BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014I14

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081977.1|  PREDICTED: glycerol kinase                         220   6e-64   Sesamum indicum [beniseed]
emb|CDO98178.1|  unnamed protein product                                218   2e-63   Coffea canephora [robusta coffee]
ref|XP_011073388.1|  PREDICTED: glycerol kinase-like                    216   2e-62   Sesamum indicum [beniseed]
ref|XP_008461141.1|  PREDICTED: glycerol kinase                         215   4e-62   Cucumis melo [Oriental melon]
gb|EYU21675.1|  hypothetical protein MIMGU_mgv1a019703mg                215   4e-62   Erythranthe guttata [common monkey flower]
ref|XP_007023294.1|  Actin-like ATPase superfamily protein isoform 1    214   6e-62   
ref|XP_004135863.1|  PREDICTED: glycerol kinase-like                    211   1e-60   Cucumis sativus [cucumbers]
ref|XP_002273367.1|  PREDICTED: glycerol kinase                         210   3e-60   Vitis vinifera
emb|CAN76048.1|  hypothetical protein VITISV_037711                     210   3e-60   Vitis vinifera
ref|XP_010654824.1|  PREDICTED: glycerol kinase-like                    197   6e-60   
gb|AIT39761.1|  glycerol kinase                                         207   4e-59   Chrysanthemum boreale
ref|XP_010063499.1|  PREDICTED: glycerol kinase                         205   2e-58   Eucalyptus grandis [rose gum]
ref|XP_004303284.1|  PREDICTED: glycerol kinase-like                    205   2e-58   Fragaria vesca subsp. vesca
ref|XP_010033977.1|  PREDICTED: glycerol kinase-like                    204   4e-58   
ref|XP_004235901.1|  PREDICTED: glycerol kinase                         204   7e-58   Solanum lycopersicum
ref|XP_009758692.1|  PREDICTED: glycerol kinase                         203   1e-57   Nicotiana sylvestris
ref|XP_009593517.1|  PREDICTED: glycerol kinase                         202   2e-57   Nicotiana tomentosiformis
ref|XP_009334628.1|  PREDICTED: glycerol kinase-like                    200   2e-56   Pyrus x bretschneideri [bai li]
ref|XP_008372701.1|  PREDICTED: glycerol kinase                         200   2e-56   Malus domestica [apple tree]
gb|EPS68115.1|  hypothetical protein M569_06657                         199   3e-56   Genlisea aurea
ref|XP_006341400.1|  PREDICTED: glycerol kinase-like                    199   4e-56   Solanum tuberosum [potatoes]
ref|XP_009336317.1|  PREDICTED: glycerol kinase-like                    199   7e-56   Pyrus x bretschneideri [bai li]
gb|KJB66376.1|  hypothetical protein B456_010G138000                    194   1e-55   Gossypium raimondii
ref|XP_010691126.1|  PREDICTED: glycerol kinase                         197   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250262.1|  PREDICTED: glycerol kinase-like                    197   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006302137.1|  hypothetical protein CARUB_v10020141mg             196   5e-55   Capsella rubella
gb|KHG30375.1|  Glycerol kinase                                         196   8e-55   Gossypium arboreum [tree cotton]
ref|XP_010472924.1|  PREDICTED: glycerol kinase-like isoform X1         195   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006389795.1|  hypothetical protein EUTSA_v10018399mg             195   2e-54   Eutrema salsugineum [saltwater cress]
gb|KJB66375.1|  hypothetical protein B456_010G138000                    194   3e-54   Gossypium raimondii
emb|CDX67948.1|  BnaA07g19880D                                          194   3e-54   
emb|CDY37598.1|  BnaA02g19720D                                          194   4e-54   Brassica napus [oilseed rape]
ref|XP_009104463.1|  PREDICTED: glycerol kinase                         194   4e-54   
ref|XP_002887828.1|  At1g80460                                          194   4e-54   
gb|ABK32113.1|  At1g80460                                               194   4e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79385.1|  BnaC06g19180D                                          194   5e-54   
emb|CDY39977.1|  BnaC06g40550D                                          194   5e-54   Brassica napus [oilseed rape]
ref|XP_010417705.1|  PREDICTED: glycerol kinase-like                    193   6e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010429953.1|  PREDICTED: glycerol kinase                         193   6e-54   Camelina sativa [gold-of-pleasure]
emb|CDX87311.1|  BnaA07g35620D                                          193   7e-54   
ref|XP_009106746.1|  PREDICTED: glycerol kinase-like                    193   7e-54   Brassica rapa
ref|XP_007215813.1|  hypothetical protein PRUPE_ppa004097mg             193   9e-54   
ref|NP_178161.1|  glycerol kinase                                       192   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228677.1|  PREDICTED: glycerol kinase                         190   9e-53   Prunus mume [ume]
ref|XP_006385291.1|  glycerol kinase family protein                     190   1e-52   
ref|XP_011044862.1|  PREDICTED: glycerol kinase                         190   1e-52   Populus euphratica
emb|CBI36374.3|  unnamed protein product                                176   1e-51   Vitis vinifera
gb|KDO47427.1|  hypothetical protein CISIN_1g0098681mg                  186   1e-51   Citrus sinensis [apfelsine]
gb|KDP37048.1|  hypothetical protein JCGZ_06104                         187   2e-51   Jatropha curcas
gb|ABR26079.1|  glycerol kinase                                         177   2e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006492058.1|  PREDICTED: glycerol kinase-like                    186   3e-51   Citrus sinensis [apfelsine]
ref|XP_006427440.1|  hypothetical protein CICLE_v10025360mg             186   3e-51   Citrus clementina [clementine]
ref|XP_006427437.1|  hypothetical protein CICLE_v10025756mg             182   1e-50   
gb|AAR88660.1|  glycerol kinase                                         185   1e-50   Pandanus amaryllifolius [pandan rampeh]
ref|XP_002517681.1|  glycerol kinase, putative                          184   1e-50   Ricinus communis
ref|XP_010244913.1|  PREDICTED: glycerol kinase-like                    184   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008779159.1|  PREDICTED: glycerol kinase-like isoform X1         181   8e-50   Phoenix dactylifera
ref|XP_008779160.1|  PREDICTED: glycerol kinase-like isoform X2         181   2e-49   Phoenix dactylifera
ref|XP_006442413.1|  hypothetical protein CICLE_v10020202mg             178   5e-49   
ref|XP_006652916.1|  PREDICTED: glycerol kinase-like                    179   2e-48   Oryza brachyantha
ref|XP_010097187.1|  Glycerol kinase                                    179   2e-48   Morus notabilis
gb|KFK42437.1|  hypothetical protein AALP_AA2G256400                    179   2e-48   Arabis alpina [alpine rockcress]
emb|CAJ86056.1|  H0821G03.7                                             179   2e-48   Oryza sativa [red rice]
ref|XP_009407371.1|  PREDICTED: glycerol kinase                         179   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054071.1|  Os04g0647800                                       176   2e-47   
ref|XP_010537930.1|  PREDICTED: glycerol kinase                         176   2e-47   Tarenaya hassleriana [spider flower]
gb|AAR18687.1|  glycerol kinase-like protein                            176   2e-47   Oryza sativa Japonica Group [Japonica rice]
gb|KHN01314.1|  Putative glycerol kinase                                176   2e-47   Glycine soja [wild soybean]
ref|NP_001237303.1|  glycerol kinase                                    176   2e-47   
ref|XP_003580683.1|  PREDICTED: glycerol kinase                         175   4e-47   Brachypodium distachyon [annual false brome]
ref|XP_006442415.1|  hypothetical protein CICLE_v10024258mg             172   4e-47   
gb|AGH08245.1|  glycerol kinase                                         175   4e-47   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001132106.2|  uncharacterized protein LOC100193522               175   5e-47   Zea mays [maize]
ref|XP_004977029.1|  PREDICTED: glycerol kinase-like                    175   5e-47   Setaria italica
ref|XP_003533071.2|  PREDICTED: glycerol kinase-like                    164   8e-47   Glycine max [soybeans]
gb|EMT01355.1|  Putative glycerol kinase                                175   9e-47   
gb|KDO41571.1|  hypothetical protein CISIN_1g046958mg                   171   3e-46   Citrus sinensis [apfelsine]
gb|EMS68114.1|  Glycerol kinase                                         171   5e-46   Triticum urartu
ref|XP_002448637.1|  hypothetical protein SORBIDRAFT_06g030600          171   8e-46   Sorghum bicolor [broomcorn]
ref|XP_007135771.1|  hypothetical protein PHAVU_010G157400g             171   8e-46   Phaseolus vulgaris [French bean]
ref|XP_010907017.1|  PREDICTED: glycerol kinase                         169   5e-45   Elaeis guineensis
ref|XP_003604353.1|  Glycerol kinase                                    164   3e-43   Medicago truncatula
ref|XP_004506960.1|  PREDICTED: glycerol kinase-like                    162   2e-42   Cicer arietinum [garbanzo]
ref|XP_008795833.1|  PREDICTED: glycerol kinase-like                    162   3e-42   Phoenix dactylifera
