BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014I15

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  316   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             316   1e-101   Phoenix dactylifera
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         315   3e-101   Jatropha curcas
emb|CDP11183.1|  unnamed protein product                                315   3e-101   Coffea canephora [robusta coffee]
gb|AFV46215.1|  hypothetical protein                                    308   5e-101   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  313   2e-100   Nelumbo nucifera [Indian lotus]
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  313   2e-100   Gossypium arboreum [tree cotton]
dbj|BAH57232.1|  AT4G13940                                              306   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           313   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             313   3e-100   Setaria italica
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  312   4e-100   
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             312   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB72025.1|  hypothetical protein B456_011G154000                    305   5e-100   Gossypium raimondii
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             311   8e-100   Vitis vinifera
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  311   1e-99    Sesamum indicum [beniseed]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                311   1e-99    Tarenaya hassleriana [spider flower]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             311   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB37873.1|  hypothetical protein B456_006G223900                    311   1e-99    Gossypium raimondii
gb|EMT11613.1|  Adenosylhomocysteinase                                  304   1e-99    
ref|XP_003601687.1|  Adenosylhomocysteinase                             311   2e-99    Medicago truncatula
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    310   3e-99    Medicago sativa [alfalfa]
gb|KJB72026.1|  hypothetical protein B456_011G154000                    305   3e-99    Gossypium raimondii
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             310   3e-99    Prunus persica
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  310   3e-99    Malus domestica [apple tree]
gb|KHN12344.1|  Adenosylhomocysteinase                                  307   3e-99    Glycine soja [wild soybean]
gb|KJB19538.1|  hypothetical protein B456_003G108500                    310   3e-99    Gossypium raimondii
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             310   4e-99    Nelumbo nucifera [Indian lotus]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                310   4e-99    Erythranthe guttata [common monkey flower]
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                310   4e-99    
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             310   4e-99    Sesamum indicum [beniseed]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             310   5e-99    Setaria italica
gb|AFK46472.1|  unknown                                                 303   6e-99    Lotus japonicus
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  309   7e-99    Pyrus x bretschneideri [bai li]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      309   7e-99    Gossypium hirsutum [American cotton]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             308   7e-99    Oryza sativa Japonica Group [Japonica rice]
gb|EMS57067.1|  Adenosylhomocysteinase                                  307   8e-99    Triticum urartu
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                309   8e-99    Eucalyptus grandis [rose gum]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               309   8e-99    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             309   8e-99    Arabidopsis lyrata subsp. lyrata
ref|NP_001031627.1|  adenosylhomocysteinase 1                           305   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       309   8e-99    Prunus mume [ume]
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             309   1e-98    Elaeis guineensis
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             308   1e-98    Sesamum indicum [beniseed]
gb|KHG17040.1|  Adenosylhomocysteinase                                  308   1e-98    Gossypium arboreum [tree cotton]
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             308   1e-98    
ref|NP_001031628.1|  adenosylhomocysteinase 1                           307   1e-98    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              301   2e-98    
emb|CAH69227.1|  putative adenosylhomocysteinase                        301   2e-98    Nicotiana glauca [glaucous tobacco]
ref|XP_010097949.1|  hypothetical protein L484_026840                   308   2e-98    Morus notabilis
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    308   2e-98    
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             308   2e-98    Elaeis guineensis
gb|KJB72027.1|  hypothetical protein B456_011G154000                    306   2e-98    Gossypium raimondii
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    308   2e-98    Arabis alpina [alpine rockcress]
gb|KHN44476.1|  Adenosylhomocysteinase                                  301   3e-98    Glycine soja [wild soybean]
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    301   3e-98    Camelina sativa [gold-of-pleasure]
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  307   3e-98    Gossypium arboreum [tree cotton]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             307   4e-98    Capsella rubella
gb|EPS72602.1|  adenosylhomocysteinase                                  310   4e-98    Genlisea aurea
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             307   4e-98    Oryza brachyantha
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             307   4e-98    Pyrus x bretschneideri [bai li]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  307   5e-98    Malus domestica [apple tree]
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             307   5e-98    Glycine max [soybeans]
gb|ACN34730.1|  unknown                                                 307   5e-98    Zea mays [maize]
gb|AGT16642.1|  Adenosylhomocysteinase                                  307   5e-98    Saccharum hybrid cultivar R570
ref|NP_001148534.1|  adenosylhomocysteinase                             307   6e-98    
ref|NP_001067845.2|  Os11g0455500                                       308   6e-98    
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  306   7e-98    Nelumbo nucifera [Indian lotus]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        305   8e-98    Nicotiana sylvestris
gb|KJB72029.1|  hypothetical protein B456_011G154000                    305   8e-98    Gossypium raimondii
gb|KJB28098.1|  hypothetical protein B456_005G027700                    306   8e-98    Gossypium raimondii
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   306   8e-98    Ricinus communis
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    306   9e-98    Arabis alpina [alpine rockcress]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    306   9e-98    Gossypium raimondii
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             306   1e-97    Cicer arietinum [garbanzo]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  306   1e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   306   1e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   306   2e-97    Populus tomentosa [Chinese white poplar]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      306   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   306   2e-97    Populus tomentosa [Chinese white poplar]
ref|NP_193130.1|  adenosylhomocysteinase 1                              306   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   305   2e-97    Populus tomentosa [Chinese white poplar]
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       305   2e-97    Gentiana triflora
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   305   2e-97    Populus tomentosa [Chinese white poplar]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    305   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             305   2e-97    Populus euphratica
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  305   2e-97    Vitis vinifera
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             305   2e-97    Nicotiana sylvestris
