEGS  196

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
             IVV+EILKVLKEADW+P LHW+++  E +E SP   +  +    +N S+ T + +  W+
Sbjct  197  NIVVEEILKVLKEADWDPCLHWKAMPTEFAEDSPYDLVSSSGDATVNPSEWTIHRRIPWD  256



>ref|XP_010106264.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
 gb|EXC09421.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
Length=275

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/237 (60%), Positives = 182/237 (77%), Gaps = 5/237 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            + S+   GWGA+L+DIY+R+AD++LRGY GWNSR ALQVLDQVFPK+A VQPSLVIVYFG
Sbjct  37   KLSYSNGGWGAMLSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDASVQPSLVIVYFG  96

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL----E  420
            GNDSM    SGL  HVPLPEY+ENM+KIA HL+SLSD  RIIFL+CPP+NE +       
Sbjct  97   GNDSMGSHSSGLGPHVPLPEYIENMKKIARHLQSLSDSIRIIFLTCPPVNEEKVCGTTSG  156

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +F  L R+NEL  +YSEACI++ ++  VKVIDL++A Q+ DDW+  CFTDGIHL++EGSK
Sbjct  157  IFSELVRTNELCGQYSEACIKVGQETGVKVIDLFSAFQRSDDWMNACFTDGIHLSAEGSK  216

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQ  72
            IVV+EILKVLK A+W+P LHW+S+  E SE S    +  + K  +N S+ TF+ + Q
Sbjct  217  IVVEEILKVLKSAEWKPCLHWKSVPTEFSEDSSYDLVAADGKRTLNPSEWTFHREIQ  273



>ref|XP_004980098.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Setaria 
italica]
Length=255

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 181/239 (76%), Gaps = 5/239 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIY+R+AD++LRGY GWN+R ALQV+D+VFPK++ VQPSLVIVYFG
Sbjct  17   QYSFSNGGWGAALADIYARKADILLRGYIGWNTRRALQVMDKVFPKDSPVQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----  420
            GNDS+    SGL  HVP+ EY++NMRKIA HLKSLS+KTR+IFLSCPP+NE         
Sbjct  77   GNDSIAAHSSGLGPHVPVDEYIDNMRKIAEHLKSLSEKTRVIFLSCPPLNEEMLRRSTST  136

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
            +   + R+NE  R YS+AC+ LCK++++KV+DLW A+Q R+DW+  CFTDG+HL+ EGS 
Sbjct  137  ILSEIVRTNETCRLYSDACVALCKEMNLKVVDLWHAMQTREDWMTACFTDGLHLSEEGSN  196

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            IVV+EILKVLKEADW+P LHW+++  E +E SP   +  +    +N S+ T + +  W+
Sbjct  197  IVVEEILKVLKEADWDPCLHWKAMPTEFAEDSPYDLVSSSGDATVNPSEWTIHRRIPWD  255



>ref|XP_004492452.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=255

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 180/237 (76%), Gaps = 3/237 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG +LA++YSR+AD++LRGYSGWNSR AL+VLD++FPK+A VQPSLVI+YFG
Sbjct  18   QMSFDNGGWGGILANLYSRKADIILRGYSGWNSRRALEVLDEIFPKDAYVQPSLVIIYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EYVENMRKIA HLKSLSD  R+IFL+ PPI+E +  +    
Sbjct  78   GNDSIHPHPSGLGPHVPLEEYVENMRKIANHLKSLSDHIRLIFLTSPPISEVQIRKKLSA  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE    Y++A +ELC +L++KVI+LW+A+QQRDDWL   FTDG+HL++EGSK+V
Sbjct  138  TQSGRTNEHCGIYAKALVELCDELNLKVINLWSAIQQRDDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            VKEILKVL+EADW+PSLHW SL  E +E SP     P+  T IN S        QW+
Sbjct  198  VKEILKVLREADWKPSLHWMSLPTEYAEDSPYYPPSPDGTTTINVSYSIPRRHLQWD  254



>ref|XP_002879730.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55989.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=294

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 177/228 (78%), Gaps = 6/228 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR AD++LRGY+GWNSR AL+VL QVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFTDRGWGATLADLYSRTADIILRGYAGWNSRFALKVLHQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P PSG   HVPL E++ENMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSTHPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLTPPPMNEKQIEVVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
            +  GRSNEL R Y+E  + LC++++VK ID+WTA+QQ+DDWL +CFTDGIH T++ S+IV
Sbjct  138  VIRGRSNELCRPYAEELLNLCREINVKGIDIWTAIQQQDDWLNSCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLT  90
            +KEILKV++EADW+PSL+W+SL  E     P  F  PN   +N  +LT
Sbjct  198  IKEILKVVREADWKPSLYWKSLPVE----FPFDFDVPNSISLNDLELT  241



>ref|XP_011006553.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Populus 
euphratica]
Length=254

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 178/236 (75%), Gaps = 3/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+LA IY+R+AD+VLRGYSGWNSR A+QVLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QLSYINEGWGAILAHIYARKADIVLRGYSGWNSRRAVQVLDQVFPKDAAIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS+ P  +GL  HVPLPEY+EN RKIA+HLKS+SDKTR+IFLS PP +E +    L  
Sbjct  78   GNDSVHPHATGLGPHVPLPEYIENTRKIAMHLKSISDKTRVIFLSAPPASEEQIGIHLSD  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
               + R+NE  R YSEAC+E+C+++++K +DLWTA+QQ D+W   C  DGIH   EGS+I
Sbjct  138  KIDMVRTNESCRIYSEACLEVCREMNLKAVDLWTAIQQVDNWETVCLKDGIHFAPEGSRI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            +VKEIL+V+KEA WEPSL+W+++A+E SE SP   +      +N S+   +    W
Sbjct  198  IVKEILRVIKEAHWEPSLYWKAMASEFSEDSPYDPVSMEGKTVNVSEPDLFGDFPW  253



>ref|XP_009133234.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Brassica rapa]
 emb|CDY07749.1| BnaA03g17620D [Brassica napus]
Length=250

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR AD++LRGY GWNSR AL+VLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QYSFINGGWGASLADVYSRTADIILRGYGGWNSRYALKVLDQVFPKDAVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P PSG   HVPL E++ENMRKI  HL SLSDKTR+IFLS PP+NE +   VFG 
Sbjct  78   GNDSKAPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLSPPPMNETQIQLVFGN  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNE+ R Y+EA + LC +++VK +DLW A+QQ+DDWL TCFTDGIH T++ S++V
Sbjct  138  AIKGRSNEVCRPYAEALLNLCNEINVKSVDLWNAIQQQDDWLNTCFTDGIHFTAKASEVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKE+LKV+KEADW+PSLHW+SL  E
Sbjct  198  VKEVLKVVKEADWKPSLHWKSLPIE  222



>ref|XP_006583655.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Glycine max]
Length=254

 Score =   265 bits (678),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 184/238 (77%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD+VLRGY+ WNSR ALQVLD +FPK+A  QPSLVIVYFG
Sbjct  18   QYSY-YEGWGATLSHLYARKADIVLRGYAAWNSRRALQVLDTIFPKDAKEQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL---EV  417
            GNDS LP+P+GL  HVP+ EY ENMRKIAIH+K LS+KTR IFL+ PPINEA+     + 
Sbjct  77   GNDSTLPNPNGLGPHVPVEEYKENMRKIAIHMKCLSEKTRTIFLTTPPINEAQIHNNSDP  136

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
             G L R+NE    Y+EAC+E+C +++VK IDLW+A+Q++D+W   CF DGIHL++EGSKI
Sbjct  137  HGLLLRTNEACLIYAEACLEVCHEMNVKAIDLWSAIQKKDNWRDVCFIDGIHLSTEGSKI  196

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            V KEILKVLKEA+WEPSL+W+S+ ++  E SP   +GP+ K+ IN S   F    QW+
Sbjct  197  VTKEILKVLKEAEWEPSLYWRSMPSDFGEDSPYDPVGPDGKSTINLSNFAFPNNDQWD  254



>ref|XP_004137721.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Cucumis sativus]
 ref|XP_004156607.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Cucumis sativus]
 gb|KGN58760.1| hypothetical protein Csa_3G731220 [Cucumis sativus]
Length=232

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 168/206 (82%), Gaps = 3/206 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSFG  GWG++LAD+YSR+AD+++RGY+GWNSR AL VL  +FPK++  QPSLVIVYFG
Sbjct  18   QFSFGDGGWGSILADLYSRQADILVRGYAGWNSREALGVLHHLFPKDSANQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GND MLP PS  N +VPL EYVENM+KIAIHLKSLS+KTR+IFL+ PP++     E    
Sbjct  78   GNDCMLPFPSSKNPYVPLSEYVENMKKIAIHLKSLSEKTRVIFLTAPPVSYNLIKEKMSE  137

Query  410  --TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
                 R+ E  RKY+EAC ELCK++DVK IDLW+A+Q+RDDWL +CFTDG+HLT+EGS+I
Sbjct  138  DHAERRTLESCRKYAEACKELCKKIDVKCIDLWSAIQKRDDWLTSCFTDGVHLTAEGSEI  197

Query  236  vvkeilkvlkEADWEPSLHWQSLANE  159
            V +EILKVL+EADWEPSLHW++L  E
Sbjct  198  VAEEILKVLEEADWEPSLHWKTLPIE  223



>ref|XP_010517106.1| PREDICTED: GDSL esterase/lipase At2g38180 isoform X1 [Camelina 
sativa]
Length=273

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 169/205 (82%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIYSR AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFTDGGWGATLADIYSRTADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG   HVPL E+++NMRKI  HL  LSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSMDPHPSGFGPHVPLSEFIDNMRKIGEHLLGLSDKTRVIFLTPPPMNEKQIQLVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
            +  GRSNEL R Y+EA + LC++++VK +D+WTA+QQ+DDWL +CFTDGIH T++ S+IV
Sbjct  138  VIKGRSNELCRPYAEALLNLCREINVKGVDIWTAIQQQDDWLNSCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            +KEILK ++EADW+PSL+W+SL  E
Sbjct  198  LKEILKAVREADWKPSLYWKSLPIE  222



>gb|EYU41888.1| hypothetical protein MIMGU_mgv1a011996mg [Erythranthe guttata]
Length=264

 Score =   265 bits (677),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/238 (59%), Positives = 176/238 (74%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LAD+Y R+AD+ LRGYSGWNSR ALQVL QVFP++A +QPSLVIVYFG
Sbjct  18   QQSFIDGGWGAILADLYDRKADIFLRGYSGWNSRRALQVLHQVFPRDADIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+M P PSGL AHVPL EY+ENM+KI +HLKSLS+ TRIIFL+ PP+N A   E FG 
Sbjct  78   GNDAMHPHPSGLGAHVPLREYIENMKKIYLHLKSLSENTRIIFLTSPPLNVAMIREHFGN  137

Query  407  LG----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE    Y++A ++ C+Q D+KVI+LW A+QQR+DW   C TDGIH + EGS+
Sbjct  138  AHDNQIRTNESCGVYADALVDFCRQSDIKVINLWKAIQQREDWATACLTDGIHFSREGSE  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            IVVKEILKV+KEA WEPSL+W ++ NE +E SP   +  + KT  N S     W+ +W
Sbjct  198  IVVKEILKVIKEAGWEPSLYWTTMPNEFAEDSPYYMVRSDGKTTFNVSNGISRWKIKW  255



>gb|AAL31218.1| At2g38180/F16M14.11 [Arabidopsis thaliana]
Length=312

 Score =   266 bits (679),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR AD++LRGY+GWNSR AL+VL QVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFTDRGWGATLADLYSRTADIILRGYAGWNSRFALKVLHQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P PSG   HVPL E++ENMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSTHPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLTPPPMNEKQIEIVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNEL R Y+E  + LC++++VK ID+WTA+QQ+DDWL +CFTDGIH T++ S+IV
Sbjct  138  AIKGRSNELCRPYAEELLNLCREINVKGIDIWTAIQQQDDWLNSCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLT  90
            VKEILKVL+ ADW+PSL+W+SL  E     P  F  PN   ++  +LT
Sbjct  198  VKEILKVLRGADWKPSLYWKSLPVE----FPFDFDAPNSISLHDLELT  241



>ref|XP_008442421.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Cucumis melo]
 ref|XP_008442423.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Cucumis melo]
 ref|XP_008442424.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Cucumis melo]
 gb|ADN33797.1| isoamyl acetate-hydrolyzing esterase [Cucumis melo subsp. melo]
Length=234

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 171/208 (82%), Gaps = 7/208 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSFG  GWG++LA++YSR+AD+++RGY+GWNSR ALQVL  +FPK++ +QPSLVIVYFG
Sbjct  18   QFSFGDGGWGSILANLYSRQADILVRGYAGWNSRQALQVLHHLFPKDSPIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPP-----INEARAL  423
            GNDS+LP PS     VPL EYVENM+KIAIHLKSLS+KTR+IFL+ PP     I E  +L
Sbjct  78   GNDSVLPFPSSKKPCVPLSEYVENMKKIAIHLKSLSEKTRVIFLTAPPVSYDLIKEKLSL  137

Query  422  EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
            E      R+ E  RKY+EAC ELCK++DVK ID+W+A+Q+RDDWL +CFTDG+HLT+EGS
Sbjct  138  E--QAECRTLESCRKYAEACKELCKKIDVKCIDVWSAIQKRDDWLTSCFTDGVHLTAEGS  195

Query  242  kivvkeilkvlkEADWEPSLHWQSLANE  159
            +IV +EILKVL+EADWEPSLHW++L  E
Sbjct  196  EIVAEEILKVLEEADWEPSLHWKTLPIE  223



>ref|NP_565883.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|O80443.1|GDL46_ARATH RecName: Full=GDSL esterase/lipase At2g38180; AltName: Full=Extracellular 
lipase At2g38180; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC27167.1| expressed protein [Arabidopsis thaliana]
 gb|AAX12857.1| At2g38180 [Arabidopsis thaliana]
 gb|AAX12886.1| At2g38180 [Arabidopsis thaliana]
 gb|AEC09502.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=312

 Score =   265 bits (678),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 175/228 (77%), Gaps = 6/228 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR AD++LRGY+GWNSR AL+VL QVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFTDRGWGATLADLYSRTADIILRGYAGWNSRFALKVLHQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P PSG   HVPL E++ENMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSTHPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLTPPPMNEKQIEIVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNEL R Y+E  + LC++++VK ID+WTA+QQ+DDWL +CFTDGIH T++ S+IV
Sbjct  138  AIKGRSNELCRPYAEELLNLCREINVKGIDIWTAIQQQDDWLNSCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLT  90
            VKEILKVL+ ADW+PSL+W+SL  E     P  F  PN   ++  +LT
Sbjct  198  VKEILKVLRGADWKPSLYWKSLPVE----FPFDFDAPNSISLHDLELT  241



>gb|KEH23161.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=281

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 179/231 (77%), Gaps = 5/231 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD+VLRGY+ WNSR ALQVLD++FPKNA  QP+LVIVYFG
Sbjct  45   QYSY-YEGWGATLSHLYARKADIVLRGYAAWNSRHALQVLDRIFPKNAAEQPALVIVYFG  103

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS  P PSGL  HVPL EY+ENMRKIAIH+ SLS KTRIIFLS PPINEA+    +  
Sbjct  104  GNDSFRPHPSGLGPHVPLEEYIENMRKIAIHIMSLSQKTRIIFLSNPPINEAQMKHHINE  163

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            FG   R+NE    YS+AC+++C+++++KVID+W+A+Q+RDDW   CF DG+HL++EGS+I
Sbjct  164  FGQPIRTNEDCGIYSDACLDMCREMNIKVIDMWSAIQKRDDWRDVCFIDGVHLSNEGSEI  223

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            V KEIL V+KEA+WEPSL+W+ +  E  E SP   +  + KT +N S + F
Sbjct  224  VTKEILNVIKEAEWEPSLYWKLMPTEFGEDSPYDIVSLDGKTTVNYSNVPF  274



>emb|CDY18401.1| BnaA04g21860D [Brassica napus]
Length=277

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 167/205 (81%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWG  LA+IYSR ADV+LRGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFSDGGWGTTLANIYSRTADVILRGYAGWNSRSALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSG   HVPL E+ +NMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSMPPHPSGQGPHVPLSEFTDNMRKIGEHLLSLSDKTRVIFLTPPPMNEGQIEVVFGD  137

Query  410  -TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNEL R Y+EA + LC++++VK IDLW+A+Q++DDWL TCFTDGIH T++ S+IV
Sbjct  138  AMRGRSNELCRPYAEALLSLCREINVKGIDLWSAIQKQDDWLNTCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKEIL+V++EADW+PSLH +SL  E
Sbjct  198  VKEILRVVREADWKPSLHRKSLPVE  222



>ref|NP_001242371.1| uncharacterized protein LOC100792188 [Glycine max]
 gb|ACU21119.1| unknown [Glycine max]
 gb|KHN48501.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=256

 Score =   262 bits (670),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 179/237 (76%), Gaps = 3/237 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD++LRGYSGWNSR AL+VLD++FPK+A VQPSLVIVYFG
Sbjct  19   QMSFDNGGWGAILANLYARKADIILRGYSGWNSRRALEVLDEIFPKDAYVQPSLVIVYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EYVENMRKIA HLKSLSD  RIIFL+ PPINE    +    
Sbjct  79   GNDSIDPHPSGLGPHVPLEEYVENMRKIANHLKSLSDHIRIIFLTSPPINEELIRKKLSA  138

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE   +Y++  +ELC+++++K I+LW+A+Q R+DWL   FTDG+HL++EGSK+V
Sbjct  139  TQSGRTNESCGEYADGLMELCEEMNIKAINLWSAIQTREDWLDVSFTDGVHLSAEGSKVV  198

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            VKEILKVL+E DW+PSLHW S+  E +E SP     P+  T IN S +      QW+
Sbjct  199  VKEILKVLREVDWKPSLHWMSMPTEYAEDSPYYPPSPDGTTTINVSHIISRRCLQWD  255



>ref|XP_010509212.1| PREDICTED: GDSL esterase/lipase At2g38180-like isoform X1 [Camelina 
sativa]
Length=273