ref|XP_010913342.1|  PREDICTED: glycerol kinase-like                    155   6e-40   Elaeis guineensis
ref|XP_006852853.1|  hypothetical protein AMTR_s00033p00197360          152   8e-39   
gb|ABK24550.1|  unknown                                                 149   7e-38   Picea sitchensis
gb|KEH28675.1|  glycerol kinase-like protein                            148   2e-37   Medicago truncatula
gb|ABK25673.1|  unknown                                                 148   2e-37   Picea sitchensis
ref|XP_002985935.1|  hypothetical protein SELMODRAFT_123030             139   4e-34   Selaginella moellendorffii
ref|XP_002984877.1|  hypothetical protein SELMODRAFT_121015             139   5e-34   Selaginella moellendorffii
ref|XP_001763943.1|  predicted protein                                  138   7e-34   
gb|KHN38002.1|  Glycerol kinase                                         121   1e-30   Glycine soja [wild soybean]
gb|KDO39537.1|  hypothetical protein CISIN_1g0368922mg                  102   3e-23   Citrus sinensis [apfelsine]
ref|XP_007023296.1|  Actin-like ATPase superfamily protein isoform 3    105   2e-22   
ref|XP_007023295.1|  Actin-like ATPase superfamily protein isoform 2    105   2e-22   
emb|CDY72493.1|  BnaCnng77930D                                          102   2e-22   Brassica napus [oilseed rape]
emb|CDY03893.1|  BnaC07g11180D                                          101   3e-22   
gb|KDO47430.1|  hypothetical protein CISIN_1g036432mg                 97.1    7e-22   Citrus sinensis [apfelsine]
emb|CDY03995.1|  BnaC02g37100D                                        99.0    2e-21   
ref|WP_020538754.1|  glycerol kinase                                    102   3e-21   Lewinella cohaerens
ref|WP_009289239.1|  MULTISPECIES: glycerol kinase                      101   7e-21   Anaerostipes
ref|WP_006567424.1|  glycerol kinase                                    101   7e-21   Anaerostipes caccae
ref|WP_041694822.1|  glycerol kinase                                    100   9e-21   Alicyclobacillus acidocaldarius
ref|XP_003288686.1|  hypothetical protein DICPUDRAFT_34436              101   1e-20   Dictyostelium purpureum
gb|AEJ42051.1|  glycerol kinase                                         100   1e-20   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
ref|WP_040288263.1|  glycerol kinase                                    100   1e-20   
gb|EJY57173.1|  glycerol kinase                                         100   1e-20   Alicyclobacillus hesperidum URH17-3-68
ref|WP_030528182.1|  glycerol kinase                                    100   2e-20   Intrasporangiaceae
ref|WP_034782288.1|  glycerol kinase                                  96.3    2e-20   
ref|XP_002951253.1|  hypothetical protein VOLCADRAFT_91722              100   2e-20   Volvox carteri f. nagariensis
ref|WP_013824342.1|  glycerol kinase                                  99.8    3e-20   
ref|WP_040860438.1|  glycerol kinase                                  99.8    3e-20   Nocardia niigatensis
ref|WP_026960945.1|  glycerol kinase                                  99.8    3e-20   Alicyclobacillus herbarius
ref|WP_018267275.1|  glycerol kinase                                  99.4    3e-20   Methylosinus sp. LW4
ref|WP_033086797.1|  glycerol kinase                                  99.4    4e-20   Nocardia seriolae
ref|XP_005851284.1|  hypothetical protein CHLNCDRAFT_18995            99.4    4e-20   Chlorella variabilis
ref|WP_027488741.1|  glycerol kinase                                  99.0    5e-20   Rhizobium undicola
ref|WP_018085303.1|  glycerol kinase                                  98.6    7e-20   Desulfurispora thermophila
ref|XP_003056322.1|  predicted protein                                99.0    7e-20   Micromonas pusilla CCMP1545
ref|XP_641267.1|  hypothetical protein DDB_G0280371                   99.0    7e-20   Dictyostelium discoideum AX4
emb|CAN60752.1|  hypothetical protein VITISV_031768                   94.4    9e-20   Vitis vinifera
ref|WP_012809514.1|  glycerol kinase                                  98.2    1e-19   Alicyclobacillus acidocaldarius
ref|WP_028239012.1|  glycerol kinase                                  98.2    1e-19   Pseudomonas azotifigens
ref|WP_014400151.1|  glycerol kinase                                  97.8    1e-19   Corallococcus coralloides
gb|EFA75245.1|  Glycerol kinase 2                                     97.8    1e-19   Heterostelium album PN500
ref|WP_037022450.1|  glycerol kinase                                  97.8    1e-19   Pseudomonas saudiphocaensis
ref|WP_025845445.1|  glycerol kinase                                  97.8    1e-19   Paenibacillus ehimensis
ref|WP_028052024.1|  glycerol kinase                                  97.4    2e-19   Carboxydothermus ferrireducens
ref|WP_011344733.1|  glycerol kinase                                  97.4    2e-19   Carboxydothermus hydrogenoformans
ref|WP_040732517.1|  glycerol kinase                                  97.4    2e-19   Nocardia tenerifensis
ref|WP_041059389.1|  glycerol kinase                                  97.1    2e-19   Cohnella kolymensis
ref|WP_019045228.1|  MULTISPECIES: glycerol kinase                    97.1    2e-19   Actinobacteria
gb|EGL82842.1|  Carbohydrate kinase, FGGY                             91.3    2e-19   Caldalkalibacillus thermarum TA2.A1
ref|WP_024728558.1|  glycerol kinase                                  97.1    2e-19   Anaerostipes sp. BG01
gb|KHF78769.1|  Glycerol kinase                                       97.1    2e-19   Acinetobacter sp. neg1
ref|WP_023461610.1|  glycerol kinase                                  97.1    3e-19   Asticcacaulis sp. YBE204
ref|WP_005259085.1|  glycerol kinase 1                                97.1    3e-19   Acinetobacter sp. NIPH 2168
ref|WP_004770367.1|  glycerol kinase 1                                97.1    3e-19   Acinetobacter sp. NIPH 758
ref|WP_005231833.1|  MULTISPECIES: glycerol kinase 1                  97.1    3e-19   Acinetobacter
ref|WP_018592342.1|  glycerol kinase                                  97.1    3e-19   Terrisporobacter glycolicus
ref|WP_029872306.1|  glycerol kinase                                  96.7    3e-19   Rhizobium leguminosarum
ref|WP_027676630.1|  glycerol kinase                                  96.7    3e-19   Agrobacterium larrymoorei
ref|WP_021899791.1|  glycerol kinase                                  96.7    3e-19   
ref|WP_036991283.1|  glycerol kinase                                  92.0    3e-19   
ref|WP_025028478.1|  glycerol kinase                                  96.7    3e-19   Bacillus mannanilyticus
ref|WP_035625622.1|  glycerol kinase                                  96.7    3e-19   Lachnospiraceae bacterium C6A11
ref|WP_027508274.1|  glycerol kinase                                  96.7    4e-19   Rhizobium sullae
gb|EHY77295.1|  glycerol kinase                                       92.0    4e-19   Pseudomonas stutzeri ATCC 14405 = CCUG 16156
ref|WP_008337869.1|  glycerol kinase                                  96.3    4e-19   Alicyclobacillus acidocaldarius
ref|WP_042264218.1|  glycerol kinase                                  96.3    5e-19   Nocardia brasiliensis
ref|WP_004652021.1|  glycerol kinase 1                                96.3    5e-19   Acinetobacter
ref|WP_024878177.1|  glycerol kinase                                  95.9    5e-19   Methylosinus
ref|WP_016541215.1|  Glycerol kinase                                  95.9    5e-19   Acinetobacter gyllenbergii
ref|WP_005296128.1|  glycerol kinase 1                                95.9    5e-19   Acinetobacter sp. NIPH 2100
ref|XP_006302136.1|  hypothetical protein CARUB_v10020141mg           95.5    5e-19   
ref|WP_013549579.1|  glycerol kinase                                  95.9    6e-19   Cellulophaga algicola
ref|WP_036687373.1|  glycerol kinase                                  95.9    6e-19   Paenibacillus
ref|WP_025242527.1|  glycerol kinase                                  95.5    7e-19   Pseudomonas stutzeri
ref|WP_036584799.1|  glycerol kinase                                  95.5    7e-19   Paenibacillus darwinianus
ref|WP_009610750.1|  glycerol kinase                                  95.5    7e-19   Caldanaerobacter subterraneus
ref|WP_022587917.1|  glycerol kinase                                  95.5    7e-19   Caldanaerobacter subterraneus
ref|WP_018326861.1|  glycerol kinase                                  95.5    7e-19   Rhizobium giardinii
ref|WP_034666258.1|  glycerol kinase                                  95.5    7e-19   Cellulophaga sp. E6(2014)
ref|WP_043663224.1|  glycerol kinase                                  95.5    7e-19   Nocardia vulneris
ref|WP_033429062.1|  glycerol kinase                                  95.5    7e-19   Saccharothrix syringae
ref|WP_035945306.1|  hypothetical protein                             90.9    7e-19   
ref|WP_029901568.1|  glycerol kinase                                  95.5    7e-19   Nocardia brasiliensis
ref|WP_018133536.1|  glycerol kinase                                  95.5    8e-19   Effusibacillus pohliae
ref|WP_014982240.1|  glycerol kinase                                  95.5    8e-19   Nocardia brasiliensis
ref|WP_042617374.1|  glycerol kinase                                  95.5    8e-19   Agrobacterium tumefaciens