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                305   2e-97    Tarenaya hassleriana [spider flower]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   305   3e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   305   3e-97    Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  305   3e-97    
gb|AAM62888.1|  adenosylhomocysteinase                                  305   3e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   305   3e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   305   4e-97    Populus tomentosa [Chinese white poplar]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  305   4e-97    Solanum lycopersicum
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     304   4e-97    Eucalyptus grandis [rose gum]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       306   5e-97    
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             305   5e-97    Phoenix dactylifera
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   304   5e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   304   5e-97    Populus tomentosa [Chinese white poplar]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    304   5e-97    
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     304   5e-97    Populus tomentosa [Chinese white poplar]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             304   6e-97    Phaseolus vulgaris [French bean]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             307   6e-97    
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             304   6e-97    Nicotiana tomentosiformis
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  304   6e-97    Phoenix dactylifera
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     304   6e-97    Nicotiana tabacum [American tobacco]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  304   7e-97    Eucalyptus grandis [rose gum]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             304   7e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   304   7e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   304   7e-97    Populus tomentosa [Chinese white poplar]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   304   7e-97    Populus tomentosa [Chinese white poplar]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             304   8e-97    Solanum tuberosum [potatoes]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    303   9e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    304   9e-97    Gossypium raimondii
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            303   1e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            303   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  303   1e-96    Fragaria vesca subsp. vesca
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    303   1e-96    Catharanthus roseus [chatas]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             303   1e-96    Selaginella moellendorffii
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   303   1e-96    Populus tomentosa [Chinese white poplar]
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    303   1e-96    Lupinus luteus
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   303   2e-96    Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   303   2e-96    Populus tomentosa [Chinese white poplar]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             303   2e-96    Citrus sinensis [apfelsine]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    303   2e-96    Lupinus luteus
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       303   2e-96    Gentiana triflora
ref|XP_006373090.1|  adenosylhomocysteinase family protein              303   2e-96    Populus trichocarpa [western balsam poplar]
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   301   2e-96    Citrus sinensis [apfelsine]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   302   3e-96    Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   302   3e-96    Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   302   3e-96    Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   302   3e-96    Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   302   3e-96    Populus tomentosa [Chinese white poplar]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            302   3e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDP15078.1|  unnamed protein product                                302   3e-96    Coffea canephora [robusta coffee]
gb|AEI54335.1|  adenosylhomocysteinase                                  302   3e-96    Glycine max [soybeans]
emb|CDY50423.1|  BnaCnng19320D                                          302   3e-96    Brassica napus [oilseed rape]
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    302   4e-96    Pinus pinaster [cluster pine]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          302   4e-96    Amborella trichopoda
emb|CDY01177.1|  BnaA04g06420D                                          302   4e-96    
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               302   5e-96    Capsicum annuum
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   302   5e-96    Citrus sinensis [apfelsine]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    301   5e-96    Mesembryanthemum crystallinum
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   301   5e-96    Populus tomentosa [Chinese white poplar]
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             300   6e-96    
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                303   6e-96    Erythranthe guttata [common monkey flower]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             301   8e-96    Eutrema salsugineum [saltwater cress]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                301   8e-96    Cucumis melo [Oriental melon]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                301   9e-96    Brassica rapa
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           301   9e-96    Brassica rapa
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             301   1e-95    Glycine max [soybeans]
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     301   1e-95    Nicotiana tabacum [American tobacco]
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        292   1e-95    Petroselinum crispum
ref|NP_001289538.1|  adenosylhomocysteinase                             301   1e-95    Nicotiana sylvestris
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       301   1e-95    Nicotiana suaveolens
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             301   1e-95    Solanum lycopersicum
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             300   2e-95    Phaseolus vulgaris [French bean]
ref|NP_001234012.1|  adenosylhomocysteinase                             300   2e-95    
emb|CDY47309.1|  BnaAnng08830D                                          300   2e-95    Brassica napus [oilseed rape]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    300   2e-95    Petroselinum crispum
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                300   2e-95    Brassica rapa
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       300   2e-95    Nicotiana benthamiana
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    300   3e-95    Arabis alpina [alpine rockcress]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           300   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             300   3e-95    Citrus clementina [clementine]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                300   3e-95    Brassica rapa
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    300   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                300   4e-95    Camelina sativa [gold-of-pleasure]
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     300   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     299   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     299   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     299   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     299   4e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     299   4e-95    Populus tomentosa [Chinese white poplar]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       299   4e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             299   5e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-95    Populus tomentosa [Chinese white poplar]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             300   5e-95    