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 168/205 (82%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIYSR AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFTDGGWGATLADIYSRTADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG   HVPL E+++NMR+I  HL  LSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSMDPHPSGFGPHVPLSEFIDNMRQIGEHLLGLSDKTRVIFLTPPPMNEKQIQIVFGG  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
            +  GRSNE  R Y+EA + LC++++VK +D+WTA+QQ+DDWL +CFTDGIH T++ S+IV
Sbjct  138  MVKGRSNERCRPYAEALLNLCREINVKGVDIWTAIQQQDDWLNSCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            +KEILK ++EADW+PSL+W+SL  E
Sbjct  198  LKEILKAVREADWKPSLYWKSLPVE  222



>ref|XP_011077558.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
 ref|XP_011077559.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
 ref|XP_011077560.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Sesamum indicum]
Length=258

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/231 (60%), Positives = 173/231 (75%), Gaps = 5/231 (2%)
 Frame = -3

Query  746  GWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLP  567
            GW A+LAD+Y+R+ADV+LRGYSGWNSR ALQ LD++FPK+A VQPSLV+V FGGND+  P
Sbjct  25   GWSAVLADLYARKADVLLRGYSGWNSRMALQALDRIFPKDAAVQPSLVVVCFGGNDATNP  84

Query  566  DPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT----LGR  399
             PSGL  HVPLPEYV+NM++I +HL +LS KTRII LS P +NEA+A E +G       R
Sbjct  85   HPSGLGGHVPLPEYVDNMKQIIVHLNNLSAKTRIICLSSPRVNEAKAREFYGKGLDDQAR  144

Query  398  SNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeil  219
            +N+  R YSEA +ELCK+LDV+ I+LW A QQRDDW   C  DGIHL++EGSK+VV EIL
Sbjct  145  TNDACRIYSEALVELCKELDVEAINLWAAFQQRDDWASACLIDGIHLSAEGSKVVVAEIL  204

Query  218  kvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            KVLK+ +WEPSL+W S+ +E  E SP   +GP+ KT  N +      Q QW
Sbjct  205  KVLKKVNWEPSLYWLSMPSEFPEDSPYYVVGPDGKTTQNVTDHISVRQLQW  255



>emb|CDY07748.1| BnaA03g17630D [Brassica napus]
Length=245

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR ADVVLRGY GWNSR AL+VLDQVFPK A VQPSLVIVYFG
Sbjct  18   QYSFSNGGWGASLADVYSRTADVVLRGYGGWNSRFALRVLDQVFPKEAVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG  AHVPL E+V+NMRKI  HL SLSDKTR+IFLS PP+NE +   VFG 
Sbjct  78   GNDSMPPHPSGKGAHVPLSEFVDNMRKIGEHLLSLSDKTRVIFLSPPPMNERQIELVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR NE+ R Y+EA + LC +++VK +DLW  ++Q+DDWL TCFTDGIH T++ S++V
Sbjct  138  AIKGRRNEVCRPYAEALLNLCNEINVKCVDLWNVIRQQDDWLNTCFTDGIHFTAKASEVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKE+LKV++EA+W+PSL+W+SL  E
Sbjct  198  VKEVLKVVREAEWKPSLYWKSLPIE  222



>ref|XP_011035964.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Populus 
euphratica]
Length=233

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 172/221 (78%), Gaps = 5/221 (2%)
 Frame = -3

Query  713  READVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPL  534
            + AD++LRGY GWNSR A+QVLDQVFPK A VQPSLVIVYFGGNDSM P  SGL  HVPL
Sbjct  13   KAADILLRGYYGWNSRRAIQVLDQVFPKEAPVQPSLVIVYFGGNDSMGPHSSGLGPHVPL  72

Query  533  PEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE----VFGTLGRSNELGRKYSEA  366
             EY+ENMRKIAIHLKSLSD TRIIFLSCPP++E R       VF  L R+NEL + YS A
Sbjct  73   NEYIENMRKIAIHLKSLSDTTRIIFLSCPPVDETRVGSGLSGVFSELIRTNELCQNYSNA  132

Query  365  CIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPS  186
            CI+LC+++ V+V+DL++A Q+RDDW   CFTDG+HL++EGSKIVV+EILKVL+EA+W PS
Sbjct  133  CIKLCQEMGVEVVDLFSAFQKRDDWTKACFTDGVHLSAEGSKIVVEEILKVLREAEWVPS  192

Query  185  LHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            LHW+S+  E SE SP   +  + K  +N S+ TF+ +  W+
Sbjct  193  LHWKSMPTEFSEDSPYYLVTADGKRTLNPSEWTFHREVHWD  233



>dbj|BAB33036.1| CPRD49 [Vigna unguiculata]
Length=255

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 178/237 (75%), Gaps = 3/237 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD+VLRGYSGWNSR AL+VLD++FPK+A VQPSLVIVYFG
Sbjct  18   QMSFDNGGWGAILANLYARKADIVLRGYSGWNSRRALEVLDEIFPKDASVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EY+ENMRKIA HLKSLSD  R+IFL+ PPINE +       
Sbjct  78   GNDSIDPHPSGLGPHVPLQEYLENMRKIANHLKSLSDHIRVIFLTSPPINEEQLRRKLSA  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNE    Y+ A +ELC+++++K I+LW+A+Q R+DWL   FTDG+HL++EGSK+V
Sbjct  138  TQSGRSNESCGVYANALMELCEEMNLKAINLWSAIQAREDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-INTSQLTFYWQPQWN  66
            VKEIL+VL+EADW+ SLHW S+  E +E SP     P+ T  IN S +      QW+
Sbjct  198  VKEILRVLREADWKTSLHWMSMPTEYAEDSPYYPPTPDGTKTINVSHIVSRRCLQWD  254



>dbj|BAI63594.1| GDSL-motif lipase/hydrolase family protein [Lotus japonicus]
 gb|AFK34986.1| unknown [Lotus japonicus]
Length=255

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 171/212 (81%), Gaps = 4/212 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD+VLRGYSGWN+R AL+VLD +FPK+A  QP+LV+VYFG
Sbjct  18   QMSFDNGGWGAILANLYARKADIVLRGYSGWNTRHALEVLDDIFPKDAPEQPALVVVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA---RALEV  417
            GNDS+ P PSGL  HVPL EY+ENMRKIA HLKSLSD  R+IFL+ PPINE    R L  
Sbjct  78   GNDSIRPHPSGLGPHVPLEEYIENMRKIANHLKSLSDHIRLIFLTSPPINEEQVRRRLSA  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
              T GR+NE    Y++A +ELC++L++KVI+LW+A+QQRD WL   FTDG+HL++EGSK+
Sbjct  138  TQT-GRTNESCGTYAKALVELCEELNLKVINLWSAIQQRDGWLDVSFTDGVHLSAEGSKV  196

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            VVKEILKVL+EADW+PSLHW SL  E +E SP
Sbjct  197  VVKEILKVLREADWKPSLHWMSLPTEFAEDSP  228



>ref|XP_003552247.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Glycine max]
Length=256

 Score =   261 bits (666),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/235 (59%), Positives = 176/235 (75%), Gaps = 4/235 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++YSR+AD++LRGYSGWNSR AL VLD+VF K+A VQPSLVIVYFG
Sbjct  18   QMSFDNGGWGAILANLYSRKADIILRGYSGWNSRQALDVLDEVFSKDAHVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EYV NMRKIA HLKSLSD  RIIFL+ PPINE +  +    
Sbjct  78   GNDSVHPHPSGLGPHVPLQEYVANMRKIANHLKSLSDHIRIIFLTSPPINEEQIRKKLSA  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE   +Y++A +ELC ++++K I+LW+A+Q RDDWL   FTDG+HL++EGSK+V
Sbjct  138  TQSGRTNESCGEYADALMELCDEMNIKAINLWSAIQTRDDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            VKEILKVL+E DW+PSLHW S+  E +E SP  +  PN     T  +++    +W
Sbjct  198  VKEILKVLREVDWKPSLHWMSMPTEYAEDSP--YYPPNPDGTTTINVSYCISRKW  250



>emb|CDX93323.1| BnaC04g45730D [Brassica napus]
Length=275

 Score =   261 bits (668),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 166/205 (81%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LA+IYSR ADV+LRGY+GWNSR AL+VL+QVFPK+A +QPSLVIVYFG
Sbjct  40   QYSFSDGGWGATLANIYSRTADVILRGYAGWNSRSALKVLNQVFPKDAVIQPSLVIVYFG  99

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSG   HVPL E+ ENMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  100  GNDSMPPHPSGQGPHVPLSEFTENMRKIGEHLLSLSDKTRVIFLTPPPMNERQIQLVFGD  159

Query  410  -TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNEL R Y+EA + LC++++VK IDLW A+QQ+DDWL TCFTDGIH T++ S+IV
Sbjct  160  AMRGRSNELCRPYAEALLNLCREINVKGIDLWNAIQQQDDWLHTCFTDGIHFTAKASEIV  219

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKEILKV++EADW+PSL  +SL  E
Sbjct  220  VKEILKVVREADWKPSLDRKSLPVE  244



>ref|XP_009141726.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Brassica rapa]
Length=257

 Score =   261 bits (666),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWG  LA+IYSR ADV+LRGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFSDGGWGTTLANIYSRTADVILRGYAGWNSRSALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P PSG   HVPL E+ +NMRKI  HL SLSDKTR+IFL+ PP+NE +   VFG 
Sbjct  78   GNDSMPPHPSGQGPHVPLSEFTDNMRKIGEHLLSLSDKTRVIFLTPPPMNERQIQLVFGD  137

Query  410  -TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GRSNEL R Y+ A + LC++++VK IDLW A+QQ+DDWL TCFTDGIH T++ S+IV
Sbjct  138  AMRGRSNELCRPYAVALLNLCREINVKGIDLWNAIQQQDDWLNTCFTDGIHFTAKASEIV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKEIL+V++EADW+PSLH +SL  E
Sbjct  198  VKEILRVVREADWKPSLHRKSLPVE  222



>emb|CDY14483.1| BnaC03g21120D [Brassica napus]
Length=255

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR ADV+LRGY GWNSR AL+VLDQVFPK+A VQPSLVIVYFG
Sbjct  18   QYSFSNGGWGATLADVYSRTADVILRGYGGWNSRFALKVLDQVFPKDAVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG  AHV L E+++NMRKI  HL SLSDKTR+IFLS PP+NE +   VFG 
Sbjct  78   GNDSMPPHPSGKGAHVSLSEFIDNMRKIGEHLLSLSDKTRVIFLSPPPMNERQIQLVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR NE+ R Y+EA + LC +++VK +DLW  +QQ+DDWL TCFTDGIH T++ S++V
Sbjct  138  AIKGRRNEVCRPYAEALLTLCNEINVKCVDLWNVIQQQDDWLNTCFTDGIHFTAKASEVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKE+LKV++EA+W+PSL+W+SL  E
Sbjct  198  VKEVLKVVREAEWKPSLYWKSLPIE  222



>ref|XP_009133233.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Brassica rapa]
Length=255

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 165/205 (80%), Gaps = 2/205 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LAD+YSR ADVVLRGY GWNSR AL+VLDQVFPK A VQPSLVIVYFG
Sbjct  18   QYSFSNGGWGASLADVYSRTADVVLRGYGGWNSRFALRVLDQVFPKEAVVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG  AHVPL E+V+NMRKI  HL SLSDKTR+IF+S PP+NE +   VFG 
Sbjct  78   GNDSMPPHPSGKGAHVPLSEFVDNMRKIGEHLLSLSDKTRVIFVSPPPMNERQIELVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR NE+ R Y+EA + LC +++VK +DLW  ++Q+DDWL TCFTDGIH T++ S++V
Sbjct  138  AIKGRRNEVCRPYAEALLNLCNEINVKCVDLWNVIRQQDDWLNTCFTDGIHFTAKASEVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANE  159
            VKE+LKV++EA+W+PSL+W+SL  E
Sbjct  198  VKEVLKVVREAEWKPSLYWKSLPIE  222



>ref|XP_004492445.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=244

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/225 (59%), Positives = 171/225 (76%), Gaps = 4/225 (2%)
 Frame = -3

Query  749  EGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSML  570
            EGWGA ++ +Y+R+ DV+LRGY+ WNSR ALQ++D++FPKNA  QP+LVIVYFGGNDS  
Sbjct  19   EGWGATISHLYARKVDVILRGYAAWNSRRALQIVDKIFPKNATEQPALVIVYFGGNDSYR  78

Query  569  PDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEVFGTLGR  399
            P PSG+  HVPL EY+ENMRKIAIH+KSLS+ TRIIFLS PPINEA+    +  FG L R
Sbjct  79   PYPSGVGPHVPLEEYIENMRKIAIHIKSLSETTRIIFLSPPPINEAQISNNINEFGQLIR  138

Query  398  SNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeil  219
            +NE  R YSEAC+E+C++ ++K ID+W+ +Q RDDW   CF DG+HL+ EGSKIV  EIL
Sbjct  139  TNEACRIYSEACLEMCREENIKAIDMWSLIQTRDDWRDVCFIDGVHLSIEGSKIVSDEIL  198

Query  218  kvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTF  87
            KV+ EA+W+PSL+W  ++ E  E SP   + P+  T IN S + F
Sbjct  199  KVINEAEWKPSLYWHDMSVEFGEDSPYDPVLPDGVTTINVSNMPF  243



>gb|KDP24452.1| hypothetical protein JCGZ_25016 [Jatropha curcas]
Length=242

 Score =   257 bits (657),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 165/211 (78%), Gaps = 2/211 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG EGWGA L++ Y+R+ADVVLRGY GW SR AL+VLDQVFP++  VQPSLVIVYFG
Sbjct  18   QLSFGDEGWGAALSEKYARKADVVLRGYGGWTSRNALKVLDQVFPEHDSVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P P+ +   VPLPEY EN+R+IA+HLK LS+ TRIIFL  PP+NE    E+ G 
Sbjct  78   GNDSMEP-PTSVGPLVPLPEYKENIRRIALHLKGLSETTRIIFLGVPPVNEKMLQEIHGD  136

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
              GR+NE  R YSEAC E+ K++ +  IDLWTA+Q+R+DWL  CFTDG+HL+ EGS+ VV
Sbjct  137  KTGRTNEGCRIYSEACSEVSKEMGIATIDLWTAMQEREDWLTACFTDGVHLSGEGSETVV  196

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPI  138
            KEI++VLKEADW+PSL+W S+  E +  SP+
Sbjct  197  KEIMRVLKEADWKPSLYWASMPTEFAGISPL  227



>gb|EPS60568.1| hypothetical protein M569_14235, partial [Genlisea aurea]
Length=260

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 178/239 (74%), Gaps = 6/239 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+D+Y+R+AD  LRGYSGWNSR AL++L ++FPK+A V+PSLVIVYFG
Sbjct  19   QMSFNVGGWGAILSDLYARKADFKLRGYSGWNSRMALEILHKLFPKDAVVKPSLVIVYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+  P PSGL +HVPL EYVENMRKI +HLKSLSD T +I +S PP+NEA+ L+VFG+
Sbjct  79   GNDATNPHPSGLGSHVPLHEYVENMRKIILHLKSLSDSTHVICMSTPPVNEAQILKVFGS  138

Query  407  ----LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQ-RDDWLITCFTDGIHLTSEGS  243
                  R NE  R Y+EA ++LCK+L V+ I+L+TALQQ R+DW    F DG+HL++EGS
Sbjct  139  GFEDQARKNENCRVYAEALVDLCKELGVEGINLYTALQQRREDWAEVSFIDGMHLSAEGS  198

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            K VV+EILKV+K ADW+PSL+W  +  E  E SP   + P+ K+ +N S     WQ +W
Sbjct  199  KAVVREILKVIKGADWKPSLYWLEMEPEFPEGSPYYVVAPDGKSTVNVSPHVCSWQKEW  257



>gb|KDP24454.1| hypothetical protein JCGZ_25018 [Jatropha curcas]
Length=250

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 166/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG +GWGA L+ +Y+R+ADVVLRGYSGW SR AL++LDQVFP+N  VQPSL IVYFG
Sbjct  18   QLSFGFDGWGAALSHLYARKADVVLRGYSGWTSRDALKILDQVFPQNDRVQPSLAIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF-G  411
            GNDSM P P+     VPL EY ENMR+IA+HLKSLS+  RIIFLS PPINE    E F G
Sbjct  78   GNDSMEP-PTSDGPLVPLSEYKENMRRIALHLKSLSETIRIIFLSVPPINEEMIKEYFGG  136

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             +GR+NE  R YSEAC+E+ K++++  IDLWTA+QQR++WL TCF DGIHL+ EGSKIVV
Sbjct  137  EMGRTNEGCRIYSEACLEVSKEMEITAIDLWTAIQQRENWLTTCFLDGIHLSGEGSKIVV  196

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPI  138
            KEIL+V++ ADW+PSL+WQ + +E    S I
Sbjct  197  KEILRVVRNADWKPSLYWQYMPSEFQGISAI  227



>gb|ACJ85300.1| unknown [Medicago truncatula]
Length=255

 Score =   256 bits (653),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 170/211 (81%), Gaps = 2/211 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD+VLRGYSGWNSR AL+VLD+VFPK+A VQPSLVI+YFG
Sbjct  18   QMSFDNGGWGAILANLYTRKADIVLRGYSGWNSRRALEVLDEVFPKDAYVQPSLVIIYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVP+ EY ENMRKIA +LKSLSD  R+IFL+ PPI+E +  +    
Sbjct  78   GNDSIHPHPSGLGPHVPIEEYKENMRKIANYLKSLSDHIRLIFLTSPPISEVQIKKKLSA  137

Query  407  --LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE    Y+ A +ELC ++++KV++LW+A+Q+R+DWL   FTDG+HL++EGSK+V
Sbjct  138  TQTGRTNEHCGIYARALLELCDEMNLKVVNLWSAIQEREDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSP  141
            +KEIL+VL+EADW+PSLHW SL  E +E SP
Sbjct  198  LKEILRVLREADWKPSLHWMSLPTEYAEDSP  228