ref|WP_038341960.1|  glycerol kinase                                  95.5    8e-19   Acinetobacter sp. A47
ref|WP_005243524.1|  MULTISPECIES: glycerol kinase                    95.5    9e-19   Acinetobacter
ref|WP_016651637.1|  glycerol kinase 1                                95.5    9e-19   Acinetobacter
ref|WP_042846678.1|  glycerol kinase                                  95.5    1e-18   Providencia rettgeri
ref|WP_014445904.1|  glycerol kinase                                  95.1    1e-18   Actinoplanes missouriensis
ref|WP_005269757.1|  glycerol kinase 1                                95.1    1e-18   Acinetobacter colistiniresistens
ref|WP_027888454.1|  glycerol kinase                                  95.1    1e-18   Meiothermus taiwanensis
ref|WP_018880210.1|  glycerol kinase                                  95.1    1e-18   Thioalkalivibrio sp. ALE9
ref|WP_004801481.1|  glycerol kinase 1                                95.1    1e-18   Acinetobacter sp. CIP 56.2
ref|WP_005202079.1|  MULTISPECIES: glycerol kinase 1                  95.1    1e-18   Acinetobacter
ref|WP_005144845.1|  MULTISPECIES: glycerol kinase 1                  95.1    1e-18   Acinetobacter
ref|WP_040752000.1|  glycerol kinase                                  95.1    1e-18   Nocardia transvalensis
ref|WP_039846864.1|  glycerol kinase                                  95.1    1e-18   
ref|WP_040775205.1|  glycerol kinase                                  95.1    1e-18   Nocardia pneumoniae
ref|WP_021860355.1|  glycerol kinase                                  95.1    1e-18   
ref|WP_034270380.1|  glycerol kinase                                  95.1    1e-18   Amycolatopsis halophila
ref|WP_022514753.1|  glycerol kinase                                  94.7    1e-18   
ref|WP_002442632.1|  glycerol kinase                                  94.7    1e-18   Staphylococcus
ref|WP_026599807.1|  glycerol kinase                                  94.7    1e-18   Methylocystis sp. LW5
ref|WP_027882694.1|  glycerol kinase                                  94.7    1e-18   Meiothermus rufus
ref|WP_031173082.1|  glycerol kinase                                  89.7    2e-18   
ref|WP_002491397.1|  glycerol kinase                                  94.7    2e-18   Staphylococcus
ref|WP_034336705.1|  glycerol kinase                                  94.7    2e-18   Deinococcus misasensis
ref|WP_014187637.1|  glycerol kinase                                  94.7    2e-18   Desulfosporosinus orientis
ref|WP_005620047.1|  glycerol kinase                                  94.7    2e-18   Pseudomonas avellanae
ref|WP_030104795.1|  glycerol kinase                                  94.7    2e-18   Actinoalloteichus cyanogriseus
ref|WP_026419357.1|  glycerol kinase                                  94.7    2e-18   Actinoalloteichus
ref|XP_006389796.1|  hypothetical protein EUTSA_v10018399mg           94.0    2e-18   
ref|WP_014853593.1|  glycerol kinase                                  94.4    2e-18   Pseudomonas stutzeri
ref|WP_004265295.1|  glycerol kinase                                  94.4    2e-18   Providencia rettgeri
ref|WP_025428008.1|  glycerol kinase                                  94.4    2e-18   Ensifer
gb|KGS12834.1|  glycerol kinase                                       93.2    2e-18   Pseudomonas coronafaciens
ref|WP_018880584.1|  glycerol kinase                                  94.4    2e-18   Thioalkalivibrio sp. ALE30
ref|WP_044198816.1|  glycerol kinase                                  94.0    2e-18   Hyalangium minutum
ref|WP_002476673.1|  glycerol kinase                                  94.0    2e-18   Staphylococcus epidermidis
gb|ENW19110.1|  glycerol kinase 1                                     92.8    2e-18   Acinetobacter haemolyticus NIPH 261
ref|WP_002473610.1|  glycerol kinase                                  94.0    2e-18   Staphylococcus epidermidis
ref|WP_013777682.1|  glycerol kinase                                  94.0    2e-18   Tepidanaerobacter acetatoxydans
ref|WP_035375252.1|  glycerol kinase                                  92.8    3e-18   
ref|WP_028739490.1|  glycerol kinase                                  94.0    3e-18   Rhizobium mongolense
ref|WP_019558077.1|  glycerol kinase                                  94.0    3e-18   Thioalkalivibrio sp. ALE12
ref|WP_013767675.1|  glycerol kinase                                  94.0    3e-18   Haliscomenobacter hydrossis
ref|WP_037127087.1|  glycerol kinase                                  94.0    3e-18   Rhizobium sp. CF097
ref|WP_024637957.1|  hypothetical protein                             90.1    3e-18   
emb|CBI25161.3|  unnamed protein product                              86.7    3e-18   Vitis vinifera
ref|XP_785650.3|  PREDICTED: glycerol kinase-like                     94.0    3e-18   
ref|WP_039799920.1|  glycerol kinase                                  94.0    3e-18   Nocardia araoensis
ref|WP_034048000.1|  glycerol kinase                                  90.1    3e-18   
ref|WP_043623789.1|  glycerol kinase                                  93.6    3e-18   Ensifer sp. ZNC0028
ref|WP_018882042.1|  MULTISPECIES: glycerol kinase                    93.6    3e-18   Thioalkalivibrio
ref|WP_015517270.1|  glycerol kinase                                  93.6    3e-18   [Eubacterium] rectale
ref|WP_005055194.1|  glycerol kinase 1                                93.6    3e-18   Acinetobacter beijerinckii
ref|WP_014692584.1|  glycerol kinase                                  93.6    3e-18   Actinoplanes
ref|XP_002500482.1|  predicted protein                                94.0    3e-18   Micromonas commoda
ref|WP_043688472.1|  glycerol kinase                                  93.6    4e-18   Nocardia abscessus
ref|WP_014905211.1|  glycerol kinase                                  93.6    4e-18   Desulfosporosinus meridiei
dbj|GAK59206.1|  glycerol kinase 2                                    93.6    4e-18   Candidatus Vecturithrix granuli
ref|WP_011426358.1|  glycerol kinase                                  93.6    4e-18   Rhizobium etli
ref|WP_017965422.1|  glycerol kinase                                  93.6    4e-18   Rhizobium leguminosarum
ref|WP_028478492.1|  glycerol kinase                                  93.6    4e-18   Nocardia sp. CNY236
ref|WP_020921972.1|  glycerol kinase 2                                93.6    4e-18   Rhizobium etli
ref|WP_004396510.1|  glycerol kinase                                  93.6    4e-18   Pseudomonas syringae
ref|WP_014829396.1|  glycerol kinase                                  93.6    4e-18   Desulfosporosinus acidiphilus
ref|WP_027736969.1|  glycerol kinase                                  93.6    4e-18   Streptomyces sp. CNT360
ref|WP_020051183.1|  glycerol kinase                                  93.6    4e-18   Rhizobium leguminosarum
ref|WP_014757439.1|  MULTISPECIES: glycerol kinase                    93.6    4e-18   Thermoanaerobacterium aotearoense
ref|WP_033441033.1|  glycerol kinase                                  93.6    4e-18   Saccharothrix sp. NRRL B-16314
ref|WP_028483991.1|  glycerol kinase                                  93.6    4e-18   Thioalkalivibrio sp. ALE17
ref|WP_005889324.1|  MULTISPECIES: glycerol kinase                    93.6    4e-18   Pseudomonas syringae group
ref|WP_010315712.1|  glycerol kinase                                  93.2    4e-18   Saccharopolyspora spinosa
ref|WP_026273704.1|  glycerol kinase                                  92.4    4e-18   
ref|WP_019340977.1|  glycerol kinase                                  93.2    4e-18   Pseudomonas stutzeri
ref|WP_036293668.1|  glycerol kinase                                  93.2    4e-18   Methylosinus sp. PW1
ref|WP_019333936.1|  glycerol kinase                                  93.2    4e-18   Pseudomonas syringae
ref|WP_005764834.1|  MULTISPECIES: glycerol kinase                    93.2    4e-18   Pseudomonas
ref|WP_016698736.1|  glycerol kinase                                  93.2    4e-18   Actinoalloteichus spitiensis
ref|WP_027683508.1|  glycerol kinase                                  93.2    5e-18   Rhizobium leguminosarum
ref|WP_018877452.1|  glycerol kinase                                  93.2    5e-18   Thioalkalivibrio sp. ALE28
ref|WP_026955253.1|  glycerol kinase                                  93.2    5e-18   Algoriphagus vanfongensis
ref|WP_018824072.1|  glycerol kinase                                  92.4    5e-18   
ref|WP_022345959.1|  glycerol kinase 2                                93.2    5e-18   
ref|WP_024319477.1|  glycerol kinase                                  93.2    5e-18   Rhizobium leguminosarum
ref|WP_005739144.1|  MULTISPECIES: glycerol kinase                    93.2    5e-18   Pseudomonas syringae group
ref|WP_018866964.1|  MULTISPECIES: glycerol kinase                    93.2    5e-18   Thioalkalivibrio
ref|WP_002611785.1|  glycerol kinase                                  93.2    5e-18   Stigmatella aurantiaca
ref|WP_017702524.1|  glycerol kinase                                  93.2    5e-18   Pseudomonas syringae
ref|WP_013306039.1|  glycerol kinase                                  93.2    5e-18   Maribacter sp. HTCC2170