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-95    Populus tomentosa [Chinese white poplar]
ref|NP_189023.1|  adenosylhomocysteinase 2                              299   5e-95    Arabidopsis thaliana [mouse-ear cress]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     299   5e-95    Populus tomentosa [Chinese white poplar]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                300   5e-95    
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        299   6e-95    
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     299   6e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     299   6e-95    Populus tomentosa [Chinese white poplar]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    299   6e-95    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        299   7e-95    Cicer arietinum [garbanzo]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     299   8e-95    Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     298   8e-95    Populus tomentosa [Chinese white poplar]
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     293   1e-94    
gb|ACN40278.1|  unknown                                                 298   1e-94    Picea sitchensis
gb|ABR16547.1|  unknown                                                 298   1e-94    Picea sitchensis
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     298   1e-94    Populus tomentosa [Chinese white poplar]
gb|ABR17322.1|  unknown                                                 298   1e-94    Picea sitchensis
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     298   1e-94    Populus tomentosa [Chinese white poplar]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     298   1e-94    Populus tomentosa [Chinese white poplar]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             298   2e-94    
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    298   2e-94    Phalaenopsis sp.
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     298   2e-94    Populus tomentosa [Chinese white poplar]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             298   2e-94    Cucumis sativus [cucumbers]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     298   2e-94    Populus tomentosa [Chinese white poplar]
gb|ABR16573.1|  unknown                                                 298   2e-94    Picea sitchensis
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    298   2e-94    
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     297   2e-94    Populus tomentosa [Chinese white poplar]
gb|ABR16616.1|  unknown                                                 296   3e-94    Picea sitchensis
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     297   3e-94    Populus tomentosa [Chinese white poplar]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  297   3e-94    Populus euphratica
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     297   3e-94    Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 297   3e-94    Picea sitchensis
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        297   4e-94    Kalanchoe daigremontiana
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     297   5e-94    Populus tomentosa [Chinese white poplar]
gb|ABK25129.1|  unknown                                                 296   5e-94    Picea sitchensis
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             296   5e-94    Arabidopsis thaliana [mouse-ear cress]
gb|ABR16138.1|  unknown                                                 296   5e-94    Picea sitchensis
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     296   5e-94    Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     296   6e-94    Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     296   6e-94    Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        296   6e-94    Trifolium pratense [peavine clover]
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                299   7e-94    Erythranthe guttata [common monkey flower]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              296   7e-94    Populus trichocarpa [western balsam poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     296   7e-94    Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     296   8e-94    Populus tomentosa [Chinese white poplar]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     296   8e-94    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003629610.1|  Adenosylhomocysteinase                             295   1e-93    Medicago truncatula
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      295   2e-93    Petunia x hybrida [garden petunia]
gb|EMS57266.1|  Adenosylhomocysteinase                                  302   2e-93    Triticum urartu
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     295   3e-93    Cucumis sativus [cucumbers]
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    296   6e-93    Linum usitatissimum
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             292   3e-92    Cucumis melo [Oriental melon]
ref|XP_001755926.1|  predicted protein                                  292   3e-92    
ref|XP_001755929.1|  predicted protein                                  292   3e-92    
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       283   3e-92    Nicotiana benthamiana
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                291   9e-92    Solanum tuberosum [potatoes]
ref|XP_001755906.1|  predicted protein                                  290   1e-91    
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     287   3e-90    Phaseolus vulgaris [French bean]
gb|ACE96401.1|  C-x8-C-x5-C-x3-H type Zn-finger                         270   4e-88    Populus tremula [European aspen]
gb|ACE96407.1|  C-x8-C-x5-C-x3-H type Zn-finger                         270   6e-88    Populus tremula [European aspen]
emb|CDY58805.1|  BnaC08g46780D                                          271   3e-84    Brassica napus [oilseed rape]
gb|AJD09650.1|  SAHH1                                                   259   4e-84    Braya humilis
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            268   7e-84    
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                270   7e-84    Chlorella variabilis
gb|AJD09655.1|  SAHH1                                                   259   7e-84    Iberis amara [bitter candytuft]
gb|AJD09647.1|  SAHH1                                                   258   1e-83    Arabis alpina [alpine rockcress]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           269   2e-83    Brassica rapa
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    269   2e-83    Ostreococcus tauri
gb|AJD09657.1|  SAHH1                                                   258   2e-83    Lepidium campestre [bastard cress]
emb|CDX85127.1|  BnaC07g07790D                                          269   2e-83    
gb|AJD09658.1|  SAHH1                                                   258   2e-83    Matthiola fruticulosa subsp. valesiaca
gb|AJD09646.1|  SAHH1                                                   257   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003057172.1|  adenosylhomocysteinase                             268   4e-83    Micromonas pusilla CCMP1545
gb|AJD09654.1|  SAHH1                                                   256   6e-83    Hornungia alpina subsp. brevicaulis
gb|AJD09659.1|  SAHH1                                                   256   1e-82    Noccaea ochroleuca
gb|KIZ05177.1|  adenosylhomocysteinase                                  278   1e-82    Monoraphidium neglectum
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              267   2e-82    Volvox carteri f. nagariensis
gb|AJD09652.1|  SAHH1                                                   255   2e-82    Diplotaxis tenuifolia
gb|AJD09648.1|  SAHH1                                                   255   2e-82    
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  266   2e-82    
ref|XP_001419579.1|  predicted protein                                  266   3e-82    
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     266   7e-82    
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      264   1e-81    
ref|XP_002505983.1|  adenosylhomocysteinase                             264   2e-81    
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     261   5e-81    
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       263   7e-81    
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       262   1e-80    
gb|AJD09649.1|  SAHH1                                                   251   1e-80    