>gb|KEH23169.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=255

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 170/211 (81%), Gaps = 2/211 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD+VLRGYSGWNSR AL+VLD+VFPK+A VQPSLVI+YFG
Sbjct  18   QMSFDNGGWGAILANLYARKADIVLRGYSGWNSRRALEVLDEVFPKDAYVQPSLVIIYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVP+ EY ENMRKIA +LKSLSD  R+IFL+ PPI+E +  +    
Sbjct  78   GNDSIHPHPSGLGPHVPIEEYKENMRKIANYLKSLSDHIRLIFLTSPPISEVQIKKKLSA  137

Query  407  --LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE    Y+ A +ELC ++++KV++LW+A+Q+R+DWL   FTDG+HL++EGSK+V
Sbjct  138  TQTGRTNEHCGIYARALLELCDEMNLKVVNLWSAIQEREDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSP  141
            +KEIL+VL+EADW+PSLHW SL  E +E SP
Sbjct  198  LKEILRVLREADWKPSLHWMSLPTEYAEDSP  228



>gb|KEH23165.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=280

 Score =   256 bits (654),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 175/231 (76%), Gaps = 5/231 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD+VLRGY+ WNSR ALQVLD++FPKNA  QPSLVIVYFG
Sbjct  44   QYSY-YEGWGATLSHLYARKADIVLRGYAAWNSRRALQVLDKIFPKNAIEQPSLVIVYFG  102

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GND   P PSGL  HVPL EYVENMRKIAIH+ SLSDKTRII LS PPINEA+    ++ 
Sbjct  103  GNDCTHPFPSGLGPHVPLEEYVENMRKIAIHIMSLSDKTRIILLSNPPINEAQIKINIDD  162

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            FG   R+NE  R YSEAC+ +C+++ +K IDLW+A+Q+ DDW   CF DG+HL+++GS+I
Sbjct  163  FGNPMRTNETSRIYSEACLNMCREMKIKAIDLWSAIQKIDDWRDVCFVDGVHLSNKGSEI  222

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTF  87
            V KEIL V++EA+W+PSL+W+ +  E  E SP   +  + K  IN S + F
Sbjct  223  VTKEILNVIEEAEWKPSLYWKLMPAEFGEDSPYDMVSLDGKININFSDVPF  273



>gb|KHN05547.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=254

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 176/235 (75%), Gaps = 2/235 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+    EGW A L+ +Y+R+ D+VLRGY+GWNSR ALQVLD++FPK+A VQPSLVI YFG
Sbjct  19   QYGLYDEGWMADLSHLYARKVDIVLRGYAGWNSRRALQVLDKIFPKDAPVQPSLVIAYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL-EVFG  411
            GNDS  P  SGL  HVPL EY+EN+RKI  HLKSLS+ TRI+ LS PPIN+A       G
Sbjct  79   GNDSSTPHSSGLGPHVPLQEYIENLRKIVNHLKSLSENTRILLLSAPPINDATITPNSDG  138

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               R+NE  R YSEAC+++C++++VK IDLW+A+++RD+W   CF DGIHL+SEGSKIV+
Sbjct  139  KPSRTNEACRIYSEACLDVCREMNVKAIDLWSAIKKRDNWQDVCFIDGIHLSSEGSKIVL  198

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            KEILKVLK+A+WEPSL+W+S+ +E  E SP   I P+ K+ IN S   F    +W
Sbjct  199  KEILKVLKDAEWEPSLYWKSMPSEFDEDSPYDPIAPDGKSTINISNWAFPGNDKW  253



>ref|XP_007140333.1| hypothetical protein PHAVU_008G103600g [Phaseolus vulgaris]
 gb|ESW12327.1| hypothetical protein PHAVU_008G103600g [Phaseolus vulgaris]
Length=255

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 176/239 (74%), Gaps = 7/239 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFSF   GWG +LA +Y+R+AD++LRGYSGWNSR AL VLD+VFPK+A VQPSLVIVYFG
Sbjct  18   QFSFDNGGWGGILASLYARKADIILRGYSGWNSRQALDVLDEVFPKDAPVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P  SGL  HVPL EY+ENMRKIA HLKSLSD  RIIFL+ PPINE    +    
Sbjct  78   GNDSVHPHSSGLGPHVPLEEYLENMRKIANHLKSLSDHIRIIFLTSPPINEELLRKKLSA  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
               GR+NE   +Y++A +EL ++L++K I+LW+A+Q RDDWL   FTDG+HL++EGSK+V
Sbjct  138  TQSGRTNESCGEYADALMELSEELNIKAINLWSAIQTRDDWLDVSFTDGVHLSAEGSKVV  197

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN---KTPINTSQLTFYWQPQWN  66
            VKEIL++L+EADW+ SLHW S+  E +E SP  +  P+    T IN S        QW+
Sbjct  198  VKEILRILREADWKTSLHWMSMPTEYAEDSP--YYPPSADGTTTINVSYCISRRSLQWD  254



>ref|NP_001237711.1| uncharacterized protein LOC100527807 [Glycine max]
 gb|ACU16983.1| unknown [Glycine max]
Length=254

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 176/235 (75%), Gaps = 2/235 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+    EGW A L+ +Y+R+ D+VLRGY+GWNSR ALQVLD++FPK+A VQPSLVI YFG
Sbjct  19   QYGLYDEGWMADLSHLYARKIDIVLRGYAGWNSRRALQVLDKIFPKDAPVQPSLVIAYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL-EVFG  411
            GNDS  P  SGL  HVPL EY+EN+RKI  HLKSLS+ TRI+ LS PPIN+A       G
Sbjct  79   GNDSSTPHSSGLGPHVPLQEYIENLRKIVNHLKSLSENTRILLLSAPPINDATITPNSDG  138

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               R+NE  R YSEAC+++C+++++K IDLW+A+++RD+W   CF DGIHL+SEGSKIV+
Sbjct  139  KPSRTNEACRIYSEACLDVCREMNIKAIDLWSAIKKRDNWQDVCFIDGIHLSSEGSKIVL  198

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            KEILKVLK+A+WEPSL+W+S+ +E  E SP   I P+ K+ IN S   F    +W
Sbjct  199  KEILKVLKDAEWEPSLYWKSMPSEFDEDSPYDPIAPDGKSTINISNWAFPGNDKW  253



>gb|KEH23162.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=249

 Score =   252 bits (644),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 173/230 (75%), Gaps = 4/230 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD++LRGY+GWNSR ALQVLD++F KNA  QPSLVI YFG
Sbjct  14   QYSY-YEGWGATLSHLYARKADILLRGYAGWNSRHALQVLDKIFSKNAIEQPSLVIAYFG  72

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GND + P PSGL  HVPL EY+ENM+KIA H+ SLS KTRII LS PPINEA+    ++ 
Sbjct  73   GNDCIPPHPSGLGPHVPLGEYIENMKKIATHIMSLSQKTRIILLSNPPINEAQMKHNIDD  132

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            FG   R+NE+ R YSEAC+++C ++ +K ID W+A+Q+RDDW   CF DG+HL++EGS+I
Sbjct  133  FGQPIRTNEVSRIYSEACLDMCCEMKIKAIDTWSAIQKRDDWRDFCFIDGVHLSNEGSEI  192

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTF  87
            V KEIL V+KEA+WEPSL+W+ +  E  E SP   +  +   IN S + F
Sbjct  193  VTKEILNVIKEAEWEPSLYWKLMPAEFGEDSPYDMVTLDGKTINFSNVPF  242



>ref|XP_008355726.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Malus domestica]
Length=231

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  EADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLP  531
            +ADV+LRGY+GWNSR ALQVL QVFPK+A  QPSLVIVYFGGNDSM P PSGL AHVPL 
Sbjct  6    QADVLLRGYAGWNSRRALQVLXQVFPKDATTQPSLVIVYFGGNDSMHPHPSGLGAHVPLK  65

Query  530  EYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF----GTLGRSNELGRKYSEAC  363
            EYVENMRKIA HLKSLS+KTR+IFL+ PP+NE +  E          R+NE  + YS+AC
Sbjct  66   EYVENMRKIAKHLKSLSEKTRVIFLTAPPVNEEQIRENLSDQTSPQKRTNESCKIYSDAC  125

Query  362  IELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSL  183
            +E+C++ DVK +DLWT++Q+  DW  TCF DGIH +SEGSKIV +EILKVL+EADWEP L
Sbjct  126  LEVCREFDVKGVDLWTSIQKTKDWSTTCFRDGIHFSSEGSKIVAEEILKVLREADWEPCL  185

Query  182  HWQSLANESSETSP  141
            HW+SL  E SE SP
Sbjct  186  HWKSLPTEFSEDSP  199



>ref|XP_010236200.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Brachypodium 
distachyon]
Length=237

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 167/223 (75%), Gaps = 6/223 (3%)
 Frame = -3

Query  719  YSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHV  540
            ++  AD++LRGY GWNSR ALQV+++VFPK++ VQPSLVIVYFGGNDS+    SGL  HV
Sbjct  14   FTTMADIILRGYIGWNSRRALQVIEKVFPKDSEVQPSLVIVYFGGNDSIAEHSSGLGPHV  73

Query  539  PLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT----LGRSNELGRKYS  372
            PL EY ENMRKIA HLKSLSDKTR+IFLSC PINE    +   T    + R+NE  R YS
Sbjct  74   PLEEYTENMRKIAKHLKSLSDKTRVIFLSCAPINEETLRKTMSTELSEVIRTNEACRLYS  133

Query  371  EACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlk-EADW  195
            EACI +CK++D+K++DLW A+Q+RDDW  TCFTDG+H + EGS IVV++IL+VLK  A+W
Sbjct  134  EACISVCKEMDIKMVDLWNAIQKRDDWATTCFTDGVHFSEEGSNIVVEQILRVLKDAAEW  193

Query  194  EPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            EPSLHW+++  E  E SP   +  + ++ IN ++LTF  +  W
Sbjct  194  EPSLHWKAMPTEFDEDSPYDPVASSGQSTINPTKLTFLTKIPW  236



>ref|XP_009377763.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Pyrus 
x bretschneideri]
Length=257

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = -3

Query  710  EADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLP  531
            EADV+LRGY+GWNSR ALQVL+QVFPK+A  QPSLVIVYFGGNDSM P PSGL AHVPL 
Sbjct  32   EADVLLRGYAGWNSRRALQVLEQVFPKDATTQPSLVIVYFGGNDSMHPHPSGLGAHVPLN  91

Query  530  EYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT----LGRSNELGRKYSEAC  363
            EYVENMRKIA HLKSLS+KTR+IFL+ PP+NE +  E          R+NE  + YS+AC
Sbjct  92   EYVENMRKIAKHLKSLSEKTRVIFLTAPPVNEEQIRENLSVQTSPQKRTNESCKIYSDAC  151

Query  362  IELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSL  183
            +E+C++ DVK +DLWT++Q+  DW  TCF DGIH +SEGSKIV +EILKVL+EADWEP L
Sbjct  152  LEVCQEFDVKGVDLWTSIQKIKDWSTTCFRDGIHFSSEGSKIVAEEILKVLREADWEPCL  211

Query  182  HWQSLANESSETSP  141
            HW+SL  E  E SP
Sbjct  212  HWKSLPTEFLEDSP  225



>gb|KDP24453.1| hypothetical protein JCGZ_25017 [Jatropha curcas]
Length=246

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 161/210 (77%), Gaps = 2/210 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG +GWGA LA +Y+R+AD+VLRGY+GW SR AL+VL+QVFP+N  VQPSL IVYFG
Sbjct  18   QLSFGFDGWGATLAHLYARKADIVLRGYAGWTSRDALKVLEQVFPQNDSVQPSLAIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDSM P P+     VPL EY ENM KIA+HLKSLS+  RIIFL  PP+NE    E +G 
Sbjct  78   GNDSMEP-PTSDGPLVPLCEYKENMEKIALHLKSLSETIRIIFLGVPPVNEEMIKEFYGD  136

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
             +GR+NE  R YSEAC+E+ K++ +  IDLWTA+QQR+DWL TCF DGIHLT  GS+IVV
Sbjct  137  EMGRTNEGCRIYSEACLEVSKKMGITAIDLWTAMQQREDWLTTCFLDGIHLTGTGSEIVV  196

Query  230  keilkvlkEADWEPSLHWQSLANESSETSP  141
            +EIL+VL++ DW P LHW+S+ +E    SP
Sbjct  197  EEILRVLEKPDWIPRLHWKSIPSEFVGISP  226



>ref|XP_003529152.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Glycine max]
 gb|KHN07714.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=253

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 176/236 (75%), Gaps = 2/236 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QF F  EGW A+L+ +Y+R+ D+ LRGY+GWNSR A+QVLD+VFPK+A +QPSLVIVYFG
Sbjct  18   QFGFYDEGWVAILSHLYARKVDIDLRGYAGWNSRRAVQVLDKVFPKDAPIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL-EVFG  411
            GNDS  P  SGL  HVPL EY+EN+RKI  HLKSLS+ TRI+ LS PP+N+A       G
Sbjct  78   GNDSSAPLSSGLGPHVPLQEYIENLRKIVDHLKSLSENTRILLLSTPPLNDAAITPNSDG  137

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               ++NE  + YSEAC+++C+++++K IDLW+A+Q+RD+W   CF DGIHL+SEGSKIV+
Sbjct  138  KPTKTNEACQIYSEACLDVCRKMNIKAIDLWSAIQKRDNWQDVCFIDGIHLSSEGSKIVL  197

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            KEIL VLK A+WEPSL+W+S+ +E  E SP   +  + K+ IN S   F    +W+
Sbjct  198  KEILNVLKGAEWEPSLYWKSMPSEFDEDSPYDPVTTDGKSTINLSSWVFPDNDKWD  253



>gb|KDO68983.1| hypothetical protein CISIN_1g0251811mg, partial [Citrus sinensis]
Length=186

 Score =   243 bits (619),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+L+DIY+R+AD++LRGY GWNSR ALQVLDQVFPK+A +QPSLVIVY G
Sbjct  18   QLSFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDAPIQPSLVIVYVG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P PSGL  HVPLPEYVENMR+IA HLKSLS  TRIIFLS PP++EAR      E
Sbjct  78   GNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPPVDEARINQGTSE  137

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
            +F  L R+NEL +KYS+ACI LC +L VKV+DL+TA+Q+RDDW   CFT
Sbjct  138  IFSELVRTNELCQKYSDACINLCHELGVKVVDLFTAIQKRDDWKNACFT  186



>gb|EMT30262.1| GDSL esterase/lipase CPRD49 [Aegilops tauschii]
Length=290

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 165/218 (76%), Gaps = 5/218 (2%)
 Frame = -3

Query  707  ADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPE  528
            AD+VLRGY  WNSR ALQV+ ++FPK++ VQPSLV+VYFGGNDS+ P PSGL  HVPL E
Sbjct  72   ADIVLRGYIAWNSRRALQVITKIFPKDSAVQPSLVVVYFGGNDSIAPHPSGLGPHVPLEE  131

Query  527  YVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT----LGRSNELGRKYSEACI  360
            Y++NMRKI  HLKSLS+KTR+IFLSCPP+NE    +   T    + R+NE  R YSEACI
Sbjct  132  YMDNMRKIGEHLKSLSNKTRVIFLSCPPLNEELLKKSTSTALSEIVRTNETCRLYSEACI  191

Query  359  ELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLH  180
             + K++D+KV+DLW A+Q+R+DW   CFTDG+HL+ EGS IVV+EIL++LKEA+W+P LH
Sbjct  192  SVSKEMDIKVVDLWNAMQKREDWATACFTDGLHLSEEGSNIVVEEILRILKEAEWDPCLH  251

Query  179  WQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            W+++  E  E SP   +  + K+ IN S+ TF+ +  W
Sbjct  252  WKAMPTEFGEDSPYDLVASSGKSTINPSEWTFHRKRSW  289



>ref|XP_007163539.1| hypothetical protein PHAVU_001G242700g [Phaseolus vulgaris]
 gb|ESW35533.1| hypothetical protein PHAVU_001G242700g [Phaseolus vulgaris]
Length=200

 Score =   243 bits (619),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 156/200 (78%), Gaps = 5/200 (3%)
 Frame = -3

Query  650  LDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKT  471
            +DQVFPK+A  QPSLVIVYFGGNDSM P  SGL  HVPLPEY+ENMRKI IH++ LS++T
Sbjct  1    MDQVFPKDAATQPSLVIVYFGGNDSMGPHSSGLGPHVPLPEYIENMRKILIHIQGLSERT  60

Query  470  RIIFLSCPPINEARAL----EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQ  303
            RII LSCPP+NE +       V   L R+NEL + YSEACI+LCK+LDVKV+DL+TALQ+
Sbjct  61   RIIVLSCPPVNEEKVRGNTSGVLSELVRTNELCQSYSEACIKLCKELDVKVVDLFTALQK  120

Query  302  RDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGP  123
            RDDW   CFTDGIHL +EGSKIVVKEIL VLKEADWEP LHW+SL+ E SE SP   +  
Sbjct  121  RDDWRNACFTDGIHLAAEGSKIVVKEILSVLKEADWEPCLHWKSLSTEFSENSPYDLVAA  180

Query  122  N-KTPINTSQLTFYWQPQWN  66
            + KT +N S+ TFY + QW+
Sbjct  181  DGKTTLNPSEWTFYREIQWD  200



>gb|EMS49022.1| GDSL esterase/lipase CPRD49 [Triticum urartu]
Length=260

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 164/218 (75%), Gaps = 5/218 (2%)
 Frame = -3

Query  707  ADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPE  528
            AD+VLRGY  WNSR ALQV+ ++FPK++ VQPSLV+VYFGGNDS+ P PSGL  HVPL E
Sbjct  42   ADIVLRGYIAWNSRRALQVITKIFPKDSAVQPSLVVVYFGGNDSIAPHPSGLGPHVPLEE  101

Query  527  YVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT----LGRSNELGRKYSEACI  360
            Y++NMRKI  HLKSLSDKTR+IFLSCPP+NE    +   T    + R+NE  R YSEACI
Sbjct  102  YMDNMRKIGEHLKSLSDKTRVIFLSCPPLNEELLKKSTSTALSEIVRTNETCRLYSEACI  161