ref|WP_009579971.1|  Glycerol kinase                                  93.2    5e-18   Fulvivirga imtechensis
ref|WP_018875542.1|  glycerol kinase                                  93.2    5e-18   Thioalkalivibrio sp. ALE31
ref|WP_019583903.1|  glycerol kinase                                  93.2    5e-18   Thioalkalivibrio sp. ALE16
ref|WP_015805093.1|  glycerol kinase                                  93.2    5e-18   Actinosynnema
ref|WP_037266528.1|  glycerol kinase                                  93.2    5e-18   Kibdelosporangium aridum
ref|WP_006663187.1|  glycerol kinase                                  93.2    5e-18   Providencia alcalifaciens
ref|WP_011366544.1|  glycerol kinase                                  93.2    5e-18   Desulfovibrio alaskensis
ref|WP_029544063.1|  glycerol kinase                                  93.2    5e-18   Selenomonas ruminantium
ref|WP_006816276.1|  glycerol kinase                                  93.2    5e-18   Providencia rustigianii
ref|WP_014078702.1|  glycerol kinase                                  93.2    5e-18   Roseburia hominis
ref|WP_025395536.1|  glycerol kinase                                  93.2    5e-18   Rhizobium leguminosarum
ref|WP_039591739.1|  glycerol kinase                                  93.2    6e-18   Pseudomonas frederiksbergensis
ref|WP_006660520.1|  glycerol kinase                                  93.2    6e-18   Providencia alcalifaciens
ref|WP_037040600.1|  glycerol kinase                                  93.2    6e-18   Pseudomonas
ref|WP_015528416.1|  glycerol kinase [                                92.8    6e-18   
ref|WP_018073879.1|  glycerol kinase                                  92.8    6e-18   Rhizobium leguminosarum
ref|WP_042181713.1|  glycerol kinase                                  92.8    6e-18   Kibdelosporangium sp. MJ126-NF4
ref|WP_023012998.1|  glycerol kinase                                  92.8    6e-18   Acinetobacter sp. COS3
ref|WP_019543021.1|  glycerol kinase                                  92.8    6e-18   Selenomonas bovis
ref|WP_034056159.1|  glycerol kinase                                  90.1    6e-18   
ref|WP_004878344.1|  glycerol kinase 1                                92.8    6e-18   Acinetobacter venetianus
ref|WP_007481743.1|  glycerol kinase                                  92.8    6e-18   
ref|WP_013787284.1|  glycerol kinase                                  92.8    6e-18   
ref|WP_043523415.1|  glycerol kinase                                  92.8    6e-18   
ref|WP_041106526.1|  glycerol kinase                                  92.8    6e-18   
ref|WP_002501856.1|  glycerol kinase                                  92.8    6e-18   
emb|CDC15143.1|  glycerol kinase                                      92.8    6e-18   
ref|WP_002439580.1|  MULTISPECIES: glycerol kinase                    92.8    6e-18   
ref|WP_002487415.1|  glycerol kinase                                  92.8    6e-18   
ref|WP_042648341.1|  glycerol kinase                                  92.8    7e-18   
emb|CEL13600.1|  Glycerol kinase                                      92.8    7e-18   
ref|WP_043220993.1|  glycerol kinase                                  92.8    7e-18   
gb|EGH79681.1|  glycerol kinase                                       92.8    7e-18   
ref|WP_030435889.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_010497592.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_002489950.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_002446325.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_014044407.1|  MULTISPECIES: glycerol kinase                    92.8    7e-18   
gb|EGH29981.1|  glycerol kinase                                       92.8    7e-18   
gb|AHX61794.1|  glycerol kinase                                       92.8    7e-18   
ref|WP_005081717.1|  MULTISPECIES: glycerol kinase                    92.8    7e-18   
ref|WP_041206102.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_009794678.1|  MULTISPECIES: glycerol kinase                    92.8    7e-18   
ref|WP_024639295.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_032656781.1|  glycerol kinase                                  92.8    7e-18   
dbj|BAP78835.1|  glycerol kinase                                      92.8    7e-18   
ref|WP_044324397.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_003405430.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_024647072.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_003363615.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_002554859.1|  MULTISPECIES: glycerol kinase                    92.8    7e-18   
ref|WP_004638301.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_044344449.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_019741517.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_043607522.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_043297199.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_002476023.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_020361212.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_007248746.1|  glycerol kinase                                  92.8    7e-18   
gb|KDD76694.1|  FGGY carbohydrate kinase                              92.8    7e-18   
ref|WP_034788970.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_017245762.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_011912765.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_011169329.1|  glycerol kinase                                  92.8    7e-18   
ref|WP_004658188.1|  MULTISPECIES: glycerol kinase                    92.8    8e-18   
ref|WP_005755456.1|  glycerol kinase                                  92.8    8e-18   
ref|WP_044319425.1|  glycerol kinase                                  92.8    8e-18   
gb|ERE64354.1|  hypothetical protein N036_38855                       91.3    8e-18   
ref|WP_014596337.1|  glycerol kinase                                  92.8    8e-18   
ref|WP_031544502.1|  glycerol kinase                                  92.4    8e-18   
ref|WP_040826898.1|  glycerol kinase                                  92.8    8e-18   
ref|WP_010426632.1|  glycerol kinase                                  92.4    8e-18   
ref|WP_033876172.1|  glycerol kinase                                  90.1    8e-18   
ref|WP_037331798.1|  glycerol kinase                                  88.2    8e-18   
ref|WP_003541924.1|  glycerol kinase                                  92.4    8e-18   
ref|WP_025642575.1|  glycerol kinase                                  92.4    8e-18   
dbj|GAK69026.1|  glycerol kinase                                      92.4    8e-18   
ref|WP_031585243.1|  glycerol kinase                                  92.4    8e-18   
ref|WP_028680535.1|  hypothetical protein                             89.7    8e-18   
gb|KEA40943.1|  glycerol kinase                                       90.1    9e-18   
ref|WP_020568670.1|  hypothetical protein                             92.4    9e-18   
ref|WP_028852037.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_033180111.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_031773443.1|  glycerol kinase                                  90.1    9e-18   
ref|WP_031170850.1|  glycerol kinase                                  87.8    9e-18   
ref|WP_031768791.1|  glycerol kinase                                  90.1    9e-18   
ref|WP_031802241.1|  glycerol kinase                                  90.1    9e-18   
ref|WP_015277532.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_008570319.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_042682207.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_026759803.1|  MULTISPECIES: glycerol kinase                    92.4    9e-18   
ref|WP_003299277.1|  glycerol kinase                                  92.4    9e-18   
ref|WP_028473143.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_014819956.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_033977853.1|  glycerol kinase                                  90.1    1e-17   
ref|WP_044321390.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_027652531.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_015028738.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_027664047.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_038661497.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_027661174.1|  glycerol kinase                                  92.4    1e-17   
ref|WP_037140670.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_018720195.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_024686855.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_004932569.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_028423131.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_004881859.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_037118332.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_016733762.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_042852776.1|  glycerol kinase                                  90.1    1e-17   
ref|WP_005883090.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_029616967.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_034024024.1|  glycerol kinase                                  90.1    1e-17   