gb|KFK36282.1|  hypothetical protein AALP_AA4G102500                    247   5e-79    
ref|XP_005708566.1|  adenosylhomocysteinase                             258   9e-79    
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                257   7e-78    
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     255   9e-78    
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  253   3e-77    
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      251   3e-76    
ref|XP_011397211.1|  Adenosylhomocysteinase                             251   6e-76    
emb|CDY50106.1|  BnaC01g43540D                                          250   1e-75    
emb|CDY67319.1|  BnaA03g57570D                                          238   7e-75    
gb|EJK64241.1|  hypothetical protein THAOC_15047                        236   1e-73    
emb|CDX77483.1|  BnaA07g06210D                                          242   3e-73    
gb|EJY87176.1|  Adenosylhomocysteinase                                  241   9e-73    
emb|CDY53211.1|  BnaC03g74050D                                          239   9e-72    
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    237   4e-71    
ref|XP_008872075.1|  adenosylhomocysteinase 2                           236   1e-70    
gb|KFG60763.1|  putative adenosylhomocysteinase                         232   2e-70    
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   234   4e-70    
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  234   4e-70    
ref|XP_002177758.1|  adenosylhomocysteinase                             233   1e-69    
gb|ABR16332.1|  unknown                                                 233   1e-69    
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   233   2e-69    
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                233   2e-69    
ref|XP_009493630.1|  adenosylhomocysteinase 1                           233   2e-69    
gb|ETO08386.1|  hypothetical protein RFI_29000                          226   2e-69    
ref|XP_009833581.1|  adenosylhomocysteinase 2                           232   5e-69    
gb|EPT27008.1|  adenosylhomocysteinase, putative                        233   1e-68    
ref|XP_008611237.1|  adenosylhomocysteinase                             231   1e-68    
gb|ETO04662.1|  hypothetical protein RFI_32734                          223   1e-68    
gb|KFH13893.1|  putative adenosylhomocysteinase                         233   1e-68    
gb|EPR62066.1|  putative adenosylhomocysteinase                         233   2e-68    
gb|KFG42936.1|  putative adenosylhomocysteinase                         233   2e-68    
gb|KFG55060.1|  putative adenosylhomocysteinase                         233   2e-68    
gb|ESS32583.1|  putative adenosylhomocysteinase                         233   2e-68    
ref|WP_036944508.1|  hypothetical protein                               228   7e-68    
ref|XP_001023087.1|  adenosylhomocysteinase family protein              228   9e-68    
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                228   2e-67    
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              228   2e-67    
ref|WP_043581849.1|  adenosylhomocysteinase                             227   4e-67    
gb|ADK98229.1|  S-adenosyl-homocysteine hydrolase                       216   6e-67    
gb|ADK98228.1|  S-adenosyl-homocysteine hydrolase                       215   6e-67    
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                226   6e-67    
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             226   7e-67    
gb|ADK98240.1|  S-adenosyl-homocysteine hydrolase                       215   7e-67    
gb|AHG90399.1|  Adenosylhomocysteinase                                  226   8e-67    
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                225   2e-66    
ref|WP_027006534.1|  hypothetical protein                               225   2e-66    
gb|ADR18482.1|  adenosylhomocysteinase                                  224   3e-66    
ref|WP_041723781.1|  adenosylhomocysteinase                             224   4e-66    
gb|ADK98242.1|  S-adenosyl-homocysteine hydrolase                       213   4e-66    
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   224   4e-66    
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                224   5e-66    
gb|ADK98221.1|  S-adenosyl-homocysteine hydrolase                       213   6e-66    
emb|CCA20123.1|  unnamed protein product                                223   1e-65    
dbj|GAE21599.1|  adenosylhomocysteinase                                 219   1e-65    
dbj|GAE20305.1|  adenosylhomocysteinase                                 218   1e-65    
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     220   1e-65    
ref|WP_009947852.1|  S-adenosyl-L-homocysteine hydrolase                223   2e-65    
gb|ADK98227.1|  S-adenosyl-homocysteine hydrolase                       211   2e-65    
gb|AEN82434.1|  AT4G13940-like protein                                  211   2e-65    
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                222   3e-65    
gb|ADK98231.1|  S-adenosyl-homocysteine hydrolase                       211   3e-65    
ref|WP_039007649.1|  S-adenosyl-L-homocysteine hydrolase                222   4e-65    
gb|ADK98222.1|  S-adenosyl-homocysteine hydrolase                       211   4e-65    
ref|WP_027072847.1|  S-adenosyl-L-homocysteine hydrolase                221   4e-65    
gb|ADK98225.1|  S-adenosyl-homocysteine hydrolase                       211   5e-65    
ref|WP_009576960.1|  Adenosylhomocysteinase                             221   5e-65    
ref|WP_003475714.1|  adenosylhomocysteinase                             221   6e-65    
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-65    
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-65    
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                221   8e-65    
ref|WP_003465484.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-64    
gb|EKE10711.1|  hypothetical protein ACD_15C00209G0001                  211   2e-64    
ref|WP_044656141.1|  adenosylhomocysteinase                             215   2e-64    
ref|WP_028061676.1|  hypothetical protein                               219   2e-64    
ref|XP_010024044.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    218   2e-64    
ref|XP_002902721.1|  adenosylhomocysteinase                             219   3e-64    
ref|XP_002765933.1|  conserved hypothetical protein                     219   4e-64    
ref|XP_010024043.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    217   5e-64    
emb|CCI50303.1|  unnamed protein product                                219   5e-64    
ref|WP_023840013.1|  MULTISPECIES: adenosylhomocysteinase               218   6e-64    
ref|WP_011438808.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   6e-64    
ref|WP_027325990.1|  adenosylhomocysteinase                             218   8e-64    
ref|XP_008893590.1|  adenosylhomocysteinase                             218   8e-64    
ref|WP_041448694.1|  adenosylhomocysteinase                             218   9e-64    
gb|ABS24379.1|  adenosylhomocysteinase                                  218   1e-63    
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       218   1e-63    
ref|WP_029416908.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-63    
ref|WP_026633760.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-63    
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-63    
ref|XP_002788757.1|  conserved hypothetical protein                     217   2e-63    
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     217   2e-63    
ref|WP_028081726.1|  S-adenosyl-L-homocysteine hydrolase                217   2e-63    
ref|WP_043959717.1|  S-adenosyl-L-homocysteine hydrolase                217   2e-63    
ref|XP_004344078.1|  Sadenosyl-L-homocysteine hydrolase, putative       217   2e-63    
dbj|BAH40894.1|  adenosylhomocysteinase                                 218   2e-63    
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                217   2e-63    
ref|WP_027069325.1|  S-adenosyl-L-homocysteine hydrolase                217   2e-63    
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             214   2e-63    
ref|WP_029720180.1|  hypothetical protein                               217   2e-63    
ref|WP_012917260.1|  S-adenosyl-L-homocysteine hydrolase                217   2e-63    
ref|WP_024305137.1|  adenosylhomocysteinase                             213   2e-63    
ref|WP_041266969.1|  adenosylhomocysteinase                             217   3e-63    