Query  359  ELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLH  180
             + K++ +KV+DLW A+Q+R+DW   CFTDG+HL+ EGS IVV+EIL++LKEA+W+P LH
Sbjct  162  SVSKEMGIKVVDLWNAMQKREDWATACFTDGLHLSEEGSNIVVEEILRILKEAEWDPCLH  221

Query  179  WQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            W+++  E  E SP   +  + K+ IN S+ TF+ +  W
Sbjct  222  WKAMPTEFGEDSPYDLVASSGKSTINPSEWTFHRKRSW  259



>ref|XP_006435729.1| hypothetical protein CICLE_v10032177mg [Citrus clementina]
 gb|ESR48969.1| hypothetical protein CICLE_v10032177mg [Citrus clementina]
Length=245

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q  F   GWGA+L+DIY+R+AD++LRGY GWNSR ALQVLDQVFPK+A +QPSLVIVYFG
Sbjct  73   QLGFSNGGWGAILSDIYARKADILLRGYYGWNSRRALQVLDQVFPKDAPIQPSLVIVYFG  132

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR----ALE  420
            GNDSM P PSGL  HVPLPEYVENMR+IA HLKSLS  TRIIFLS PP++EAR      E
Sbjct  133  GNDSMGPHPSGLGPHVPLPEYVENMRRIATHLKSLSCATRIIFLSTPPVDEARINQGTSE  192

Query  419  VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
            +F  L R+NEL +KYS+ACI LC  L VK +DL+TA+Q+RDDW   CFT
Sbjct  193  IFSELVRTNELCQKYSDACINLCHDLGVKAVDLFTAIQKRDDWKNACFT  241



>gb|KEH23163.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=245

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 170/230 (74%), Gaps = 8/230 (3%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD++LRGY+GWNSR ALQVLD++F KNA  QPSLVI YFG
Sbjct  14   QYSY-YEGWGATLSHLYARKADILLRGYAGWNSRHALQVLDKIFSKNAIEQPSLVIAYFG  72

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GND + P PSGL  HVPL EY+ENM+KIA H+     KTRII LS PPINEA+    ++ 
Sbjct  73   GNDCIPPHPSGLGPHVPLGEYIENMKKIATHIM----KTRIILLSNPPINEAQMKHNIDD  128

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            FG   R+NE+ R YSEAC+++C ++ +K ID W+A+Q+RDDW   CF DG+HL++EGS+I
Sbjct  129  FGQPIRTNEVSRIYSEACLDMCCEMKIKAIDTWSAIQKRDDWRDFCFIDGVHLSNEGSEI  188

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTF  87
            V KEIL V+KEA+WEPSL+W+ +  E  E SP   +  +   IN S + F
Sbjct  189  VTKEILNVIKEAEWEPSLYWKLMPAEFGEDSPYDMVTLDGKTINFSNVPF  238



>ref|XP_011006554.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Populus 
euphratica]
Length=246

 Score =   242 bits (618),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 170/236 (72%), Gaps = 11/236 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+LA IY+R+AD+VLRGYSGWNSR A+Q        +A +QPSLVIVYFG
Sbjct  18   QLSYINEGWGAILAHIYARKADIVLRGYSGWNSRRAVQ--------DAAIQPSLVIVYFG  69

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS+ P  +GL  HVPLPEY+EN RKIA+HLKS+SDKTR+IFLS PP +E +    L  
Sbjct  70   GNDSVHPHATGLGPHVPLPEYIENTRKIAMHLKSISDKTRVIFLSAPPASEEQIGIHLSD  129

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
               + R+NE  R YSEAC+E+C+++++K +DLWTA+QQ D+W   C  DGIH   EGS+I
Sbjct  130  KIDMVRTNESCRIYSEACLEVCREMNLKAVDLWTAIQQVDNWETVCLKDGIHFAPEGSRI  189

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQW  69
            +VKEIL+V+KEA WEPSL+W+++A+E SE SP   +      +N S+   +    W
Sbjct  190  IVKEILRVIKEAHWEPSLYWKAMASEFSEDSPYDPVSMEGKTVNVSEPDLFGDFPW  245



>ref|XP_004492448.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=257

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/238 (55%), Positives = 168/238 (71%), Gaps = 5/238 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF Q GWGA L+ +Y+R+AD+VLRGY+GWNSR AL+V+D+VFPKNA  QP LVIVYFG
Sbjct  14   QYSFYQ-GWGATLSHLYARKADIVLRGYAGWNSRRALKVVDKVFPKNAPKQPELVIVYFG  72

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS  P  SG   HVPL EY ENMRKIA H+K LS+ TRIIFLS PPI+EA+  E    
Sbjct  73   GNDSTPPHKSGYGPHVPLDEYKENMRKIAQHIKGLSENTRIIFLSTPPIDEAKIKENMNE  132

Query  407  LG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITC-FTDGIHLTSEGSk  240
             G   R+NE  RKYS+AC+E+C + ++K IDLW  +Q++D+W   C F DGIHLT++G++
Sbjct  133  FGQPIRTNEECRKYSKACLEMCLEENIKAIDLWNLIQRKDNWKNVCIFDDGIHLTAKGNE  192

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQWN  66
            IV  EILKVLK A+W+PSL+W  +  E  E S    I       N S + F +  QW+
Sbjct  193  IVSNEILKVLKVAEWKPSLYWMEMPPEFGEDSSYDPISSFGVKTNISNIPFPYHLQWD  250



>ref|XP_007140343.1| hypothetical protein PHAVU_008G104100g [Phaseolus vulgaris]
 gb|ESW12337.1| hypothetical protein PHAVU_008G104100g [Phaseolus vulgaris]
Length=256

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 159/213 (75%), Gaps = 4/213 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QF F  EGW A LA +Y+R+AD++ RGY+GWN+R ALQVL++VFPK+A VQPSLVI+YFG
Sbjct  18   QFGFYGEGWAANLAHVYARKADIINRGYAGWNTRRALQVLEKVFPKDARVQPSLVIIYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVF--  414
            GNDS  PDPSG    VPL EYVENM+KI  H+KSLS+ TRII LS PPIN+      F  
Sbjct  78   GNDSSFPDPSGFGTSVPLEEYVENMKKIINHIKSLSETTRIIVLSAPPINDEVLNIQFAR  137

Query  413  --GTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              G   R+NE  R YSEAC++LC+ +++K IDLWT LQ+ D W   CF DGIH +  G+K
Sbjct  138  SNGKPSRTNETCRVYSEACMDLCQDMNIKAIDLWTTLQKIDKWQDACFIDGIHFSPLGNK  197

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            ++ KEI+KVLK+A+W+PSL+W+SL +E  E SP
Sbjct  198  VLFKEIMKVLKDAEWKPSLYWKSLPSEFDEDSP  230



>ref|XP_009587567.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Nicotiana tomentosiformis]
Length=237

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/212 (58%), Positives = 164/212 (77%), Gaps = 2/212 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  +GWGA L  +Y+R+AD+ LRGY GWNSR AL + ++VFPK+A +QP LVI+YFG
Sbjct  18   QISYYLQGWGATLNTLYARKADITLRGYIGWNSRMALNIYEKVFPKDAEIQPDLVILYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDS   D    ++HVPL EYVENMRKIA+H+KSLS+KTR+I LS PP+NE + ++ +G 
Sbjct  78   GNDSCHADFPN-SSHVPLEEYVENMRKIALHIKSLSEKTRLIMLSAPPVNEEQIIQHYGD  136

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
              GR NE  R YSEA ++L ++L VKVID W+ALQ+R DWL T F DG+HLT EGS I+V
Sbjct  137  NRGRDNETCRIYSEAGVKLAQELGVKVIDFWSALQERPDWLTTVFWDGMHLTKEGSDILV  196

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPII  135
            K+IL+++KEADWEPSL+W+ + +E S+  P++
Sbjct  197  KKILEIVKEADWEPSLNWEKIPDEFSDIGPVM  228



>ref|XP_010517107.1| PREDICTED: GDSL esterase/lipase At2g38180 isoform X2 [Camelina 
sativa]
Length=249

 Score =   238 bits (606),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = -3

Query  722  IYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAH  543
            + S  AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFGGNDSM P PSG   H
Sbjct  9    LTSTLADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFGGNDSMDPHPSGFGPH  68

Query  542  VPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGTL--GRSNELGRKYSE  369
            VPL E+++NMRKI  HL  LSDKTR+IFL+ PP+NE +   VFG +  GRSNEL R Y+E
Sbjct  69   VPLSEFIDNMRKIGEHLLGLSDKTRVIFLTPPPMNEKQIQLVFGDVIKGRSNELCRPYAE  128

Query  368  ACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEP  189
            A + LC++++VK +D+WTA+QQ+DDWL +CFTDGIH T++ S+IV+KEILK ++EADW+P
Sbjct  129  ALLNLCREINVKGVDIWTAIQQQDDWLNSCFTDGIHFTAKASEIVLKEILKAVREADWKP  188

Query  188  SLHWQSLANE  159
            SL+W+SL  E
Sbjct  189  SLYWKSLPIE  198



>ref|XP_006584285.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At2g38180-like 
[Glycine max]
Length=237

 Score =   236 bits (603),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD++LRGYSGWNSR AL+VL + FPK + VQPSL+IVYFG
Sbjct  19   QMSFDNGGWGAILANLYARKADIILRGYSGWNSRRALEVLMKXFPKESPVQPSLLIVYFG  78

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EYVENMRKIA HLKSLSD  RIIFL+ PPINE    +    
Sbjct  79   GNDSVHPHPSGLGPHVPLEEYVENMRKIANHLKSLSDHIRIIFLTSPPINEELIRKKLSA  138

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT-DGIHLTSEGSki  237
               GR+NE  R      +ELC+++++K I+LW+A+Q R+DWL   FT D +HL++EG+K+
Sbjct  139  TQSGRTNESCRDXEYGLMELCEEMNIKAINLWSAIQTREDWLDDSFTXDEVHLSAEGNKV  198

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFI  129
            VVKEILKVL++ DW+ SLHW S+A E ++ SP  +I
Sbjct  199  VVKEILKVLRKVDWKTSLHWMSMAIEFAKDSPYCWI  234



>gb|KCW86116.1| hypothetical protein EUGRSUZ_B02812 [Eucalyptus grandis]
Length=239

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 159/228 (70%), Gaps = 31/228 (14%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GWGA LAD+Y+R                          K+A  QPSLVIVYFG
Sbjct  18   QLSFGNGGWGASLADLYAR--------------------------KDAATQPSLVIVYFG  51

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P PSGL  HVPLPEY+ENMRKIA +LKSLSD TR+IFLS PPINE +  E    
Sbjct  52   GNDSMRPHPSGLGPHVPLPEYIENMRKIAKYLKSLSDCTRVIFLSAPPINEEKIRESLSD  111

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
             F  LGR+N+  R YSEAC++LC+++++K +DLWTA+Q+RDDW   CFTDGIH +SE S+
Sbjct  112  KFQDLGRTNDACRVYSEACLKLCREMNIKAVDLWTAIQKRDDWATACFTDGIHFSSEASE  171

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTS  99
            IVV+EIL+VLKEADWEPSL+W+S+  E  E SP   +GP+ KT +N S
Sbjct  172  IVVEEILRVLKEADWEPSLYWESMPAEFGEDSPYYPVGPDGKTTVNLS  219



>ref|XP_009796363.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Nicotiana sylvestris]
Length=238

 Score =   234 bits (597),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 161/210 (77%), Gaps = 2/210 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  +GWGA L  +YSR+AD+ LRGY+GWNS+ AL + ++VFPK+A +QP LVI+YFG
Sbjct  18   QISYYFQGWGATLNTLYSRKADITLRGYAGWNSKMALNIYEKVFPKDAEIQPDLVILYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG-  411
            GNDS  PD    ++HVPL EY+ENMRKI +H+KSLS+KTR+I LS PP+NE + ++ +G 
Sbjct  78   GNDSCHPDFPN-SSHVPLEEYIENMRKIILHIKSLSEKTRLIMLSAPPVNEEQLIQHYGD  136

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
              GR NE    YSEA ++L ++L VKVID W+ALQ+R DWL T F DG+HL  EGS I+V
Sbjct  137  NRGRDNETCHIYSEAGVKLGQELGVKVIDFWSALQERPDWLTTVFWDGMHLAKEGSDILV  196

Query  230  keilkvlkEADWEPSLHWQSLANESSETSP  141
            K+ILK+LKEADWEPSL+W+ + +E S+  P
Sbjct  197  KKILKILKEADWEPSLNWEKMPDEFSDIGP  226



>ref|XP_010509214.1| PREDICTED: GDSL esterase/lipase At2g38180-like isoform X2 [Camelina 
sativa]
Length=249

 Score =   234 bits (598),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = -3

Query  722  IYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAH  543
            + S  AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFGGNDSM P PSG   H
Sbjct  9    LTSTLADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFGGNDSMDPHPSGFGPH  68

Query  542  VPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGTL--GRSNELGRKYSE  369
            VPL E+++NMR+I  HL  LSDKTR+IFL+ PP+NE +   VFG +  GRSNE  R Y+E
Sbjct  69   VPLSEFIDNMRQIGEHLLGLSDKTRVIFLTPPPMNEKQIQIVFGGMVKGRSNERCRPYAE  128

Query  368  ACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEP  189
            A + LC++++VK +D+WTA+QQ+DDWL +CFTDGIH T++ S+IV+KEILK ++EADW+P
Sbjct  129  ALLNLCREINVKGVDIWTAIQQQDDWLNSCFTDGIHFTAKASEIVLKEILKAVREADWKP  188

Query  188  SLHWQSLANE  159
            SL+W+SL  E
Sbjct  189  SLYWKSLPVE  198



>ref|XP_004492449.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=265

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 165/235 (70%), Gaps = 7/235 (3%)
 Frame = -3

Query  749  EGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNA---GVQPSLVIVYFGGND  579
            EGWGA L  +Y+R+AD+VLRGYS WNS  ALQ++D++ PKN      QP+LVIVYFGGND
Sbjct  24   EGWGATLCHLYARKADIVLRGYSAWNSTRALQIVDKILPKNTISMQSQPTLVIVYFGGND  83

Query  578  SMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEVFGT  408
            S     SG   HVPL EY ENMRKIAIH+KSLS+  RI+FLS PP+NE +     + FG 
Sbjct  84   STRLRQSGKGPHVPLEEYKENMRKIAIHIKSLSENIRILFLSTPPVNEEQIEHNSDEFGQ  143

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
              R+NE  R YSEAC+E+C++ ++K ID+W+ +Q RDDW   CF DG+HL+ EGSK+V  
Sbjct  144  PLRTNEACRIYSEACLEMCREENIKAIDMWSLIQTRDDWKDVCFIDGVHLSIEGSKMVSD  203

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNK-TPINTSQLTFYWQPQWN  66
            EILKVLKEA+W+PSL+W+ +  E  E SP   + P+  T IN S + F    +W+
Sbjct  204  EILKVLKEAEWQPSLYWRKMPVEFGEDSPYDPVLPDGVTTINVSNIPFPLHVEWD  258



>ref|XP_004492446.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=290

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 165/230 (72%), Gaps = 4/230 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF Q GWGA L+ +Y+R+AD+VLRGY+GWNS+ ALQV+D+VFPKNA  QP LVIVYFG
Sbjct  55   QYSFHQ-GWGANLSHVYARKADIVLRGYAGWNSKRALQVVDKVFPKNAPKQPDLVIVYFG  113

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS L   SG   HVPL EY ENMRKIA HLKSLS+  RIIFLS PPI+EA+  +  G 
Sbjct  114  GNDSTLKHDSGYGPHVPLDEYKENMRKIAQHLKSLSEDIRIIFLSTPPIDEAKIQKFSGD  173

Query  407  LG--RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWL-ITCFTDGIHLTSEGSki  237
                ++NE   KYSEACI +C + ++KVIDLW  +Q+  +W     + DGIHLT++G+++
Sbjct  174  EKPTKTNEECEKYSEACIAMCLEENIKVIDLWNLIQKNTNWKNAYIWDDGIHLTTKGNEV  233

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTF  87
            V   IL VLK+A+W+PSL+W++++ E  E SP   +  +  PIN S   F
Sbjct  234  VSNAILDVLKDAEWKPSLYWKNMSAEFEEDSPYDPVTLHFKPINISHAPF  283



>ref|XP_006294972.1| hypothetical protein CARUB_v10024027mg [Capsella rubella]
 gb|EOA27870.1| hypothetical protein CARUB_v10024027mg [Capsella rubella]
Length=220

 Score =   228 bits (582),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 133/167 (80%), Gaps = 2/167 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIYSR AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFSDGGWGATLADIYSRTADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P  SG   HVPL E+++NMRKI  HL  LSDKTR+I+L+ PP+NE +   VFG 
Sbjct  78   GNDSMEPHLSGYGPHVPLSEFIDNMRKIGEHLLGLSDKTRVIYLAPPPMNEKQIQLVFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
               GRSNEL R Y+EA + LC++++VK +D+WTA+QQ DDWL +CFT
Sbjct  138  AIKGRSNELCRPYAEALLNLCREINVKGVDMWTAIQQEDDWLNSCFT  184



>ref|XP_003548744.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Glycine max]
 gb|KHN16448.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=223

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/217 (57%), Positives = 162/217 (75%), Gaps = 2/217 (1%)
 Frame = -3

Query  710  EADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLP  531
            + D+ LRGY+GWNSR A+QVLD+VFPK+A VQPSLVIVYFGGNDS  P  SGL  HVPL 
Sbjct  7    QVDIDLRGYAGWNSRHAVQVLDKVFPKDAPVQPSLVIVYFGGNDSSTPHSSGLGPHVPLQ  66

Query  530  EYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL-EVFGTLGRSNELGRKYSEACIEL  354
            EY+EN+RKI  HLKSLS+ TRI+ LS PPINEA       G   ++NE  + YSEAC+++
Sbjct  67   EYIENLRKIVDHLKSLSENTRILLLSTPPINEATITPNSDGKPTKTNEACQIYSEACLDV  126