ref|WP_021675420.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_005062914.1|  glycerol kinase 1                                92.0    1e-17   
ref|WP_004912734.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_024313965.1|  MULTISPECIES: glycerol kinase                    92.0    1e-17   
ref|WP_018614184.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_008056630.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_016293843.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_030624251.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_024619178.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_004963379.1|  glycerol kinase 1                                92.0    1e-17   
ref|WP_037098859.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_003565649.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_015352907.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_024804016.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_017395622.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_033175947.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_013809138.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_030250580.1|  glycerol kinase                                  92.0    1e-17   
ref|WP_014063323.1|  glycerol kinase                                  91.7    1e-17   
gb|EIV99628.1|  LOW QUALITY PROTEIN: glycerol kinase                  91.7    2e-17   
ref|WP_011653038.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_014758097.1|  MULTISPECIES: glycerol kinase                    91.7    2e-17   
ref|WP_017844614.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_030671589.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_004400549.1|  MULTISPECIES: glycerol kinase                    91.7    2e-17   
ref|WP_040865247.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_003871378.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_030858775.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_029688493.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_008053512.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_025801473.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_004094211.1|  MULTISPECIES: glycerol kinase                    91.7    2e-17   
ref|WP_006423821.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_028443498.1|  MULTISPECIES: glycerol kinase                    91.7    2e-17   
ref|WP_021857093.1|  glycerol kinase 2                                91.7    2e-17   
ref|WP_019627048.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_002451261.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_024270170.1|  glycerol kinase GlpK                             91.7    2e-17   
ref|WP_031064041.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_018189990.1|  MULTISPECIES: glycerol kinase                    91.7    2e-17   
ref|WP_023443786.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_031002217.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_015586324.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_037859877.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_040813279.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_012758538.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_043562747.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_035643528.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_034601690.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_028991359.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_004663369.1|  MULTISPECIES: glycerol kinase 1                  91.7    2e-17   
ref|WP_007630952.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_025619269.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_010564129.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_041013583.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_005488222.1|  Glycerol kinase                                  91.3    2e-17   
ref|WP_040161505.1|  glycerol kinase                                  91.7    2e-17   
ref|WP_041274996.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_042928053.1|  MULTISPECIES: glycerol kinase                    91.3    2e-17   
ref|WP_003443190.1|  MULTISPECIES: glycerol kinase                    91.3    2e-17   
emb|CBA75804.1|  glycerol kinase                                      86.3    2e-17   
ref|WP_018475275.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_030168428.1|  glycerol kinase                                  91.3    2e-17   
gb|ADD27214.1|  glycerol kinase                                       91.7    2e-17   
ref|WP_025347461.1|  glycerol kinase                                  91.3    2e-17   
sp|A4J8E6.1|GLPK_DESRM  RecName: Full=Glycerol kinase; AltName: F...  91.3    2e-17   
ref|WP_012851581.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_012995763.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_027769937.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_003866562.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_014129603.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_003178687.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_014339888.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_002622012.1|  Glycerol kinase                                  91.3    2e-17   
ref|WP_030146193.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_035529901.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_018570128.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_007694227.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_015096694.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_007971302.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_030907160.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_022378780.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_009052782.1|  MULTISPECIES: glycerol kinase                    91.3    2e-17   
ref|WP_018481535.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_037896457.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_039621372.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_017823040.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_017994876.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_005344490.1|  glycerol kinase [                                91.3    2e-17   
ref|WP_030018107.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_030140769.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_019357401.1|  MULTISPECIES: glycerol kinase                    91.3    2e-17   
ref|WP_021207583.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_012652016.1|  MULTISPECIES: glycerol kinase                    91.3    2e-17   
ref|WP_022888254.1|  glycerol kinase                                  91.3    2e-17   
ref|WP_022169969.1|  glycerol kinase 1                                91.3    2e-17   
ref|WP_008543219.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_044296794.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_005329277.1|  glycerol kinase 1                                91.3    3e-17   
ref|WP_018832895.1|  glycerol kinase                                  89.4    3e-17   
ref|WP_013561135.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_027922834.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_027293903.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_032487697.1|  glycerol kinase                                  86.3    3e-17   
ref|WP_004681481.1|  MULTISPECIES: glycerol kinase                    91.3    3e-17   
ref|WP_043193328.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_003152303.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_020662584.1|  glycerol kinase                                  91.3    3e-17   
ref|WP_004760975.1|  MULTISPECIES: glycerol kinase 1                  90.9    3e-17   
ref|WP_015105019.1|  Glycerol kinase                                  90.9    3e-17   
ref|WP_003204972.1|  MULTISPECIES: glycerol kinase                    90.9    3e-17   
ref|WP_020298571.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_010847663.1|  Glycerol kinase                                  90.9    3e-17   
ref|WP_003292206.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_043632727.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_007533922.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_008032172.1|  MULTISPECIES: glycerol kinase                    90.9    3e-17   
ref|WP_034080357.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_012259133.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_011705539.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_043100909.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_008399380.1|  MULTISPECIES: glycerol kinase                    90.9    3e-17   
ref|WP_043831849.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_004674902.1|  glycerol kinase 1                                90.9    3e-17   
ref|WP_037883115.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_013183162.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_037816066.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_031459864.1|  glycerol kinase                                  90.9    3e-17   
ref|WP_015909396.1|  glycerol kinase                                  90.9    3e-17   