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             217   3e-63    
ref|WP_019878251.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-63    
ref|WP_033834449.1|  S-adenosyl-L-homocysteine hydrolase                216   4e-63    
ref|WP_019661087.1|  S-adenosyl-L-homocysteine hydrolase                216   4e-63    
emb|CBK23294.2|  unnamed protein product                                216   4e-63    
emb|CDA85923.1|  adenosylhomocysteinase                                 214   5e-63    
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                216   5e-63    
ref|WP_015104941.1|  Adenosylhomocysteinase                             216   5e-63    
ref|WP_017912973.1|  S-adenosyl-L-homocysteine hydrolase                216   5e-63    
ref|WP_014687599.1|  S-adenosyl-L-homocysteine hydrolase                216   5e-63    
ref|WP_019815305.1|  S-adenosyl-L-homocysteine hydrolase                216   6e-63    
ref|WP_033429119.1|  adenosylhomocysteinase                             216   6e-63    
emb|CAJ65404.1|  Adenosylhomocysteinase (S-adenosyl-L-homocystein...    216   6e-63    
ref|WP_030440996.1|  adenosylhomocysteinase                             216   7e-63    
ref|WP_041939978.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-63    
ref|WP_027079175.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-63    
ref|WP_007028966.1|  S-adenosyl-L-homocysteine hydrolase                216   8e-63    
ref|WP_028769932.1|  S-adenosyl-L-homocysteine hydrolase                215   8e-63    
ref|WP_026415696.1|  S-adenosyl-L-homocysteine hydrolase                216   8e-63    
ref|WP_013219512.1|  S-adenosyl-L-homocysteine hydrolase                214   8e-63    
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase                216   8e-63    
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    215   8e-63    
ref|WP_044300351.1|  adenosylhomocysteinase                             215   9e-63    
ref|WP_032576381.1|  adenosylhomocysteinase                             215   9e-63    
dbj|GAN45334.1|  S-adenosyl-L-homocysteine hydrolase                    215   9e-63    
ref|WP_010481888.1|  S-adenosyl-L-homocysteine hydrolase [              215   9e-63    
ref|WP_008375899.1|  adenosylhomocysteinase                             216   9e-63    
ref|WP_022301900.1|  adenosylhomocysteinase                             214   1e-62    
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                215   1e-62    
ref|WP_021645958.1|  adenosylhomocysteinase                             215   1e-62    
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               215   1e-62    
ref|WP_039706318.1|  hypothetical protein                               215   1e-62    
ref|WP_038508580.1|  adenosylhomocysteinase                             215   1e-62    
ref|WP_005415311.1|  S-adenosyl-L-homocysteine hydrolase                215   1e-62    
gb|EWM11842.1|  adenosylhomocysteinase                                  215   1e-62    
ref|WP_005170542.1|  adenosylhomocysteinase                             215   1e-62    
ref|WP_043716643.1|  adenosylhomocysteinase                             215   1e-62    
ref|WP_007238886.1|  S-adenosyl-L-homocysteine hydrolase                215   1e-62    
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-62    
ref|WP_020651088.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-62    
ref|WP_012854369.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_005465635.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-62    
ref|WP_006801116.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_025876541.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-62    
ref|WP_008213996.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
emb|CDJ37737.1|  adenosylhomocysteinase, putative                       215   2e-62    
ref|WP_017909629.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_017915311.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_002775930.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_043093152.1|  S-adenosyl-L-homocysteine hydrolase                214   2e-62    
ref|WP_026869144.1|  adenosylhomocysteinase                             213   2e-62    
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_018770150.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_033830371.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_039856658.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                213   3e-62    
ref|WP_034305234.1|  adenosylhomocysteinase                             214   3e-62    
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_032974920.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_023357899.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_016268876.1|  adenosylhomocysteinase                             214   3e-62    
ref|WP_019466297.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-62    
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    214   3e-62    
gb|KFA30189.1|  S-adenosyl-L-homocysteine hydrolase                     211   3e-62    
ref|WP_038031735.1|  adenosylhomocysteinase                             213   4e-62    
ref|WP_043474120.1|  adenosylhomocysteinase                             214   4e-62    
ref|WP_035857732.1|  hypothetical protein                               214   4e-62    
ref|WP_035812380.1|  hypothetical protein                               214   4e-62    
ref|WP_044852292.1|  adenosylhomocysteinase                             214   4e-62    
ref|WP_006370365.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-62    
ref|WP_032850487.1|  adenosylhomocysteinase                             213   4e-62    
ref|WP_005910841.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    214   4e-62    
ref|WP_019182466.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-62    
ref|WP_044606136.1|  hypothetical protein                               213   4e-62    
ref|WP_011346442.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    214   4e-62    
ref|WP_030543976.1|  adenosylhomocysteinase                             214   4e-62    
ref|WP_010311525.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-62    
ref|WP_031421135.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-62    
ref|WP_014089407.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-62    
ref|WP_020676549.1|  hypothetical protein                               213   4e-62    
gb|EFI04196.1|  adenosylhomocysteinase                                  213   4e-62    
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-62    
ref|WP_016551225.1|  adenosylhomocysteinase                             213   5e-62    
ref|WP_034274048.1|  adenosylhomocysteinase                             214   5e-62    
ref|WP_029917627.1|  hypothetical protein                               213   5e-62    
ref|WP_018180991.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-62    
ref|WP_038614995.1|  S-adenosyl-L-homocysteine hydrolase                213   5e-62    
ref|WP_018762939.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-62    
ref|WP_006239887.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-62    
ref|WP_009083024.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-62    
ref|WP_015786997.1|  S-adenosyl-L-homocysteine hydrolase                213   6e-62    
gb|KGK58630.1|  S-adenosyl-L-homocysteine hydrolase                     213   6e-62    
ref|WP_010409859.1|  S-adenosyl-L-homocysteine hydrolase                212   6e-62    
ref|WP_039564728.1|  S-adenosyl-L-homocysteine hydrolase                213   6e-62    
ref|WP_012501941.1|  S-adenosyl-L-homocysteine hydrolase                213   6e-62    
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                213   6e-62    
ref|WP_019629152.1|  S-adenosyl-L-homocysteine hydrolase                213   6e-62    
ref|WP_037340993.1|  adenosylhomocysteinase                             213   6e-62    
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_008097775.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_036327944.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_010342174.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_027493191.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_014036003.1|  S-adenosyl-L-homocysteine hydrolase                213   7e-62    
ref|WP_004154241.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    213   8e-62    
ref|WP_043828422.1|  adenosylhomocysteinase                             213   8e-62    
ref|WP_037816606.1|  adenosylhomocysteinase                             213   8e-62    