Query  353  CKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQ  174
            C++++++ +DLW+A+Q+RD+W   CF DGIHL+SEGSKIV+KEIL VLK A+WEPSL+W+
Sbjct  127  CRKMNIEAMDLWSAIQKRDNWQDVCFIDGIHLSSEGSKIVLKEILNVLKGAEWEPSLYWK  186

Query  173  SLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            S+ +E  E SP   I  + K+ +N S   F    +W+
Sbjct  187  SMPSEFDEDSPYDPIASDGKSTVNLSNWVFPDNDKWD  223



>gb|AFK40200.1| unknown [Medicago truncatula]
Length=239

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++Y+R+AD+VLRGYSGWNSR AL+VLD+VFPK+A VQPSLVI+YFG
Sbjct  18   QMSFDNGGWGAILANLYTRKADIVLRGYSGWNSRRALEVLDEVFPKDAYVQPSLVIIYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVP+ EY ENMRKIA +LKSLSD  R+IFL+ PPI+E +  +    
Sbjct  78   GNDSIHPHPSGLGPHVPIEEYKENMRKIANYLKSLSDHIRLIFLTSPPISEVQIKKKLSA  137

Query  407  --LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
               GR+NE    Y+ A +ELC ++++KV++LW+A+Q+R+DWL   FTDG+HL++E S
Sbjct  138  TQTGRTNEHCGIYARALLELCDEMNLKVVNLWSAIQEREDWLDVSFTDGVHLSAERS  194



>gb|KEH23160.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=257

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/242 (51%), Positives = 168/242 (69%), Gaps = 10/242 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPK---NAGVQPSLVIV  597
            Q++   EGWGA LA +Y R+ D+VLRGY+GWNS   LQV+D +FPK       QP+L IV
Sbjct  14   QYNHYGEGWGATLAHLYGRKVDIVLRGYAGWNSTRGLQVVDDIFPKISIEQRDQPALAIV  73

Query  596  YFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---  426
            YFGGNDS LP PSGL  HV L EY++NM KIA +LK  S KTR+IFLSCPPI + +    
Sbjct  74   YFGGNDSHLPHPSGLGPHVRLEEYIQNMCKIANYLKINSPKTRLIFLSCPPIGDEQTEGN  133

Query  425  LEVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
            ++ FG   R+NE+ ++YS+A + +C  +++K IDLW+ +Q+RDDW   CF DGIH ++EG
Sbjct  134  IDAFGKAIRTNEVRKQYSDALLNMCSHMNIKAIDLWSLIQRRDDWKEVCFIDGIHFSAEG  193

Query  245  SkivvkeilkvlkEADWEPSLHWQSLANESSETS---PIIFIGPNKTPINTSQLTFYWQP  75
            S++V KEI+KV+KEA+WEP+L+W+++  E  E S   PI  + P KT IN S + F    
Sbjct  194  SEMVSKEIIKVIKEAEWEPNLYWKTMPVEFGEDSPFDPIHPLDPTKT-INISNIPFPHGE  252

Query  74   QW  69
             W
Sbjct  253  DW  254



>ref|XP_007140335.1| hypothetical protein PHAVU_008G103700g [Phaseolus vulgaris]
 gb|ESW12329.1| hypothetical protein PHAVU_008G103700g [Phaseolus vulgaris]
Length=229

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 156/238 (66%), Gaps = 30/238 (13%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            QFS+ Q+GWGA LA +Y+R                          KNA  QPSLVIVYFG
Sbjct  18   QFSYSQQGWGAALAHLYAR--------------------------KNATEQPSLVIVYFG  51

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---V  417
            GNDS+LP PSGL  HVPL EY+ENMRKI  HLKSLS KTRIIFLS PP+NEA       +
Sbjct  52   GNDSLLPHPSGLGQHVPLQEYIENMRKIGTHLKSLSQKTRIIFLSAPPVNEAHLYGDSVL  111

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCF-TDGIHLTSEGSk  240
             G   R+NE  R YSEAC+ELC+++++  IDLW+ LQ+RDDW   CF  DG+HL +EGS 
Sbjct  112  PGQQLRTNESCRIYSEACLELCREMNINAIDLWSVLQKRDDWRDVCFMKDGVHLGAEGSN  171

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTFYWQPQWN  66
            IV KEILKV+KEADWEPSL W+S+ +E  E SP   IGP+ T +N S  TF     W+
Sbjct  172  IVAKEILKVIKEADWEPSLQWRSMPSEYGEDSPFDPIGPDGTTVNVSNSTFLEAMLWD  229



>ref|XP_002322979.2| hypothetical protein POPTR_0016s123402g, partial [Populus trichocarpa]
 gb|EEF04740.2| hypothetical protein POPTR_0016s123402g, partial [Populus trichocarpa]
Length=184

 Score =   222 bits (566),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+LA IY+R+AD+VLRGYSGWNSR A+QVLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QLSYINEGWGAILAHIYARKADMVLRGYSGWNSRRAVQVLDQVFPKDATIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS+ P  +GL  HVPLPEY+EN RKIA+HLKS+SDKTR+IFLS P  +E +    L  
Sbjct  78   GNDSVHPHATGLGPHVPLPEYIENTRKIAMHLKSISDKTRVIFLSAPSASEEQIGIHLSD  137

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCF  276
               + R+NE  R YSEAC+E+C+++++K +DLWTA+QQ D+W   C 
Sbjct  138  KIDMVRTNESCRIYSEACLEVCREMNLKAVDLWTAIQQVDNWETVCL  184



>ref|XP_011095008.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Sesamum 
indicum]
Length=248

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/238 (53%), Positives = 158/238 (66%), Gaps = 31/238 (13%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWG+LL D+Y R                          K+A  QPSLVIVYFG
Sbjct  18   QMSFCDGGWGSLLTDLYHR--------------------------KDAADQPSLVIVYFG  51

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GND+M P PSGL  HVPLPEY+ENM+KIA+HL+SLS+KTR++FL+ PP++EA   + FG 
Sbjct  52   GNDAMQPHPSGLGPHVPLPEYLENMKKIALHLRSLSEKTRVVFLTSPPVDEAMIRQCFGN  111

Query  407  L----GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
                  R+NE  R YS+A +++CKQLDVKVI++W A Q RDDW      DGIHLTS GS+
Sbjct  112  AFDKQERTNESCRIYSDALVDMCKQLDVKVINVWKAFQHRDDWAEAYLADGIHLTSGGSR  171

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQW  69
            +V+KEILKVLKEA+WEPSLHW S+  E SE SP   +GP+ KT IN S +   W+ +W
Sbjct  172  VVLKEILKVLKEAEWEPSLHWMSMPAEFSEDSPYFPVGPDGKTTINVSDIISQWKTEW  229



>gb|KHN46944.1| GDSL esterase/lipase [Glycine soja]
Length=184

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 130/167 (78%), Gaps = 2/167 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA+LA++YSR+AD++LRGYSGWNSR AL VLD+VF K+A VQPSLVIVYFG
Sbjct  18   QMSFDNGGWGAILANLYSRKADIILRGYSGWNSRQALDVLDEVFSKDAHVQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL  HVPL EYV NMRKIA HLKSLSD  RIIFL+ PPINE +  +    
Sbjct  78   GNDSVHPHPSGLGPHVPLQEYVANMRKIANHLKSLSDHIRIIFLTSPPINEEQIRKKLSA  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
               GR+NE   +Y++A +ELC+++++K I+LW+A+Q RDDWL   FT
Sbjct  138  TQSGRTNESCGEYADALMELCEEMNIKAINLWSAIQTRDDWLDVSFT  184



>ref|XP_009377767.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Pyrus 
x bretschneideri]
Length=235

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 157/230 (68%), Gaps = 30/230 (13%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SFG  GW A+LAD Y+R                          K+A +QPSLVIVYFG
Sbjct  18   QLSFGNGGWSAILADFYAR--------------------------KDATIQPSLVIVYFG  51

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS+ P PSGL AHVPLPEY ENMRKI  HLKSLS+KTR+IFL+ PP+NE +  E    
Sbjct  52   GNDSVDPHPSGLGAHVPLPEYKENMRKIGKHLKSLSEKTRVIFLTAPPVNEEQIHEASDY  111

Query  407  L---GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSki  237
            +    R+NE  + YS+AC+++C++LD+K +DLWT++Q+R DW  TCFTDG+H +SEGSKI
Sbjct  112  VPPKNRTNESCKAYSDACLDVCRELDIKGVDLWTSIQKRKDWSTTCFTDGVHFSSEGSKI  171

Query  236  vvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLT  90
            V +EILKVL+EADWEP LHW+SL  E SE SP      + KT IN ++++
Sbjct  172  VGEEILKVLREADWEPRLHWKSLPTEFSEDSPYDPPAADGKTTINIAEIS  221



>ref|XP_007133896.1| hypothetical protein PHAVU_010G001100g [Phaseolus vulgaris]
 gb|ESW05890.1| hypothetical protein PHAVU_010G001100g [Phaseolus vulgaris]
Length=230

 Score =   219 bits (559),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 147/212 (69%), Gaps = 30/212 (14%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            + S+  EGWGA LA++Y+R                          KNA  QPSLVIVYFG
Sbjct  18   ELSYSCEGWGATLANLYAR--------------------------KNASDQPSLVIVYFG  51

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
            GNDSM P P+  + HVPL EY+ENMRKIAIHLKSLS KTR+IFLS PPINE +  E+   
Sbjct  52   GNDSMHPHPTAHSPHVPLQEYIENMRKIAIHLKSLSKKTRLIFLSSPPINEVQMHEMLSD  111

Query  416  -FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSk  240
              G L R+NE  R YSEAC+ELC++++VK IDLW+A+QQR DW   CFTDGIHL+ EG+K
Sbjct  112  LLGPLKRTNESCRIYSEACLELCREMNVKAIDLWSAVQQRHDWSDVCFTDGIHLSHEGNK  171

Query  239  ivvkeilkvlkEADWEPSLHWQSLANESSETS  144
            IV KEILKVL+EADWEPSLHW S+  E +E S
Sbjct  172  IVAKEILKVLREADWEPSLHWNSMPTEFAEDS  203



>ref|XP_004249820.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum lycopersicum]
Length=257

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 154/214 (72%), Gaps = 4/214 (2%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  +GWGA L   Y+R+AD+ LRGY GW SR ALQ+L +VFP N  +QPSLVI+YFG
Sbjct  22   QLSYFFDGWGAYLTGRYARKADISLRGYGGWTSRNALQILSKVFPPNDKIQPSLVILYFG  81

Query  587  GNDSMLPD-PSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFG  411
            GNDS  PD P+  N  VP+ EYVENMRKI +H+K LS  TR+I L+ P +NE + ++ +G
Sbjct  82   GNDSTDPDFPNSPN--VPIDEYVENMRKIILHIKGLSKNTRVIMLTAPAVNEEQIIKYYG  139

Query  410  T-LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkiv  234
            + LGR+NE GR YSEA I+L ++L +K ID W+ALQ+  DWL T F DG+HLT  GS+IV
Sbjct  140  SNLGRTNERGRIYSEAGIKLAQELGLKYIDFWSALQEPSDWLDTVFWDGMHLTKRGSEIV  199

Query  233  vkeilkvlkEADWEPSLHWQSLANESSETSPIIF  132
             ++I KV+KEA+WEP+L W+ + +E     P  F
Sbjct  200  SEKITKVIKEANWEPTLDWEEMPDEFDGIQPHDF  233



>ref|XP_008355542.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Malus domestica]
Length=185

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 144/185 (78%), Gaps = 6/185 (3%)
 Frame = -3

Query  602  IVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARAL  423
            +VYFGGNDSM P PSGL  HVPLPEY+ENMRKIA HLKSLSD TRIIFLSCPP+NEA   
Sbjct  1    MVYFGGNDSMGPHPSGLGPHVPLPEYIENMRKIASHLKSLSDSTRIIFLSCPPVNEAVIN  60

Query  422  E-----VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHL  258
            E      F  + R+NEL ++YSEACI+LC++++V  +DL+TA+Q++DDW+ TCF DGIH 
Sbjct  61   ENIRSGSFSEMIRTNELCKQYSEACIKLCQEINVTSVDLFTAVQRKDDWMNTCFIDGIHF  120

Query  257  TSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYW  81
            ++EGSKIVV+EILKVL+EADW+PSLHW+S+  E SE SP  I     KT  N S  TFYW
Sbjct  121  SAEGSKIVVEEILKVLREADWKPSLHWKSMPIEFSEDSPYDIAAADGKTTFNPSSSTFYW  180

Query  80   QPQWN  66
            + QW+
Sbjct  181  EIQWD  185



>gb|KCW86120.1| hypothetical protein EUGRSUZ_B02813 [Eucalyptus grandis]
Length=179

 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 135/171 (79%), Gaps = 4/171 (2%)
 Frame = -3

Query  641  VFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRII  462
            V  K+A  QPSLVIVYFGGNDSM P PSGL +HVPLPEYVENMRKIA +LKSLSD TR+I
Sbjct  8    VIIKDAATQPSLVIVYFGGNDSMRPQPSGLGSHVPLPEYVENMRKIAKYLKSLSDCTRVI  67

Query  461  FLSCPPINEARALEVFG----TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDD  294
            FLS PP+NE +  E +      L R+NEL R YSEACI+LC ++++K +DLWTA+Q+RDD
Sbjct  68   FLSAPPVNEEKIRESWSDKNQELRRTNELCRVYSEACIKLCGEMNIKAVDLWTAMQKRDD  127

Query  293  WLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            W   CFTDGIH + EGSKIVV+EIL+VLKEADW PSL+W+S+  E  E SP
Sbjct  128  WATACFTDGIHFSPEGSKIVVEEILRVLKEADWRPSLYWESMPTEFGEDSP  178



>ref|XP_006411022.1| hypothetical protein EUTSA_v10017306mg [Eutrema salsugineum]
 gb|ESQ52475.1| hypothetical protein EUTSA_v10017306mg [Eutrema salsugineum]
Length=178

 Score =   212 bits (539),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SFG+ GWGA LADIYSR AD++LRGY+GWNSR AL+VLDQVFPKNA +QPSLVIVYFG
Sbjct  18   QYSFGEGGWGATLADIYSRTADIILRGYAGWNSRFALKVLDQVFPKNAIIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P PSG  AHVPL E+ +NMRKI  HL SLS+KTR+IFLS PP+NE +    FG 
Sbjct  78   GNDSMDPHPSGHGAHVPLSEFTDNMRKIGEHLMSLSNKTRVIFLSPPPMNERQIEVFFGD  137

Query  407  L--GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQ  303
            +  GRSNEL R Y EA + LC ++DVK +   + L+Q
Sbjct  138  VMRGRSNELSRPYVEAVLNLCHEIDVKEMGSISQLRQ  174



>ref|XP_006339278.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Solanum tuberosum]
Length=268

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 152/222 (68%), Gaps = 15/222 (7%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPK-----------NAG  621
            Q S+  +GWGA L   Y+R+AD+ +RGY GW SR ALQVL +VFP+           N  
Sbjct  22   QLSYHFDGWGAALTGFYARKADIFVRGYGGWTSRNALQVLSKVFPQVLNLILEYCMYNDK  81

Query  620  VQPSLVIVYFGGNDSMLPD-PSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPP  444
            +QPSLVI+YFGGNDS  PD P+  N  VP+ EYVENMRKI +H+K LS   R+I L+ P 
Sbjct  82   IQPSLVILYFGGNDSTDPDVPNSPN--VPIDEYVENMRKIILHIKGLSKNIRVIMLTAPA  139

Query  443  INEARALEVFGT-LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDG  267
            +NE + +E +G+ LGR+NE GR YSEA I+L ++L +K ID W+ALQ+  DW+ T F DG
Sbjct  140  VNEKQIIEYYGSNLGRTNERGRIYSEAGIKLAQELGLKYIDFWSALQEPSDWMDTVFWDG  199

Query  266  IHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSP  141
            +HLT EGS IV  +I KV+KEA+WEP+L W+ + +E     P
Sbjct  200  LHLTKEGSAIVFHKITKVIKEAEWEPTLDWEKMPDEFDGNQP  241



>ref|XP_004173095.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cucumis sativus]
Length=238

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 149/194 (77%), Gaps = 5/194 (3%)
 Frame = -3

Query  632  KNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLS  453
            ++  VQPSLVIVYFGGNDSM P PSGL  HVPLPEY++NMRKIA H++SLSDKTR+IFL+
Sbjct  45   QDTVVQPSLVIVYFGGNDSMGPHPSGLGPHVPLPEYIDNMRKIATHIQSLSDKTRLIFLT  104

Query  452  CPPINEARAL----EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLI  285
            CPP+NE +      +    L R+NEL + Y++ACI+LC+++ VKV+DL+TA+Q+RDDW+ 
Sbjct  105  CPPVNETKVRGSQSKFLSELVRTNELCKAYAQACIKLCQEIGVKVVDLFTAIQKRDDWMN  164

Query  284  TCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTP-I  108
             CFTDGIHL++EGSK+VV+EI+KVLKEA+W+PSL+W+SL  E +E SP   +  + T  +
Sbjct  165  VCFTDGIHLSAEGSKVVVEEIMKVLKEAEWKPSLYWKSLPTEFAEDSPYDLVTADGTKTL  224

Query  107  NTSQLTFYWQPQWN  66
            N S    +    W+
Sbjct  225  NGSDWIIHRDIMWD  238



>tpg|DAA35310.1| TPA: hypothetical protein ZEAMMB73_058247 [Zea mays]
Length=245

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 157/225 (70%), Gaps = 6/225 (3%)
 Frame = -3

Query  722  IYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAH  543
            +  +++  +LR  + W  R + Q+L  +   ++ VQPSLVIVYFGGNDS+    SGL  H
Sbjct  21   VLEQKSHGMLRNMAVWRERDSFQLLIYMMTHDSAVQPSLVIVYFGGNDSIDAHCSGLGPH  80

Query  542  VPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-----ARALEVFGTLGRSNELGRK  378
            VPL EY+ NMRKIA HLKSLS+KTR++FLSCPP+NE     + +  +   + R+NE  R 
Sbjct  81   VPLDEYIGNMRKIAEHLKSLSEKTRVLFLSCPPLNEEMLRNSTSSTILSEIVRTNETCRL  140