>ref|XP_011081977.1| PREDICTED: glycerol kinase [Sesamum indicum]
Length=522

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 131/135 (97%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKND+GEF+LRVDGGATVNNLLMQIQAD+
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNDKGEFLLRVDGGATVNNLLMQIQADI  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGSPVVRPADIETTALGAAYAAGLAVG+WTED+IFSSGEK +KDT+F+P I+E++RK+KV
Sbjct  445  LGSPVVRPADIETTALGAAYAAGLAVGVWTEDQIFSSGEKTEKDTVFRPAIDEQLRKQKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV+RTFDLAD
Sbjct  505  ESWCKAVTRTFDLAD  519



>emb|CDO98178.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAGD GE KN++GEF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGDTGETKNEKGEFLLRVDGGATVNNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIFS+GEKMKK T F+PV+EE +RKKKV
Sbjct  445  LGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFSAGEKMKKATNFQPVLEEGLRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAVSRTFDLAD
Sbjct  505  ESWCKAVSRTFDLAD  519



>ref|XP_011073388.1| PREDICTED: glycerol kinase-like [Sesamum indicum]
Length=522

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKD GDKGE KND+GEF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDVGDKGEAKNDKGEFLLRVDGGATVNNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G PV RPADIETTA GAAYAAGLA+GIWTE +IFSSGE+M K TIF+P++++EVRKKKV
Sbjct  445  IGKPVARPADIETTARGAAYAAGLAIGIWTEKDIFSSGEEMDKPTIFRPIVDQEVRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            DSWCKAVSRTFDLAD
Sbjct  505  DSWCKAVSRTFDLAD  519