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKTTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   316 bits (810),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPHYRY  485



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TG
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   308 bits (790),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  128  LEDVVSEGDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRIT  187

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  188  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERTSG  247

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  248  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  302



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   306 bits (785),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  117  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  176

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  177  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  236

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  237  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  291



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED+VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPHYRY  485



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPIEGPYKPAHYRY  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPHYRY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEVDIFVTTTGNKDIIMVEHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERETG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAHYRY  485



>gb|KJB72025.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=265

 Score =   305 bits (780),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  91   LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  150

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  151  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  210

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  211  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  265



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSKADIFVTTTGNKDIIMVHHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+PEQAAYIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTHYRY  485



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPHYRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPHYRY  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPG+KRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMQGLETYPGIKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TG
Sbjct  371  IKPQTDRWVFPETSTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVHYRY  485



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPHYRY  485



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  118  LEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  177

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  178  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  237

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  238  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPAAYRY  292



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +G
Sbjct  371  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +G
Sbjct  371  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLG+LGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KJB72026.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=345

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  171  LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  230

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  231  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  290

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  291  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  345



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVEHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   307 bits (787),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  234  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  293

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  294  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  353

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  354  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  408



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED+V+EADIFVTTTGNKDIIMVSHMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRIT
Sbjct  311  LEDMVAEADIFVTTTGNKDIIMVSHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   310 bits (794),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVV++ADI VTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVTDADILVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAHYRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT EQ+ YISIPVEGPYKPPHYRY
Sbjct  431  KYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPHYRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVV+EADIFVTTTGNKDIIMV HMK+MKNNAIVCNIGHFDNEIDM GLETYPG+KRIT
Sbjct  311  LEDVVAEADIFVTTTGNKDIIMVCHMKQMKNNAIVCNIGHFDNEIDMLGLETYPGIKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ TG
Sbjct  371  IKPQTDRWVFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYIS+PVEGPYKPP YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPRYRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAI+CNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  Q+ YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAHYRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED VSEADIFVTTTGNKDIIMV HM+KMKNNAI+ NIGHFDNEIDMHGLETYPGVKRIT
Sbjct  116  LEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIISNIGHFDNEIDMHGLETYPGVKRIT  175

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  176  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSG  235

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL  +Q+ YISIP+EGPYKP HYRY
Sbjct  236  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAHYRY  290



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  276  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  335

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  336  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  395

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  396  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  450



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  242  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  301

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TG
Sbjct  302  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATG  361

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  362  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  416



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVHHMKKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPHYRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPHYRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  190  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  249

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  250  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  309

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  310  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  364



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAI+CNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMQGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPHYRY  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIVVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+P QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAHYRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  266  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  325

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  326  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  385

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  386  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  440



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  96   LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  155

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQ DR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+G
Sbjct  156  IKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSG  215

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKV ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  216  KYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  270



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  90   LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  149

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  150  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  209

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  210  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  264



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERTTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE++TG
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YISIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAHYRY  485



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YISIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAHYRY  485



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  249  LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  308

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  309  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  368

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  369  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  423



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ YISIP++GPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPHYRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   301 bits (771),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI 
Sbjct  117  LEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRIN  176

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  177  IKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSG  236

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  237  KYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  291



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  117  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  176

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  177  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  236

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  237  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  291



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED+V+EADIFVTTTGNKDIIMVSHMK+MKNNA+VCNIGHFDNEIDM GLETYPG+KRIT
Sbjct  311  LEDMVAEADIFVTTTGNKDIIMVSHMKQMKNNAVVCNIGHFDNEIDMLGLETYPGIKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR++FPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERGSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDE V +LHLGKLGAKLTKLTP+QAAYIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEMVGSLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPHYRY  485



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMTKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGV+RIT
Sbjct  393  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVERIT  452

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+++G
Sbjct  453  IKPQTDRYVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERSSG  512

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+ VEGPYKP HYRY
Sbjct  513  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAHYRY  567



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQADYISVPVEGPYKPAHYRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETY GVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYAGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYRY  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVV+EADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDVVAEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAAYRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAHYRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  341  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  400

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  401  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  460

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  461  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAHYRY  515



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   306 bits (785),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV++EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLE  PGVKRIT
Sbjct  311  LEDVLAEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEILPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +G+I+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTNSGVIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQAAYIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAHYRY  485