Query  377  YSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEAD  198
            YS+ C+ LCK++ +KV+DLW A+Q+R+DW   CFTDG+HL+ EGS IVV+EILKVLKEA+
Sbjct  141  YSDVCVALCKEMHLKVVDLWHAMQKREDWKTACFTDGLHLSEEGSNIVVEEILKVLKEAE  200

Query  197  WEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            WEPSLHW+++  E +E SP   +  +    +N S+ T + + QWN
Sbjct  201  WEPSLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTIHRKIQWN  245



>tpg|DAA35309.1| TPA: hypothetical protein ZEAMMB73_058247 [Zea mays]
Length=244

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 155/224 (69%), Gaps = 5/224 (2%)
 Frame = -3

Query  722  IYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAH  543
            +  +++  +LR  + W  R + Q+L  +   ++ VQPSLVIVYFGGNDS+    SGL  H
Sbjct  21   VLEQKSHGMLRNMAVWRERDSFQLLIYMMTHDSAVQPSLVIVYFGGNDSIDAHCSGLGPH  80

Query  542  VPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALEVFGTLGRSNELGRKY  375
            VPL EY+ NMRKIA HLKSLS+KTR++FLSCPP+NE         +   + R+NE  R Y
Sbjct  81   VPLDEYIGNMRKIAEHLKSLSEKTRVLFLSCPPLNEEMLRNSTSTILSEIVRTNETCRLY  140

Query  374  SEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADW  195
            S+ C+ LCK++ +KV+DLW A+Q+R+DW   CFTDG+HL+ EGS IVV+EILKVLKEA+W
Sbjct  141  SDVCVALCKEMHLKVVDLWHAMQKREDWKTACFTDGLHLSEEGSNIVVEEILKVLKEAEW  200

Query  194  EPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            EPSLHW+++  E +E SP   +  +    +N S+ T + + QWN
Sbjct  201  EPSLHWKAMPTEFAEDSPFDLVSSSGDATVNPSEWTIHRKIQWN  244



>ref|XP_006848220.1| hypothetical protein AMTR_s00029p00244780 [Amborella trichopoda]
 gb|ERN09801.1| hypothetical protein AMTR_s00029p00244780 [Amborella trichopoda]
Length=194

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 145/193 (75%), Gaps = 5/193 (3%)
 Frame = -3

Query  629  NAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSC  450
            +A +QPSLVI+YFGGND+M P  SGL  HVPL E  EN+RK+A H+ SLS+KTR+I LSC
Sbjct  2    DADIQPSLVIMYFGGNDAMGPHSSGLGPHVPLSECKENLRKLANHILSLSEKTRLILLSC  61

Query  449  PPINE----ARALEVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLIT  282
            PP+NE    +    +FG + RSNE+ R+YSEACIELCK++ +KV+DLWT++Q+RDDW   
Sbjct  62   PPVNEDMFQSTTSGIFGQVTRSNEICRQYSEACIELCKEMGLKVVDLWTSIQKRDDWATA  121

Query  281  CFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPIN  105
            C TDG+H +SEGS I+V EIL++LKEA+WEPSLHW++L  E +E SP      + K+ +N
Sbjct  122  CLTDGVHFSSEGSDILVAEILQILKEAEWEPSLHWKALPTEFAEDSPYDLAASDGKSTLN  181

Query  104  TSQLTFYWQPQWN  66
             S+  F+ + +W+
Sbjct  182  ISEWIFHREDKWD  194



>ref|XP_006373986.1| hypothetical protein POPTR_0016s123301g, partial [Populus trichocarpa]
 gb|ERP51783.1| hypothetical protein POPTR_0016s123301g, partial [Populus trichocarpa]
Length=179

 Score =   204 bits (518),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = -3

Query  629  NAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSC  450
            +A VQPSLVI YFGGNDSM P P+ L  HVPLPE++ENM+KIA HLKSLS+KTR+IFL  
Sbjct  1    DAAVQPSLVITYFGGNDSMKPIPAELTPHVPLPEFIENMKKIATHLKSLSEKTRVIFLGV  60

Query  449  PPINEARALEVFGT-LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
            PP N+   ++++G    RSNE GR YSEA ++LC++L+VK IDLWT +QQ++DWL TCFT
Sbjct  61   PPANDEMIIQLYGERAARSNEGGRIYSEATLKLCQELEVKAIDLWTIMQQKNDWLTTCFT  120

Query  272  DGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTS  99
            DG HL SEGSKIV KEI++ L+EA+WEPSL+W+ + +E    SP    G N   IN++
Sbjct  121  DGFHLASEGSKIVAKEIIRALEEAEWEPSLYWKLMPSEFVGISPFDSEGNNGAIINSN  178



>gb|KJB76947.1| hypothetical protein B456_012G114000 [Gossypium raimondii]
Length=178

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 132/180 (73%), Gaps = 3/180 (2%)
 Frame = -3

Query  632  KNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLS  453
            ++A VQPSLVIVYFGGNDS  P PSGL  HVPLPEYVENM+KIA+HLK LS+ T ++FLS
Sbjct  2    EDAAVQPSLVIVYFGGNDSTEPHPSGLGPHVPLPEYVENMKKIAMHLKGLSENTHVMFLS  61

Query  452  CPPINEARALEVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFT  273
             PP+NE +  E FG   R+NE  R YSEAC++LC+++D+K IDLWTA+QQRDDW   CFT
Sbjct  62   TPPMNEGQTGESFGKCARTNEGCRIYSEACLKLCQEVDIKCIDLWTAIQQRDDWKTVCFT  121

Query  272  DGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQL  93
            DGIHL+SEGSK+V +EILK L E   EPSL W+SL  E  E S    +      IN S L
Sbjct  122  DGIHLSSEGSKLVGEEILKALAE---EPSLCWRSLPTEFDEDSVFDPVDEEGKNINISNL  178



>ref|XP_006481037.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X3 [Citrus 
sinensis]
Length=208

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 145/234 (62%), Gaps = 53/234 (23%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+ FG EGWGA+LAD+Y+R+AD++LRGY+GWNSR A+QVLD+VFP               
Sbjct  18   QYGFGNEGWGAILADLYARKADILLRGYAGWNSRRAVQVLDRVFP---------------  62

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
                                            KSLS KTRIIFLS PPIN+ +  E    
Sbjct  63   --------------------------------KSLSAKTRIIFLSAPPINKQQIFESHLS  90

Query  416  --FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
              F   GR+NE  R YSEAC++LC+++DVK IDLWTA+QQRDDWL TCF DGIH +SEGS
Sbjct  91   TDFAVWGRTNESCRIYSEACLKLCQEMDVKAIDLWTAMQQRDDWLTTCFMDGIHFSSEGS  150

Query  242  kivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFY  84
            KIVV EILKVL+EADWEPSLHW+SL  E  E S    + P+ ++ +N S    Y
Sbjct  151  KIVVTEILKVLREADWEPSLHWRSLPTEFDEDSSYYPVAPDGQSTVNVSDTNIY  204



>ref|XP_006373987.1| hypothetical protein POPTR_0016s123402g, partial [Populus trichocarpa]
 gb|ERP51784.1| hypothetical protein POPTR_0016s123402g, partial [Populus trichocarpa]
Length=176

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 124/167 (74%), Gaps = 11/167 (7%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q S+  EGWGA+LA IY+R+AD+VLRGYSGWNSR A+Q        +A +QPSLVIVYFG
Sbjct  18   QLSYINEGWGAILAHIYARKADMVLRGYSGWNSRRAVQ--------DATIQPSLVIVYFG  69

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARA---LEV  417
            GNDS+ P  +GL  HVPLPEY+EN RKIA+HLKS+SDKTR+IFLS P  +E +    L  
Sbjct  70   GNDSVHPHATGLGPHVPLPEYIENTRKIAMHLKSISDKTRVIFLSAPSASEEQIGIHLSD  129

Query  416  FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCF  276
               + R+NE  R YSEAC+E+C+++++K +DLWTA+QQ D+W   C 
Sbjct  130  KIDMVRTNESCRIYSEACLEVCREMNLKAVDLWTAIQQVDNWETVCL  176



>gb|KHN48498.1| GDSL esterase/lipase CPRD49 [Glycine soja]
Length=204

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 150/235 (64%), Gaps = 49/235 (21%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+S+  EGWGA L+ +Y+R+AD+VLRGY+ WNSR ALQVLD +FPK+A  QPSLVIVYFG
Sbjct  18   QYSY-YEGWGATLSHLYARKADIVLRGYAAWNSRRALQVLDTIFPKDAKEQPSLVIVYFG  76

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS LP+P+GL  HVP+ EY ENMRKIAIH+K LS+KTR IFL+ PPINEA+       
Sbjct  77   GNDSTLPNPNGLGPHVPVEEYKENMRKIAIHMKCLSEKTRTIFLTTPPINEAQ-------  129

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
                                                    I   +DGIHL++EGSKIV K
Sbjct  130  ----------------------------------------IHNNSDGIHLSTEGSKIVTK  149

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFYWQPQWN  66
            EILKVLKEA+WEPSL+W+S+ ++  E SP   +GP+ K+ IN S   F    QW+
Sbjct  150  EILKVLKEAEWEPSLYWRSMPSDFGEDSPYDPVGPDGKSTINLSNFAFPNNDQWD  204



>ref|XP_006429389.1| hypothetical protein CICLE_v10012918mg [Citrus clementina]
 gb|ESR42629.1| hypothetical protein CICLE_v10012918mg [Citrus clementina]
Length=174

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 127/170 (75%), Gaps = 6/170 (4%)
 Frame = -3

Query  575  MLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV-----FG  411
            MLP  +GL  HVPLPEY+ENMRKIA+HLKSLS KTRIIFLS PPIN+ +  E      F 
Sbjct  1    MLPHSTGLGPHVPLPEYIENMRKIALHLKSLSAKTRIIFLSAPPINKQQIFESHLSTDFA  60

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
              GR+NE  R YSEAC++LC+++DVK IDLWTA+QQRDDWL TCF DGIH +SEGSKIVV
Sbjct  61   VWGRTNESCRIYSEACLKLCQEMDVKAIDLWTAMQQRDDWLTTCFMDGIHFSSEGSKIVV  120

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFY  84
             EILKVL+EADWEPSLHW+SL  E  E S    + P+ ++ +N S    Y
Sbjct  121  TEILKVLREADWEPSLHWRSLPTEFDEDSSYYPVAPDGQSTVNVSDTNIY  170



>gb|KDO56633.1| hypothetical protein CISIN_1g030609mg [Citrus sinensis]
 gb|KDO56634.1| hypothetical protein CISIN_1g030609mg [Citrus sinensis]
Length=174

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 128/170 (75%), Gaps = 6/170 (4%)
 Frame = -3

Query  575  MLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV-----FG  411
            MLP  +GL  HVPLPEY+ENMRKIA+HLKSLS KTRIIFLS PPIN+ +  E      F 
Sbjct  1    MLPHSTGLGPHVPLPEYIENMRKIALHLKSLSAKTRIIFLSAPPINKQQIFESHLSTDFA  60

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
              GR+NE  R YSEAC++LC+++DVK IDLWTA+QQRDDWL TCF DGIH +SEGSKIVV
Sbjct  61   VWGRTNESCRIYSEACLKLCQEMDVKAIDLWTAMQQRDDWLTTCFMDGIHFSSEGSKIVV  120

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPIIFIGPN-KTPINTSQLTFY  84
            KEILKVL+EADWEPSLHW+SL  E  E S    + P+ ++ +N S    Y
Sbjct  121  KEILKVLREADWEPSLHWRSLPTEFDEDSTYYPVAPDGQSTVNVSDTNIY  170



>ref|XP_009369162.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X2 [Pyrus 
x bretschneideri]
Length=175

 Score =   192 bits (487),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = -3

Query  575  MLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALEVFGT  408
            M P PSGL  HVPLPEY+ENMRKIA HLKSLSD TR IFLSCPP+NEA         F  
Sbjct  1    MGPHPSGLGPHVPLPEYIENMRKIASHLKSLSDSTRTIFLSCPPVNEAVINGNISGTFSE  60

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
              R+NEL ++YSEACI+LC++ +V  +DL+TA+Q++DDW+ TCF DG+H ++EGSKIVV 
Sbjct  61   RIRTNELCQQYSEACIKLCQETNVTYVDLFTAVQRKDDWMNTCFIDGVHFSAEGSKIVVA  120

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
            EILKVL+EADW+PSLHW+S+  E SE SP  I     KT  N S  TFYW+ QW+
Sbjct  121  EILKVLREADWKPSLHWKSMPIEFSEDSPYDIAAADGKTTFNPSSSTFYWEIQWD  175



>gb|AAX20048.1| CPRD49-like protein [Capsicum annuum]
Length=257

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 149/214 (70%), Gaps = 14/214 (7%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPK------NAGVQPSL  606
            Q  +   GWGA L   Y+R+AD+ LRGY GWNSR AL+V  ++FPK      +  +QPSL
Sbjct  18   QLCYFFNGWGATLTTCYARKADIFLRGYIGWNSRMALEVYKKIFPKEHCRDMHREIQPSL  77

Query  605  VIVYFGGNDSMLPD-PSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR  429
            VI+YFGGNDS  PD P+  ++HVPL EYVENMRK+A H+K LS+KTR+I LS P +NE +
Sbjct  78   VILYFGGNDSQDPDFPN--SSHVPLHEYVENMRKLAHHIKGLSEKTRLIMLSAPAVNEEQ  135

Query  428  ALEVFG-TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTS  252
             L+ +G   GRSNE+G+KY+EA ++L ++L V VI+ + AL  +       F DG+HLT+
Sbjct  136  ILKTYGDNRGRSNEVGQKYAEAGVKLGQELGVPVINFFEALYGKP----GVFWDGMHLTA  191

Query  251  EGSkivvkeilkvlkEADWEPSLHWQSLANESSE  150
            EGSKI+  +I  V+K+ADWEP+L W  +  E ++
Sbjct  192  EGSKILFDKIKDVIKKADWEPTLDWDKMPTEYAD  225



>ref|XP_001777394.1| predicted protein [Physcomitrella patens]
 gb|EDQ57798.1| predicted protein [Physcomitrella patens]
Length=253

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 155/235 (66%), Gaps = 9/235 (4%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            ++SF   GWGA LA++Y R+AD+VLRGY GWN+R AL+VLD  FPK+A  QP LV+V+FG
Sbjct  18   EYSFCHGGWGAALANLYCRKADIVLRGYRGWNTRRALEVLDNFFPKDAENQPELVVVFFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV---  417
             ND   P PSG   HVPLPE+ +N+ +I+ HL+ LSDKTR+I  + PPI E   LE    
Sbjct  78   ANDGAFPMPSGRGQHVPLPEFEDNLCRISAHLQGLSDKTRVILTTAPPIYEPARLEAGRA  137

Query  416  ------FGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
                     L R+NE   +Y+ AC     ++   +IDLWT++Q++ DW  +C TDG+HL+
Sbjct  138  KHGEKGAKYLDRTNERACQYAAACRRAAHRMGAGIIDLWTSIQRQPDWQTSCLTDGMHLS  197

Query  254  SEGSkivvkeilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLT  90
            ++GS ++++E+LKVLK++ W+PSLH+ ++  +        F+ P +  +  ++++
Sbjct  198  AQGSGVMLEELLKVLKDSPWQPSLHYDAMPEDLLGPHIYNFLHPCEEDVEEARVS  252



>ref|XP_009369161.1| PREDICTED: GDSL esterase/lipase CPRD49-like isoform X1 [Pyrus 
x bretschneideri]
Length=176

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 130/176 (74%), Gaps = 6/176 (3%)
 Frame = -3

Query  575  MLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEAR-----ALEVFG  411
            M P PSGL  HVPLPEY+ENMRKIA HLKSLSD TR IFLSCPP+NEA          F 
Sbjct  1    MGPHPSGLGPHVPLPEYIENMRKIASHLKSLSDSTRTIFLSCPPVNEAVINGNIRSGTFS  60

Query  410  TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivv  231
               R+NEL ++YSEACI+LC++ +V  +DL+TA+Q++DDW+ TCF DG+H ++EGSKIVV
Sbjct  61   ERIRTNELCQQYSEACIKLCQETNVTYVDLFTAVQRKDDWMNTCFIDGVHFSAEGSKIVV  120

Query  230  keilkvlkEADWEPSLHWQSLANESSETSPI-IFIGPNKTPINTSQLTFYWQPQWN  66
             EILKVL+EADW+PSLHW+S+  E SE SP  I     KT  N S  TFYW+ QW+
Sbjct  121  AEILKVLREADWKPSLHWKSMPIEFSEDSPYDIAAADGKTTFNPSSSTFYWEIQWD  176



>ref|XP_010095231.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
 gb|EXB58999.1| GDSL esterase/lipase CPRD49 [Morus notabilis]
Length=247

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 138/205 (67%), Gaps = 36/205 (18%)
 Frame = -3

Query  707  ADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPE  528
            AD+VLRGYSGWNSR ALQVLDQVFPK+A VQP+LVIVYFGGNDS+ P PSGL  HVPLPE
Sbjct  62   ADIVLRGYSGWNSRRALQVLDQVFPKDAAVQPTLVIVYFGGNDSVKPHPSGLGQHVPLPE  121

Query  527  YVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGTLGRSNELGRKYSEACIELCK  348
            YVENMRKIAIHLK LS+KTRIIFL+ PPINE +  E+                 C+ + K
Sbjct  122  YVENMRKIAIHLKGLSEKTRIIFLTAPPINEDQIREI-----------------CLSIFK  164

Query  347  QLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSL  168
                +++DL                 GIH T+E SK+VVKEILKVLKE DWEP+LH++SL
Sbjct  165  ---FQLLDL---------------IYGIHFTAEASKVVVKEILKVLKEKDWEPNLHYKSL  206

Query  167  ANESSETSPIIFIGPN-KTPINTSQ  96
              E  E SP   +  + KT +N S+
Sbjct  207  PVEFGEDSPYYSVTSDGKTTLNKSE  231