>ref|XP_008461141.1| PREDICTED: glycerol kinase [Cucumis melo]
Length=523

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  389  ARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADLLGS  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVGIW++DEIF SGE++K  T F PV+EEE+RKKKV+SW
Sbjct  449  PVVRPADIETTALGAAYAAGLAVGIWSKDEIFDSGERVKSATTFYPVLEEELRKKKVESW  508

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  509  CKAVSRTFDLAD  520



>gb|EYU21675.1| hypothetical protein MIMGU_mgv1a019703mg [Erythranthe guttata]
Length=510

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KGE KND+GEFVLRVDGGATVNNLLMQIQADL
Sbjct  373  SHIARAVLESMCFQVKDVLDSMNKDAGEKGEAKNDKGEFVLRVDGGATVNNLLMQIQADL  432

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGSPVVRPADIETTALGAAYAAGLAVG+WTE+EIFSS EK +K T+F+PV+ EEVRKKKV
Sbjct  433  LGSPVVRPADIETTALGAAYAAGLAVGVWTENEIFSSVEKQEKPTVFRPVLGEEVRKKKV  492

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAVSRTFDLAD
Sbjct  493  ESWCKAVSRTFDLAD  507



>ref|XP_007023294.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY25916.1| Actin-like ATPase superfamily protein isoform 1 [Theobroma cacao]
Length=522

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADLLGS  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+W EDEIF+S EK+K  TIF+PV+ EE+RKKKVDSW
Sbjct  448  PVVRPADIETTALGAAYAAGLAVGVWKEDEIFASREKIKTATIFRPVLSEELRKKKVDSW  507

Query  408  CKAVSRTFDLAD  373
            CKAV RTFDLAD
Sbjct  508  CKAVERTFDLAD  519



>ref|XP_004135863.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 ref|XP_004163547.1| PREDICTED: glycerol kinase-like [Cucumis sativus]
 gb|KGN45247.1| hypothetical protein Csa_7G432280 [Cucumis sativus]
Length=523

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDA +KGEVKN++GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  389  ARAVLESMCFQVKDVLDSMHKDAVEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADLLGS  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVGIW++DEIF SGE++K  T F PV+EEE+RKKKV+SW
Sbjct  449  PVVRPADIETTALGAAYAAGLAVGIWSKDEIFDSGERVKSATTFYPVLEEELRKKKVESW  508

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  509  CKAVSRTFDLAD  520



>ref|XP_002273367.1| PREDICTED: glycerol kinase [Vitis vinifera]
 emb|CBI36391.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGAT+NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATINNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T F P ++EE R KKV
Sbjct  445  LGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLATTFYPALDEERRNKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAVSRTFDLAD
Sbjct  505  ESWCKAVSRTFDLAD  519



>emb|CAN76048.1| hypothetical protein VITISV_037711 [Vitis vinifera]
Length=522

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGAT+NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATINNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LG+PVVRPADIETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T F P ++EE R KKV
Sbjct  445  LGNPVVRPADIETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLATTFYPALDEERRNKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAVSRTFDLAD
Sbjct  505  ESWCKAVSRTFDLAD  519



>ref|XP_010654824.1| PREDICTED: glycerol kinase-like [Vitis vinifera]
Length=128

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  747  MCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPAD  568
            MCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGAT+NNLLMQIQADLLG+PVVRPAD
Sbjct  1    MCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATINNLLMQIQADLLGNPVVRPAD  60

Query  567  IETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRT  388
            IETTALGAAYAAGLAVGIWTEDEIF SGEK+K  T F P ++EE R KKV+SWCKAVSRT
Sbjct  61   IETTALGAAYAAGLAVGIWTEDEIFDSGEKVKLATTFYPALDEERRNKKVESWCKAVSRT  120

Query  387  FDLAD  373
            FDLAD
Sbjct  121  FDLAD  125



>gb|AIT39761.1| glycerol kinase, partial [Chrysanthemum boreale]
Length=514

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGE KN +G+F+LRVDGGATVNN LMQIQADL
Sbjct  377  SHIARAVLESMCFQVKDVLDSMHKDAGEKGETKNAKGQFLLRVDGGATVNNTLMQIQADL  436

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LG+PVVRPADIETTALGAAYAAGLAVG+WTE+EIFS+GE+MKKDT F PV+ +E+R+KKV
Sbjct  437  LGNPVVRPADIETTALGAAYAAGLAVGVWTEEEIFSNGERMKKDTTFNPVLNDELREKKV  496

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV ++FDLAD
Sbjct  497  ASWCKAVGKSFDLAD  511



>ref|XP_010063499.1| PREDICTED: glycerol kinase [Eucalyptus grandis]
 gb|KCW70740.1| hypothetical protein EUGRSUZ_F03908 [Eucalyptus grandis]
Length=524

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGE KN++GEF+LRVDGGATVNNLLMQIQADL
Sbjct  386  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEAKNEKGEFLLRVDGGATVNNLLMQIQADL  445

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LG+PVVRPADIETTALGAAYAAGLAVGIWTE++IFSSGE+ +  T F P ++E VRK K+
Sbjct  446  LGNPVVRPADIETTALGAAYAAGLAVGIWTENDIFSSGERAENVTTFHPRLDEGVRKSKL  505

Query  417  DSWCKAVSRTFDLAD  373
            DSWCKAVSRTFDLAD
Sbjct  506  DSWCKAVSRTFDLAD  520



>ref|XP_004303284.1| PREDICTED: glycerol kinase-like [Fragaria vesca subsp. vesca]
Length=522

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDAG++GEVKN++GEF+LRVDGGATVNNLLMQIQAD++GS
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDAGEQGEVKNEKGEFLLRVDGGATVNNLLMQIQADVMGS  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPAD ETTALGAAYAAGLAVG+WTE+EIF+S EK K  T F+P I EE+RKKK++SW
Sbjct  448  PVVRPADTETTALGAAYAAGLAVGVWTEEEIFASEEKTKTATTFRPKIGEELRKKKLESW  507

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  508  CKAVSRTFDLAD  519



>ref|XP_010033977.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 ref|XP_010033978.1| PREDICTED: glycerol kinase-like [Eucalyptus grandis]
 gb|KCW53847.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
 gb|KCW53848.1| hypothetical protein EUGRSUZ_J03080 [Eucalyptus grandis]
Length=522

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQADLLG+
Sbjct  388  ARAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADLLGN  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTED+IF SG +    T F+P ++EE+RKKKVDSW
Sbjct  448  PVVRPADIETTALGAAYAAGLAVGVWTEDDIFHSGARSSDPTTFRPKLDEELRKKKVDSW  507

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  508  CKAVSRTFDLAD  519



>ref|XP_004235901.1| PREDICTED: glycerol kinase [Solanum lycopersicum]
Length=522