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  276  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  335

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  336  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  395

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  396  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  450



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   305 bits (782),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  282  LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  341

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  342  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  401

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  402  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  456



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+S ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVLSTADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK+TG
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWTEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLVKLGAKLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   306 bits (785),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIVMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW+EK TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWREKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  485



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED +SEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDAISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+ELWKEK +G
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIELWKEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV++E DIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPG+KRIT
Sbjct  313  LEDVLAEGDIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGIKRIT  372

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDRFVFPETK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  373  IKPQTDRFVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  432

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  433  KYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAHYRY  487



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+L KL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLAKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVK+IT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLHYRY  485



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  293  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  352

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  353  IKPQTDRWVFPETKAGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  412

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+L KL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  413  KYEKKVYVLPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPHYRY  467



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            +EDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  IEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPHYRY  485



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPHYRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED+VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P++GPYKPPHYRY
Sbjct  431  KYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPHYRY  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM++MKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TG
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAAYRY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q  Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPHYRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAPLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKH DEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHFDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L+DVVSEADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRIT
Sbjct  293  LQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRIT  352

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  353  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  412

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  413  KYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  467



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  247
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L+DVVSEADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT
Sbjct  311  LKDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAHYRY  485



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PG KRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGAKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            I+PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IEPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAHYRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMK+NAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKSNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L+DVVS ADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKR  
Sbjct  311  LDDVVSVADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRTN  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLG+LGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVHYRY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  414  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  473

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  474  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  533

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YISIP+EGPYKP HYRY
Sbjct  534  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAHYRY  588



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDI+MV HM+KMKNNAIVCNIGHFDNEIDMHGLE +PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDILMVGHMRKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YI++P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAHYRY  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  305  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  364

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  365  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  424

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+PV+GPYKPPHYRY
Sbjct  425  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPHYRY  479



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L+DVVSEADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDMHGLE +PGVKRIT
Sbjct  311  LQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLENFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+K+VYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+PVEGPYKPPHYRY
Sbjct  431  KYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPHYRY  485



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  311  LEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSAYRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPVTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (779),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWSEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYR+
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRH  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   304 bits (778),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKV+VLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVHVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   304 bits (778),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   303 bits (775),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  276  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  335

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  336  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  395

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYKP  YRY
Sbjct  396  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKPAAYRY  450



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LGDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  247
            KYEKKVYVLPKHLDEKVAALHLGKLGA LTKLT +QA YIS+P+EGPYKPPHYR
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPHYR  484



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHL+EKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLNEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            +EDVVS+ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGV+RIT
Sbjct  311  IEDVVSDADIFVTTTGNKDIIMLEHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVQRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ EQA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAHYRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAHYRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSVADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETGTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QAAYI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAHYRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+  +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDISSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLD KVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDGKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEI MHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIGMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  314  LEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETHPGVKRIT  373

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  374  IKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  433

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  434  KYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFHYRY  488



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGVK+IT
Sbjct  311  LEDVVSDADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK++G
Sbjct  371  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLAYRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  271  LEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  330

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  331  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  390

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  391  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  445



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHG ET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGPETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ ELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVASEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK + 
Sbjct  371  IKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSS  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK  II+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKAEIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA LHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPHYRY  485



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDII+V HMKKMKNNAIVCNIGHFDNEIDM GLE YPGVKR+T
Sbjct  311  LEDVVSKADIFVTTTGNKDIIIVDHMKKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRVT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR++FPE +TGIIILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWIFPENETGIIILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLELWKEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT  QAAYI++PVEGPYKPPHYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPHYRY  485



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LWKEK+ G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLGLWKEKSIG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+L+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAHYRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            +EDVVS ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  IEDVVSTADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA LTKL+PEQAAYI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAHYRY  485



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVT TGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKR T
Sbjct  311  LEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRNT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK TG
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+K+VYVLPKHLDEKVA+LHLGKLGA LTKL+P+QA YI++P+EGPYKPP YRY
Sbjct  431  KYQKQVYVLPKHLDEKVASLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQYRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +G+I+LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGVIVLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT EQA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAHYRY  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDRFVFPET TGII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRFVFPETNTGIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLELWNERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            I PQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  ILPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKTSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   300 bits (767),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  252  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  311

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQ DR+VFPET TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLELWKEKN+G
Sbjct  312  IKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLELWKEKNSG  371

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKV ALHLGK GAKLTKLT  QA YI +P+EGPYK  HYRY
Sbjct  372  KYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAHYRY  426



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  373  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  432

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  433  IKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  492

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIPVEGPYKPPHYRY
Sbjct  493  KYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPHYRY  547



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGHYRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIM+ HMKKMKNNAIVCNIGHFDNEIDM GLET PGVKRI 
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLETCPGVKRIN  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  371  IKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKGSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVA+LHLG+LGA+LTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDM GLETYPGVKRIT
Sbjct  53   LEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRIT  112

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  113  IKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  172

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYV PKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  173  KYEKKVYVCPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS  DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSGIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK +G
Sbjct  371  IKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLG+LG KLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +QA YIS+ VEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTHYRY  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDMHGLET+PGVKRIT
Sbjct  311  LEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGK GAKLTKLT +QA YI +PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAHYRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -3

Query  765  EDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRITI  586
            +DVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRITI
Sbjct  313  DDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKRITI  372

Query  585  KPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTGK  406
            KPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++GK
Sbjct  373  KPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGK  432

Query  405  YEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            YEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  433  YEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  486