>ref|XP_009621102.1| PREDICTED: GDSL esterase/lipase At2g38180-like [Nicotiana tomentosiformis]
Length=185

 Score =   173 bits (439),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = -3

Query  629  NAGVQPSLVIVYFGGNDSMLPD-PSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLS  453
            +A V+PSLVI+YFGGNDS+ P+ PS  +AHVPL EYVENM +IA+++ SLS+ TR+I LS
Sbjct  6    DADVKPSLVILYFGGNDSVDPEFPS--SAHVPLQEYVENMGRIALYITSLSENTRLIMLS  63

Query  452  CPPINEARALEVFG-TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCF  276
             PP+NE + ++ +G   GR NE  R YSEA I+L ++L VKVID W+ALQ+R DWL T F
Sbjct  64   APPVNEEQIVQFYGDNRGRYNETCRIYSEAGIKLGQELGVKVIDFWSALQERPDWLTTVF  123

Query  275  TDGIHLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSE  150
             DG+HLT EGS I+VK+I +VL+E DWEPSLHW  +A+E S+
Sbjct  124  WDGMHLTKEGSDILVKKISRVLREVDWEPSLHWTKMADEFSD  165



>gb|ADK60797.1| unknown, partial [Arachis diogoi]
Length=136

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = -3

Query  674  NSRCALQVLDQVFPKNAGVQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIH  495
            NSR ALQVL  +FPK+A  QPSL+IVYFGGNDS+L  PSGL  HVPL EY++NM KIAI+
Sbjct  1    NSRRALQVLQDIFPKDATEQPSLIIVYFGGNDSVLAHPSGLGQHVPLQEYIQNMTKIAIY  60

Query  494  LKSLSDKTRIIFLSCPPINEARAL---EVFGTLGRSNELGRKYSEACIELCKQLDVKVID  324
            LKSLS KTRIIFL  PP+NE + L   ++ G   R+NE  R YSEAC+ LC+ L++K ID
Sbjct  61   LKSLSKKTRIIFLGSPPVNEPQLLGNSDLLGRPFRTNESCRIYSEACLSLCRDLNIKAID  120

Query  323  LWTALQQRDDWLITCF  276
            +W+A+Q+R DW   CF
Sbjct  121  IWSAIQRRKDWREVCF  136



>ref|XP_004492447.1| PREDICTED: GDSL esterase/lipase CPRD49-like [Cicer arietinum]
Length=200

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 133/227 (59%), Gaps = 47/227 (21%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF Q GWGA LA +Y+R+AD+VLRGY+GWNSR AL V+D+VFPKNA  QP LVIVYFG
Sbjct  14   QYSFHQ-GWGATLAHLYARKADIVLRGYAGWNSRRALNVVDKVFPKNAPKQPELVIVYFG  72

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDS     SG   HVPL EY ENMRKIA H+KSLS+  RIIFLS PPI+E         
Sbjct  73   GNDSTPLHKSGNGPHVPLDEYKENMRKIAKHIKSLSENIRIIFLSTPPIDE---------  123

Query  407  LGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGSkivvk  228
                                          T +Q+  D       DGIHLT++G+KIV  
Sbjct  124  ------------------------------TKIQKFSD-------DGIHLTTKGNKIVSN  146

Query  227  eilkvlkEADWEPSLHWQSLANESSETSPIIFIGPNKTPINTSQLTF  87
             ILK LK+ADW+PSL+W+ ++ +  E SP   I  +    N S   F
Sbjct  147  AILKELKDADWKPSLYWKDMSAKFEEDSPYDPISLHVKTTNISHAPF  193



>ref|XP_006294971.1| hypothetical protein CARUB_v10024027mg [Capsella rubella]
 gb|EOA27869.1| hypothetical protein CARUB_v10024027mg [Capsella rubella]
Length=157

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q+SF   GWGA LADIYSR AD+++RGY+GWNSR AL+VLDQVFPK+A +QPSLVIVYFG
Sbjct  18   QYSFSDGGWGATLADIYSRTADIIVRGYAGWNSRFALKVLDQVFPKDAVIQPSLVIVYFG  77

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
            GNDSM P  SG   HVPL E+++NMRKI  HL  LSDKTR+I+L+ PP+NE +   VFG 
Sbjct  78   GNDSMEPHLSGYGPHVPLSEFIDNMRKIGEHLLGLSDKTRVIYLAPPPMNEKQIQLVFGY  137

Query  407  L  405
            +
Sbjct  138  I  138



>ref|XP_002982002.1| hypothetical protein SELMODRAFT_36615, partial [Selaginella moellendorffii]
 gb|EFJ17095.1| hypothetical protein SELMODRAFT_36615, partial [Selaginella moellendorffii]
Length=216

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 138/212 (65%), Gaps = 18/212 (8%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            ++SF   GWGA+LAD+YSR+AD++LRGY GWN+R     L    PK     P+LV+++ G
Sbjct  13   EYSFRPGGWGAVLADLYSRKADILLRGYRGWNTRRTRAALPHFLPK-----PALVVIFLG  67

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA--RAL--E  420
             ND+  P PSG    VP+PEY EN+R +  + +SLSD TR++ ++ PPIN+   RAL   
Sbjct  68   TNDAAFPLPSGKGQFVPIPEYKENLRYMCEYCQSLSDSTRVLLITPPPINDEARRALSWS  127

Query  419  VFGTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
             FG L      R++E  + Y++AC+ + +++ V V+DL  A+++ ++W   C +DG+H++
Sbjct  128  RFGPLALNWLDRTDERAQAYAQACLSVAEEMKVGVVDLHNAIKRVENWETECLSDGMHIS  187

Query  254  SEGSkivvkeilkvlkEADWEPSLHWQSLANE  159
             +G +I+V+ +L+ LK+     SLHW+ + N+
Sbjct  188  PKGCEILVELLLEALKKV----SLHWEDVPND  215



>ref|XP_002986082.1| hypothetical protein SELMODRAFT_123310 [Selaginella moellendorffii]
 gb|EFJ12901.1| hypothetical protein SELMODRAFT_123310 [Selaginella moellendorffii]
Length=246

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 139/212 (66%), Gaps = 18/212 (8%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            ++SF   GWGA+LAD+YSR+AD++LRGY GWN+R A   L    PK     P+L++++ G
Sbjct  17   EYSFRPGGWGAVLADLYSRKADILLRGYRGWNTRRARAALPHFLPK-----PALIVIFLG  71

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA--RAL--E  420
             ND+  P PSG    VP+PEY EN+R +  + +SLSD TR++ ++ PPIN+   RAL   
Sbjct  72   TNDAAFPLPSGKGQFVPIPEYKENLRYMCEYCQSLSDSTRVLLITPPPINDEARRALSWS  131

Query  419  VFGTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
             FG L      R++E  + Y++AC+ + +++ V V+DL  A+++ ++W   C +DG+H++
Sbjct  132  RFGPLAPNWLDRTDERAQAYAQACLSVAEEMKVGVVDLHNAIKRVENWETECLSDGMHIS  191

Query  254  SEGSkivvkeilkvlkEADWEPSLHWQSLANE  159
             +G +I+V+ +L+ L++     SLHW+ + N+
Sbjct  192  PKGCEILVELLLEALRKV----SLHWEDVPND  219



>ref|XP_009800647.1| PREDICTED: GDSL esterase/lipase CPRD49-like, partial [Nicotiana 
sylvestris]
Length=174

 Score =   155 bits (391),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 8/158 (5%)
 Frame = -3

Query  620  VQPSLVIVYFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPI  441
            ++PSLVI+YFGGNDS+ P+  G + HVPL EYVENMR+IA+H+ SLS+ TR+I LS PP+
Sbjct  4    LKPSLVILYFGGNDSVDPEFPG-STHVPLQEYVENMRRIALHITSLSENTRLIMLSAPPV  62

Query  440  NEARALEVF-GTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGI  264
            NE + ++ +     R+NE GR YSEA I+L ++L VKVID W+ LQ+  DW      DG+
Sbjct  63   NEEQIVQFYDDNRSRNNETGRIYSEAGIKLGQELGVKVIDFWSTLQEHPDW------DGM  116

Query  263  HLTSEGSkivvkeilkvlkEADWEPSLHWQSLANESSE  150
            HLT EGS I+VK+I +VL++A W+PSLHW  + +E S+
Sbjct  117  HLTKEGSDILVKKISRVLRKAQWKPSLHWTKMDDEFSD  154



>ref|XP_002989081.1| hypothetical protein SELMODRAFT_447540 [Selaginella moellendorffii]
 gb|EFJ09875.1| hypothetical protein SELMODRAFT_447540 [Selaginella moellendorffii]
Length=243

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 117/185 (63%), Gaps = 10/185 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQ-PSLVIVYF  591
            Q SFG  GWGA LA  Y R+AD+VLRGYSG+NS  AL +L ++FP +     P  V ++F
Sbjct  17   QQSFGPGGWGAALAHHYCRKADIVLRGYSGYNSSWALFLLHKIFPSSLEEDAPLAVTIFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-AR---AL  423
            G ND+ LPD    + HVPLP Y  N+++I  HLK++S +T I+ ++ PPI+E AR   A+
Sbjct  77   GANDAALPDRGSSHQHVPLPTYKTNLKRIISHLKAVSKRTHIVLITPPPIDEKARREFAI  136

Query  422  EVFGTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHL  258
            + +G        R+N + ++Y+ AC  +  + +V VIDLWT  Q+  DW     +DG+HL
Sbjct  137  DTYGRDAHELPERTNAVAQEYASACKAVAAEENVAVIDLWTLFQENHDWRSIYLSDGLHL  196

Query  257  TSEGS  243
            T+ G+
Sbjct  197  TAAGN  201



>ref|XP_002983691.1| hypothetical protein SELMODRAFT_156096 [Selaginella moellendorffii]
 gb|EFJ15187.1| hypothetical protein SELMODRAFT_156096 [Selaginella moellendorffii]
Length=243

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 114/185 (62%), Gaps = 10/185 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQ-PSLVIVYF  591
            Q SFG  GWGA LA  Y R+AD+VLRGYSG+NS  AL +L ++FP +     P  V ++F
Sbjct  17   QQSFGPGGWGAALAHHYCRKADIVLRGYSGYNSSWALFLLHKIFPSSLEEDAPLAVTIFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-ARALEVF  414
            G ND+ LPD    + HVPLP Y  N+++I  HLK++S +T I+ ++ PPI+E AR     
Sbjct  77   GANDAALPDRGSSHQHVPLPTYKTNLKRIISHLKAVSKRTHIVLITPPPIDEKARREFAI  136

Query  413  GTLG--------RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHL  258
             T G        R+N + ++Y+ AC  +  + +V VIDLWT  Q+  DW     +DG+HL
Sbjct  137  HTYGRDAHELPERTNAVAQEYASACKAVAAEENVAVIDLWTLFQKNHDWRSIYLSDGLHL  196

Query  257  TSEGS  243
            T+ G+
Sbjct  197  TAAGN  201



>ref|XP_010494745.1| PREDICTED: GDSL esterase/lipase At5g45920-like [Camelina sativa]
Length=264

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIVYF  591
            SF   GWGA LAD+ SR+AD+VLRGYSG+N+R AL+V+++VFP   ++ G  P+ V V+F
Sbjct  40   SFSDGGWGASLADLLSRKADIVLRGYSGYNTRWALKVVERVFPAAKEDGGESPAAVTVFF  99

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---  420
            G ND+ LP+      HVPL EY  N+R I   LK+   +T II +S PPI+E   L    
Sbjct  100  GANDACLPERCSGFQHVPLHEYKHNLRSIVSFLKNRWPQTAIILISPPPIHEESRLRYPY  159

Query  419  VFGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            +  T G   R+NE+   Y++AC+E+ K+  + VIDLW+ +QQ  +W   C  DG+HL+  
Sbjct  160  IENTTGLPERTNEVAGLYAKACVEVAKECHILVIDLWSKMQQIPNWQTECLWDGLHLSRI  219

Query  248  GS  243
            G+
Sbjct  220  GN  221



>ref|XP_006281007.1| hypothetical protein CARUB_v10027021mg [Capsella rubella]
 gb|EOA13905.1| hypothetical protein CARUB_v10027021mg [Capsella rubella]
Length=241

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIVYF  591
            SF   GWGA LAD+  R+AD+VLRGYSG+N+R AL+V+D+VFP   ++ G  P+ V V+F
Sbjct  17   SFSVGGWGASLADLLCRKADMVLRGYSGYNTRWALKVVDKVFPAGKEDGGESPAAVTVFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---  420
            G ND+ LP+      HVPL EY  N+R I   LK    +T II ++ PPI+E   L    
Sbjct  77   GANDACLPERCSGFQHVPLHEYKHNLRSIVSFLKKRWPQTAIILITPPPIHEEARLRYPY  136

Query  419  ---VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
                 G   R+NE+  +Y++AC+E+ ++ ++ VIDLW+ +QQ  +W   C  DG+HL+  
Sbjct  137  IENTTGLPERTNEVAGRYAKACVEVAEECEISVIDLWSKMQQIPNWQTECLWDGLHLSRV  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



>ref|XP_010037557.1| PREDICTED: GDSL esterase/lipase At5g62930 [Eucalyptus grandis]
 gb|KCW49273.1| hypothetical protein EUGRSUZ_K02836 [Eucalyptus grandis]
Length=242

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 9/184 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA LAD YSR+ADVVLRGY G+N+R AL +L  +FP ++   P    ++FG
Sbjct  14   QLSFRPGGWGAALADTYSRKADVVLRGYGGYNTRWALFLLHHIFPLDSSKPPVATTIFFG  73

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGT  408
             ND+ L   +    HVP+ EY EN++KI  HLK  S    I+ ++ PP++E    E  G+
Sbjct  74   ANDAALAGRTSERQHVPIDEYKENLKKIVHHLKKCSPTMLIVLITPPPVDEEGRNEYAGS  133

Query  407  L---------GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
            L          R+NE+   Y++ C++L  +L V+ ID+W+ +Q+ + W     +DG+HLT
Sbjct  134  LYGKNARELPERTNEVTGTYAQQCVQLSDELGVRAIDIWSKMQETEGWQKKFLSDGLHLT  193

Query  254  SEGS  243
             EG+
Sbjct  194  PEGN  197



>gb|KDP31089.1| hypothetical protein JCGZ_11465 [Jatropha curcas]
Length=242

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SFG  GWGA LAD YSR+ADV++RGY G+N+R AL +L  +FP  +   P  V ++FG N
Sbjct  16   SFGSGGWGAALADTYSRKADVLVRGYGGYNTRWALFLLHHLFPIGSIKPPVAVTIFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEV----F  414
            D+ L   +    HVP+ EY EN+RKI +HLK  S    +I ++ PP++E    E     +
Sbjct  76   DAALKGRTSERQHVPVDEYKENLRKIVLHLKECSPTMLVILITPPPVDEEGRKEYAKSKY  135

Query  413  GTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            G        R+NE+   Y++ C+EL K+L ++ ID+W+ +Q+ + W     +DG+HLT E
Sbjct  136  GEKAMELPERTNEMAGVYAKECVELAKELGIRSIDIWSKMQKIEGWQKKILSDGLHLTPE  195

Query  248  GS  243
            G+
Sbjct  196  GN  197



>ref|XP_011071877.1| PREDICTED: GDSL esterase/lipase At5g62930 isoform X3 [Sesamum 
indicum]
Length=242

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 115/184 (63%), Gaps = 9/184 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA LADIYSR+ DVVLRGY G+N+R AL +L+Q+FP  +   P  V ++FG
Sbjct  14   QQSFRSGGWGAALADIYSRKVDVVLRGYGGYNTRWALLMLNQIFPLGSAKPPVAVTIFFG  73

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPIN-EAR---ALE  420
             ND+   + +G   HVP+ EY +N+RKI  H+KS S  T +I ++ PPI+ E R   A  
Sbjct  74   ANDAARLEGTGKRQHVPVEEYKDNLRKIVQHIKSGSPNTLVILITPPPIDVEGRREYARS  133

Query  419  VFG-----TLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
            ++G     T  R+NE    Y++ C+ L  +L +  +D+W+ +Q+ + W     +DG+HLT
Sbjct  134  LYGDKASETPDRTNEATGVYAKQCVTLANELGLPSVDVWSKMQETEGWQKKFLSDGLHLT  193

Query  254  SEGS  243
             EG+
Sbjct  194  PEGN  197



>gb|AAK13160.1|AC078829_12 putative esterase [Oryza sativa Japonica Group]
Length=239

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 111/182 (61%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWGA LAD YSR+ADVV+RGY G+N+R AL +L Q+FP    V P    V+FG N
Sbjct  17   SFRPGGWGAALADTYSRKADVVVRGYGGYNTRWALFLLHQIFPLVGIVPPLATTVFFGAN  76

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARAL-  423
            D+ L   +G   HVP+ EY EN++KI  HLK  S    I+ ++ PPI+E      AR+L 
Sbjct  77   DAALLGRTGERQHVPVAEYKENLKKIVNHLKDCSKSMLIVLITPPPIDEDGRERFARSLY  136

Query  422  --EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
              E      R+NE+   Y+  CIEL +++++  ID+W+ +Q+   W     +DG+HLT E
Sbjct  137  GEEARKLPERTNEMAGVYASQCIELAREMNIHCIDIWSKMQETAGWQKLYLSDGLHLTPE  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



>ref|XP_010481516.1| PREDICTED: GDSL esterase/lipase At5g45920 [Camelina sativa]
Length=241

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIVYF  591
            SF   GWGA LAD+  R+AD+VLRGYSG+N+R AL+V+++VFP   ++ G  P+ V V+F
Sbjct  17   SFSDGGWGASLADLLRRKADLVLRGYSGYNTRWALKVVERVFPAAKEDGGESPAAVTVFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---  420
            G ND+ LP+      HVPL EY +N+R I   LK+   +T II ++ PPI+E   L    
Sbjct  77   GANDACLPERCSGFQHVPLHEYKQNLRSIVSFLKNRWPQTAIILITPPPIHEEARLRYPY  136