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSE DIFVTTTGNKDIIMVS M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAHYRY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS  DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSNVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+S+ADIFVTTTGNKDIIMV HMKKMKNNAIVCNIGHFDNEID+ GLETYPGVKRIT
Sbjct  311  LEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDVLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEK+TG
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLT+LT EQA YIS+  +GPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLHYRY  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVSYRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP +YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPANYRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LT+L+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTELSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   299 bits (766),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  333  LEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  392

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  393  IKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  452

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  453  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  507



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+L LGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVV EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVCEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMCGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYR  247
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+ EQA YIS+PVEGPYKP HYR
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAHYR  484



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+ EADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVLPEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKL+ +Q+ Y+SIP+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVHYRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (766),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYK   YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRLYRY  485



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   299 bits (765),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSIADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMAGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+N+G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERNSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (764),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGV+RIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVRRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   293 bits (750),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMVS MKKMKNNAIVCNIGHFDNEIDM GLETYPGV+RIT
Sbjct  153  LEDVVSEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLETYPGVQRIT  212

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  213  IKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  272

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+ +VYVLPKHLDEKVAALHLGKLGAKLT L+ +QA YI++PVEGPYKP +YRY
Sbjct  273  KYKNEVYVLPKHLDEKVAALHLGKLGAKLTVLSKDQADYINVPVEGPYKPLNYRY  327



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP++K+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDSKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI+ PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINAPVEGPYKPAQYRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIM  HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMADHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LED VSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAHYRY  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE++PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLESFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR VFP+T +GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLELWKE+ +G
Sbjct  371  IKPQTDRRVFPDTNSGILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLELWKERASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTP QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAHYRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFT+QVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTDQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRIT
Sbjct  311  LNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVT TGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAHYRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMVS M+KMKNNAIV NIGHFDNEIDMHGLET+P VKRIT
Sbjct  311  LNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLETFPDVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YIS+P+EGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAHYRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFD+EIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDSEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQYRY  485



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  276  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  335

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  336  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  395

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PV+GPYKP HYRY
Sbjct  396  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAHYRY  450



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTG+KDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGSKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LE+VVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LENVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGH DNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHLDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKD+IMVS MK+MKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSVADIFVTTTGNKDVIMVSDMKRMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK +G
Sbjct  371  IKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKASG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKLT EQA YIS+P+EGPYKP  YRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAAYRY  485



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   297 bits (760),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYV PKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVSPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDI+M+ HM+KMKNNAIVCNIGHFDNEID+ GLE +PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIVMLDHMRKMKNNAIVCNIGHFDNEIDIQGLENFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGAKLTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIF TTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPK LDEKVAALHLGKLGA+LTKLT +Q+ Y+SIPVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVHYRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIM+ HM+K+KNNAIVCNIGHFDNEIDM GLET+PGVK+IT
Sbjct  311  LEDVVSTADIFVTTTGNKDIIMLDHMRKIKNNAIVCNIGHFDNEIDMQGLETFPGVKKIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHL KLGA+LTKL+P+QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAHYRY  485



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSC FTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCLFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLVLWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL LW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLVLWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   296 bits (759),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS ADIFVTTTGNKDIIMV  MKKMKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  311  LEDVVSYADIFVTTTGNKDIIMVDDMKKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR++FPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWLFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV  MK+MKNNAIVCNIGHFDNEIDM GLE YPGVKRIT
Sbjct  400  LEDVLSEADIFVTTTGNKDIIMVDQMKRMKNNAIVCNIGHFDNEIDMQGLENYPGVKRIT  459

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  460  IKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  519

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ YISIPVEGPYKPPHYRY
Sbjct  520  KYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPHYRY  574



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDV+SEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVISEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++P+EGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPIEGPYKPAQYRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   296 bits (758),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L DVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LVDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNE+DM GLET+PGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEVDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGH SFVMSCSFTNQVIAQLELW E+ TG
Sbjct  371  IKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHSSFVMSCSFTNQVIAQLELWNERKTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYE+KVYVLPKHLDEKVA+LHLGKLGA+LTKL+ +QA YI++PVEGPYKP  YRY
Sbjct  431  KYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQYRY  485



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVSEADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLETYPGVKRIT
Sbjct  311  LEDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMLGLETYPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPETK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TG
Sbjct  371  IKPQTDRWVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKGTG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KY+K+VYVLPKHLDEKVAALHLGKLGAKLTKLT +Q+ Y+SIP+EGPYKP  YRY
Sbjct  431  KYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYLSIPIEGPYKPAAYRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            L+DVVS ADIFVTTTGNKDIIMV  M+KMKNNAIVCNIGHFDNEIDM GLE YPGVKR+T
Sbjct  311  LDDVVSYADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLENYPGVKRVT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW E+ +G
Sbjct  371  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNERKSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+  QA YIS+PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAHYRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVV++ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLET+PGVKRIT
Sbjct  311  LEDVVADADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRIT  370

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLELW EK++G
Sbjct  371  IKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLELWNEKSSG  430

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKL+ +QA YI++PVEGPYKP HYRY
Sbjct  431  KYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVHYRY  485



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  768  LEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMHGLETYPGVKRIT  589
            LEDVVS+ADIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM+GLETYPGVKRIT
Sbjct  578  LEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLETYPGVKRIT  637

Query  588  IKPQTDRFVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKNTG  409
            IKPQTDR+VFPET TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EK TG
Sbjct  638  IKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKATG  697

Query  408  KYEKKVYVLPKHLDEKVaalhlgklgakltklTPEQAAYISIPVEGPYKPPHYRY  244
            KYEKKVYVLPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIPV+GPYKP  YRY
Sbjct  698  KYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAAYRY  752



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100