Query  419  VFGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            +  T G   R+NE+   Y++AC+E+ K+  + VIDLW+ +QQ  +W   C  DG+HL+  
Sbjct  137  IENTTGLPERTNEVAGLYAKACVEVAKECQILVIDLWSKMQQIPNWQTECLWDGLHLSRL  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



>ref|XP_010546010.1| PREDICTED: GDSL esterase/lipase At5g62930 [Tarenaya hassleriana]
Length=242

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 114/182 (63%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWGA LAD YSR+ADVV+RGY G+N+R AL +L  +FP ++   P+   ++FG N
Sbjct  16   SFRSGGWGAALADTYSRKADVVVRGYGGYNTRWALFLLHHIFPLDSLNPPAATTIFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA----RALEVF  414
            D+ L   +    HVP+ EY +N+RKI  HLK  S    ++ ++ PPI+EA     A  V+
Sbjct  76   DAALKGRTSDRQHVPVEEYKDNLRKIVQHLKKCSPTMLVVLITPPPIDEAGRKSYAESVY  135

Query  413  GTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            G        R+NE+   Y++ C+EL K+L V+ ++LW+ +Q+ + W     +DG+HLT++
Sbjct  136  GEKAMNEPERTNEMAGIYAQQCVELAKELGVRSVNLWSKMQESEGWHKKYLSDGLHLTAD  195

Query  248  GS  243
            G+
Sbjct  196  GN  197



>ref|XP_004298951.1| PREDICTED: GDSL esterase/lipase At5g62930 [Fragaria vesca subsp. 
vesca]
Length=244

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 112/182 (62%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWG+ LAD YSR+ADV +RGY G+N+R AL +L Q+FP ++G  P+   ++FG N
Sbjct  18   SFRLGGWGSALADTYSRKADVKVRGYGGYNTRWALFLLQQIFPLDSGKPPAAATIFFGAN  77

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGTL-  405
            D+ +   +    HVPL EY EN+RKI +HLK  S    I+ ++ PP++E    E    L 
Sbjct  78   DAAILGRTSDRQHVPLKEYKENLRKIVLHLKECSPTILIVLITPPPVDEEGRNEFARLLY  137

Query  404  --------GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
                     R+NE+   Y++ C+EL ++L V+ I+LW+ LQ+ + W     +DG+HLT E
Sbjct  138  GEDARKLPERTNEVAGDYAKQCLELAEELGVRFINLWSKLQETEGWQKKFLSDGLHLTPE  197

Query  248  GS  243
            G+
Sbjct  198  GN  199



>ref|NP_001064851.1| Os10g0476700 [Oryza sativa Japonica Group]
 gb|ABB47788.1| GDSL-like Lipase/Acylhydrolase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26765.1| Os10g0476700 [Oryza sativa Japonica Group]
 dbj|BAG91956.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87356.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51136.1| hypothetical protein OsJ_31884 [Oryza sativa Japonica Group]
Length=270

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 111/182 (61%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWGA LAD YSR+ADVV+RGY G+N+R AL +L Q+FP    V P    V+FG N
Sbjct  48   SFRPGGWGAALADTYSRKADVVVRGYGGYNTRWALFLLHQIFPLVGIVPPLATTVFFGAN  107

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARAL-  423
            D+ L   +G   HVP+ EY EN++KI  HLK  S    I+ ++ PPI+E      AR+L 
Sbjct  108  DAALLGRTGERQHVPVAEYKENLKKIVNHLKDCSKSMLIVLITPPPIDEDGRERFARSLY  167

Query  422  --EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
              E      R+NE+   Y+  CIEL +++++  ID+W+ +Q+   W     +DG+HLT E
Sbjct  168  GEEARKLPERTNEMAGVYASQCIELAREMNIHCIDIWSKMQETAGWQKLYLSDGLHLTPE  227

Query  248  GS  243
            G+
Sbjct  228  GN  229



>ref|XP_010686339.1| PREDICTED: GDSL esterase/lipase At5g45920 [Beta vulgaris subsp. 
vulgaris]
Length=236

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 110/179 (61%), Gaps = 6/179 (3%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWGA LA+ +SR AD+V+RGYSG+N+R A++VLD+VFP      P  V V+FG N
Sbjct  16   SFSNGGWGASLANHFSRTADIVVRGYSGYNTRWAVKVLDKVFPAMDEAAPMAVTVFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEA-RALEVF---  414
            D+ L D      HVPL EY  N+R I   LK   +   I+F++ PPI+EA R L  +   
Sbjct  76   DACLDDRYAAFQHVPLDEYKHNLRFIFSFLKKRWETAVILFITPPPIDEAERLLHPYIEN  135

Query  413  --GTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEGS  243
              G   R+NE    Y++AC+E+ ++    V+DLWT +Q+  DW  +C +DG+HL   G+
Sbjct  136  PSGLPERTNEATGAYAKACVEVARECATPVVDLWTKMQEFSDWKRSCLSDGLHLAQGGN  194



>ref|XP_008439764.1| PREDICTED: GDSL esterase/lipase At5g45920 [Cucumis melo]
 ref|XP_008439765.1| PREDICTED: GDSL esterase/lipase At5g45920 [Cucumis melo]
Length=240

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 110/184 (60%), Gaps = 9/184 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIV  597
            +FSF   GWG+ L + ++R+ADVV+RGYSG+N+R AL+V+++VFP   +     P  V V
Sbjct  14   EFSFADGGWGSALTNHFTRKADVVVRGYSGYNTRWALKVIERVFPPSEEREAASPLAVTV  73

Query  596  YFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE-  420
            +FG ND+ LPD  G   HVPL EY +N+  I   LK     TRI+ ++ PPI+E   L+ 
Sbjct  74   FFGANDACLPDRYGAFQHVPLHEYKQNLISIVTFLKKKWPATRILLITPPPIDEEGRLQN  133

Query  419  -----VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
                       R+N+    Y+ ACI + K+  V VID+WT +QQ   W   C +DG+HLT
Sbjct  134  PYVPNPLNEPERTNDAAGAYANACIAVAKECGVSVIDIWTKMQQVPGWEKACLSDGLHLT  193

Query  254  SEGS  243
              G+
Sbjct  194  RNGN  197



>ref|XP_009140757.1| PREDICTED: GDSL esterase/lipase At5g45920 [Brassica rapa]
 emb|CDY48194.1| BnaA04g15580D [Brassica napus]
Length=239

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 114/181 (63%), Gaps = 8/181 (4%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPK--NAGVQPSLVIVYFG  588
            SFG  GWGA LAD+  R+AD+VLRGYSG+N+R AL+V+++VFP   + G  PS V V+FG
Sbjct  16   SFGDGGWGASLADLLRRKADMVLRGYSGYNTRWALKVMERVFPAAGDGGAYPSAVTVFFG  75

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---V  417
             ND+ LP+      HVPL EY +N+R I   LK+   +T II ++ PPI+E   L    +
Sbjct  76   ANDACLPERCSGFQHVPLLEYKQNLRLIVSFLKNRWPRTVIILITPPPIDEEARLRYPYI  135

Query  416  FGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
              T+G   R+NE    Y++AC+ +  +  +  IDLW+ +QQ  +W   C  DG+HL+  G
Sbjct  136  ENTIGLPERTNEAAGTYAKACVAVANECQIPAIDLWSKMQQIPNWQTECLWDGLHLSRVG  195

Query  245  S  243
            +
Sbjct  196  N  196



>gb|AGU43760.1| carboxylesterase ester hydrolase [Pinus massoniana]
Length=242

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 112/182 (62%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWG+ LAD YSR+ADVVLRGY G+N+R AL +LD++FP  +   P +V V+FG N
Sbjct  17   SFRPGGWGSALADSYSRKADVVLRGYGGYNTRWALFLLDKIFPLQSSKPPLVVTVFFGAN  76

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE-ARALEVFGTL  405
            D+ L   S    HVPL EY EN+ +I  HLK+ SD   ++ ++ PP++E  R+     T 
Sbjct  77   DAALLGRSNERQHVPLLEYKENLHRIITHLKNCSDSMLVVLITPPPVDENGRSQYARATY  136

Query  404  G--------RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            G        R+NE    Y+++CI++  +  V VIDLW+ +Q+   W     +DG+HLT E
Sbjct  137  GESAVELPERTNETAGTYAKSCIQVAIESGVPVIDLWSKMQETVGWQQKYLSDGLHLTPE  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



>ref|XP_008393024.1| PREDICTED: GDSL esterase/lipase At5g62930-like isoform X1 [Malus 
domestica]
Length=243

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 117/184 (64%), Gaps = 9/184 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFG  588
            Q SF   GWGA LAD YSR+ADV +RGY G+N+R AL +L  +FP ++   P+   ++FG
Sbjct  15   QQSFRPGGWGAALADSYSRKADVKVRGYGGYNTRWALFLLQHLFPLDSKKPPAAATIFFG  74

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARA  426
             ND+ +   +G   HVP+ EY EN+RKI +HLK  S    I+ ++ PP++E      A++
Sbjct  75   ANDAAVLGRTGERQHVPVEEYKENLRKIVLHLKECSPTILIVLITPPPVDEDGRNEFAQS  134

Query  425  L---EVFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
            L   +  G   R+NE+   Y++ CIEL +++ ++ I+LW+A+Q+ + W     +DG+HLT
Sbjct  135  LYGKDASGLPERTNEVTGVYAKKCIELAEEMGLRSINLWSAMQETEGWQKKFLSDGLHLT  194

Query  254  SEGS  243
             EG+
Sbjct  195  PEGN  198



>ref|XP_004152216.1| PREDICTED: GDSL esterase/lipase At5g62930-like [Cucumis sativus]
 ref|XP_004156813.1| PREDICTED: GDSL esterase/lipase At5g62930-like isoform 2 [Cucumis 
sativus]
 gb|KGN52868.1| hypothetical protein Csa_4G004790 [Cucumis sativus]
Length=242

 Score =   151 bits (381),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 13/184 (7%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SFG  GWGA LAD YSR+ADV++RGY G+N+R AL +L  +FP N+   P +V ++FG N
Sbjct  16   SFGLGGWGAALADTYSRKADVIVRGYGGYNTRWALFLLHHIFPLNSPKAPIVVTIFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARALE  420
            D+ +   +    HVPL EY  N++K+  HLK  S  T +I ++ PP++E      AR+L 
Sbjct  76   DAAVLGRTSEKQHVPLEEYKYNLKKMVNHLKEYSPTTLVILITPPPVDEEGRNEYARSL-  134

Query  419  VFGTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
             +G        R+NE+   Y++ C+EL K++ +  IDLW+ +Q+ + W      DG+H T
Sbjct  135  -YGDKARELPERTNEVTGLYAKECLELAKEIGLHAIDLWSKMQETEGWQKKFLRDGLHFT  193

Query  254  SEGS  243
             EG+
Sbjct  194  PEGN  197



>ref|XP_008454268.1| PREDICTED: GDSL esterase/lipase At5g62930 isoform X2 [Cucumis 
melo]
 ref|XP_008454269.1| PREDICTED: GDSL esterase/lipase At5g62930 isoform X2 [Cucumis 
melo]
Length=242

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 113/184 (61%), Gaps = 13/184 (7%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SFG  GWGA LAD YSR+ADV++RGY G+N+R AL +L  +FP N+   P +V ++FG N
Sbjct  16   SFGLGGWGAALADTYSRKADVLVRGYGGYNTRWALFLLHHIFPLNSPKAPIVVTIFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINE------ARALE  420
            D+ +   +    HVPL EY  N++K+  HLK  S  T ++ ++ PP++E      AR+L 
Sbjct  76   DAAILGRTSERQHVPLEEYKYNLKKMVNHLKEYSPTTLVVLITPPPVDEEGRNEYARSL-  134

Query  419  VFGTLG-----RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
             +G        R+NE+   Y++ C+EL K++ +  IDLW+ +Q+ D W      DG+H T
Sbjct  135  -YGDKARELPERTNEVTGLYAKKCLELAKEIGLHSIDLWSKMQETDGWQKKFLRDGLHFT  193

Query  254  SEGS  243
             EG+
Sbjct  194  PEGN  197



>ref|XP_010441654.1| PREDICTED: GDSL esterase/lipase At5g45920-like [Camelina sativa]
Length=241

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIVYF  591
            SF   GWGA LAD+  R+AD+VL GYSG+N+R AL+V+++VFP   ++ G  P+ V V+F
Sbjct  17   SFSDGGWGASLADLLRRKADIVLLGYSGYNTRWALKVVERVFPAAKEDGGESPAAVTVFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---  420
            G ND+ LP+      HVPL EY +N+R I   LK+   +T II ++ PPI+E   L    
Sbjct  77   GANDACLPERCSGFQHVPLHEYKQNLRSIVSFLKNRWPQTAIILITPPPIHEEARLRYPY  136

Query  419  VFGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            +  T G   R+NE+   Y++AC+E+ K+  + VIDLW+ +QQ  +W   C  DG+HL+  
Sbjct  137  IENTTGLPERTNEVAGLYAKACVEVAKECQILVIDLWSKMQQIPNWQTECLWDGLHLSRV  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



>emb|CDX77062.1| BnaC04g38570D [Brassica napus]
Length=239

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 113/181 (62%), Gaps = 8/181 (4%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPK--NAGVQPSLVIVYFG  588
            SFG  GWGA LAD+  R+ADVVLRGYSG+N+R AL+V+++VF    + G  PS V V+FG
Sbjct  16   SFGDGGWGASLADLLRRKADVVLRGYSGYNTRWALKVMERVFQAAGDGGAYPSAVTVFFG  75

Query  587  GNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---V  417
             ND+ LP+      HVPL EY +N+R I   LK+   +T II ++ PPI+E   L    +
Sbjct  76   ANDACLPERCSGFQHVPLLEYKQNLRSIVSFLKNRWPRTVIILITPPPIDEEARLRYPYI  135

Query  416  FGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSEG  246
              T+G   R+NE    Y++ C+ +  +  +  IDLW+ +QQ  +W I C  DG+HL+  G
Sbjct  136  ENTIGLPERTNEAAGTYAKTCVAVASECQIPAIDLWSKMQQIPNWQIECLWDGLHLSRVG  195

Query  245  S  243
            +
Sbjct  196  N  196



>ref|XP_002318054.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE96274.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=242

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFPKNAGVQPSLVIVYFGGN  582
            SF   GWG+ LA+ YSR+ADV++RGY G+N+R AL +L  +FP N+   P+   ++FG N
Sbjct  16   SFRSGGWGSSLANTYSRKADVLVRGYGGYNTRWALFLLTHIFPLNSTKPPAATTIFFGAN  75

Query  581  DSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALEVFGTL-  405
            D+ L   +    HVP+ EY EN++K+ +HLK  S    ++ ++ PP++E    E   +L 
Sbjct  76   DAALLGRNSERQHVPVEEYKENLKKMVLHLKECSPAMLVVLITPPPVDEEGRKEYANSLY  135

Query  404  --------GRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
                     R+NE+   Y+  C+EL K L ++ IDLW+ +Q  D W     +DG+HLT E
Sbjct  136  GEKAMQFPERTNEMAGVYARQCVELAKDLGIRAIDLWSKMQGTDGWQKKFLSDGLHLTPE  195

Query  248  GS  243
            G+
Sbjct  196  GN  197



>ref|XP_004134670.1| PREDICTED: GDSL esterase/lipase At5g45920-like [Cucumis sativus]
 ref|XP_004155548.1| PREDICTED: GDSL esterase/lipase At5g45920-like [Cucumis sativus]
 gb|KGN49288.1| hypothetical protein Csa_6G518920 [Cucumis sativus]
Length=240

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 110/184 (60%), Gaps = 9/184 (5%)
 Frame = -3

Query  767  QFSFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIV  597
            +FSF   GWG+ L + ++R+ADVV+RGYSG+N+R AL+V+++VFP   +     P  V V
Sbjct  14   EFSFADGGWGSALTNHFTRKADVVVRGYSGYNTRWALKVIERVFPPSEEREAASPLAVTV  73

Query  596  YFGGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE-  420
            +FG ND+ LPD  G   HVPL EY +N+  I    K     TRI+ ++ PPI+E   L+ 
Sbjct  74   FFGANDACLPDRYGAFQHVPLHEYKQNLISIVSFFKKKWPATRILLITPPPIDEEGRLQN  133

Query  419  -----VFGTLGRSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLT  255
                       R+N+    Y++ACI + K+  V VID+WT +QQ   W   C +DG+HLT
Sbjct  134  PYVSNPVNEPERTNDAAGAYAKACIAVAKECGVSVIDIWTKMQQVPGWEKACLSDGLHLT  193

Query  254  SEGS  243
              G+
Sbjct  194  RNGN  197



>ref|XP_002865217.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41476.1| carboxylic ester hydrolase [Arabidopsis lyrata subsp. lyrata]
Length=241

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = -3

Query  761  SFGQEGWGALLADIYSREADVVLRGYSGWNSRCALQVLDQVFP---KNAGVQPSLVIVYF  591
            SF   GWGA LAD+  R+AD+VLRGYSG+N+R AL+V+++VFP   ++    P  V V+F
Sbjct  17   SFSDGGWGASLADLLRRKADMVLRGYSGYNTRWALKVVERVFPAAEEDGRDSPVAVTVFF  76

Query  590  GGNDSMLPDPSGLNAHVPLPEYVENMRKIAIHLKSLSDKTRIIFLSCPPINEARALE---  420
            G ND+ +P+      HVPL EY +N+R I   LK+   KT II ++ PPI+E   L    
Sbjct  77   GANDACMPERCSGFQHVPLDEYKQNLRSIISFLKNRWPKTAIILITPPPIDEEARLRYPY  136

Query  419  VFGTLG---RSNELGRKYSEACIELCKQLDVKVIDLWTALQQRDDWLITCFTDGIHLTSE  249
            +  T G   R+NE+  +Y++ACI + ++  + VIDLW+ +QQ  +W   C  DG+HL+  
Sbjct  137  IENTTGLPERTNEVAGRYAKACIAVAEEYQISVIDLWSKMQQIPNWQTECLWDGLHLSRV  196

Query  248  GS  243
            G+
Sbjct  197  GN  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100