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG K E K+D+ EF+LRVDGGAT+NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGTKDEAKSDKTEFLLRVDGGATINNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGS VVRPADIETTALGAAYAAGLAVG++TE++IF+SGEK+K+ TIFKPV+EEE+RKKK 
Sbjct  445  LGSSVVRPADIETTALGAAYAAGLAVGVYTENDIFASGEKLKQATIFKPVLEEELRKKKA  504

Query  417  DSWCKAVSRTFDLAD  373
            DSWC+AVSR+FDLAD
Sbjct  505  DSWCRAVSRSFDLAD  519



>ref|XP_009758692.1| PREDICTED: glycerol kinase [Nicotiana sylvestris]
Length=522

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDA  K + K +  EF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAAQKSDGKTEGTEFLLRVDGGATVNNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGSPVVRPADIETTALGAAYAAGLAVG++T+DEIFSSGEKMKK T FKPV+EEE+RKKKV
Sbjct  445  LGSPVVRPADIETTALGAAYAAGLAVGVYTQDEIFSSGEKMKKATTFKPVLEEELRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            DSWC AVSR+FDLAD
Sbjct  505  DSWCLAVSRSFDLAD  519



>ref|XP_009593517.1| PREDICTED: glycerol kinase [Nicotiana tomentosiformis]
Length=522

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 123/135 (91%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDA  K + K +  EF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAAQKSDDKTEGTEFLLRVDGGATVNNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGSPVVRPADIETTALGAAYAAGLAVG++T+DEIFSSGEKMKK T FKPV+EEE+RKKKV
Sbjct  445  LGSPVVRPADIETTALGAAYAAGLAVGVYTQDEIFSSGEKMKKATTFKPVLEEELRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            DSWC AVSR+FDLAD
Sbjct  505  DSWCLAVSRSFDLAD  519



>ref|XP_009334628.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=530

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVN LLMQIQADLLGSP
Sbjct  397  RAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNTLLMQIQADLLGSP  456

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            VVRPADIETTALGAAYAAGLAVG+W+E EIF+S E+ K  TIF+P ++EE+RKKK++SW 
Sbjct  457  VVRPADIETTALGAAYAAGLAVGVWSEKEIFASEERTKTSTIFRPKLDEELRKKKLESWF  516

Query  405  KAVSRTFDLAD  373
            KA+SRTFDLAD
Sbjct  517  KAISRTFDLAD  527



>ref|XP_008372701.1| PREDICTED: glycerol kinase [Malus domestica]
 ref|XP_008372702.1| PREDICTED: glycerol kinase [Malus domestica]
Length=530

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVN LLMQIQADLLGSP
Sbjct  397  RAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNTLLMQIQADLLGSP  456

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            VVRPADIETTALGAAYAAGLAVG+W+E EIF+  E+ K  TIF+P ++EE+RKKK+DSW 
Sbjct  457  VVRPADIETTALGAAYAAGLAVGVWSEKEIFACEERTKSSTIFRPKLDEELRKKKLDSWF  516

Query  405  KAVSRTFDLAD  373
            KA+SRTFDLAD
Sbjct  517  KAISRTFDLAD  527



>gb|EPS68115.1| hypothetical protein M569_06657, partial [Genlisea aurea]
Length=509

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 124/136 (91%), Gaps = 2/136 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQVRDVL+SMHKDAG++GE +ND+GEFVLRVDGGATVNNLLMQIQAD+
Sbjct  371  SHVARAVLESMCFQVRDVLESMHKDAGEEGESRNDKGEFVLRVDGGATVNNLLMQIQADI  430

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEK-MKKDTIFKPVIEEEVRKKK  421
            LGSPVVRP+DIETTALGAAYAAGLAVGIW+E E+F SGEK  +K T+F P I+EEVRKKK
Sbjct  431  LGSPVVRPSDIETTALGAAYAAGLAVGIWSETEVFGSGEKGGEKPTVFWPFIDEEVRKKK  490

Query  420  VDSWCKAVSRTFDLAD  373
            V+SWCKAV R+ DLAD
Sbjct  491  VESWCKAVERSLDLAD  506



>ref|XP_006341400.1| PREDICTED: glycerol kinase-like [Solanum tuberosum]
Length=518

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 124/135 (92%), Gaps = 5/135 (4%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDA    E K+D+ EF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDA----EAKSDKTEFLLRVDGGATVNNLLMQIQADL  440

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGS VVRPADIETTALGAAYAAGLAVG++TEDEIF+SGEK+K+ TIFKPV+EEE+RKKK 
Sbjct  441  LGSSVVRPADIETTALGAAYAAGLAVGVYTEDEIFASGEKLKQATIFKPVLEEELRKKKA  500

Query  417  DSWCKAVSRTFDLAD  373
            DSWC+AVSR+FDLAD
Sbjct  501  DSWCRAVSRSFDLAD  515



>ref|XP_009336317.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338517.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
 ref|XP_009338518.1| PREDICTED: glycerol kinase-like [Pyrus x bretschneideri]
Length=524

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RAV ESMCFQV+DVLDSMHKDAG+KGE KN++GEF+LRVDGGATVN LLMQIQADLLGSP
Sbjct  391  RAVLESMCFQVKDVLDSMHKDAGEKGEAKNEKGEFLLRVDGGATVNTLLMQIQADLLGSP  450

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            VVRPADIETTALGAAYAAGLAVG+W+E EIF+  E+ K  TIF+P ++EE+RKKK+DSW 
Sbjct  451  VVRPADIETTALGAAYAAGLAVGVWSEKEIFACEERTKNSTIFRPKLDEELRKKKLDSWF  510

Query  405  KAVSRTFDLAD  373
            KA+SRTFDLAD
Sbjct  511  KAISRTFDLAD  521



>gb|KJB66376.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=370

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++ EF+LRVDGGATVNNLLMQIQADL
Sbjct  233  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKEEFLLRVDGGATVNNLLMQIQADL  292

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+SG+ +K  +IF P    E RKKKV
Sbjct  293  LGSSVVRPADIETTALGAAYAAGIAVGVWKEEELFASGQIIKTASIFSPKSSVEWRKKKV  352

Query  417  DSWCKAVSRTFDLAD  373
            DSWCKAV RTF LAD
Sbjct  353  DSWCKAVERTFGLAD  367



>ref|XP_010691126.1| PREDICTED: glycerol kinase [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH  RAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQADL
Sbjct  386  SHICRAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADL  445

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGSPV+RP +IETTALGAAYAAGLAVG+W +D+IFS+ E+ K   IF+P +EEE RKKKV
Sbjct  446  LGSPVLRPENIETTALGAAYAAGLAVGVWKQDQIFSTEERAKTARIFRPTLEEESRKKKV  505

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV R+FDLAD
Sbjct  506  GSWCKAVERSFDLAD  520



>ref|XP_010250262.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=529

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 122/132 (92%), Gaps = 2/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDAG+KGE KND+GEF+LRVDGGATVN LLMQIQAD+LGS
Sbjct  397  ARAVLESMCFQVKDVLDSMHKDAGEKGEAKNDKGEFLLRVDGGATVNKLLMQIQADILGS  456

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTED+IF+  E+ +K TIF P ++ E+RKK+++SW
Sbjct  457  PVVRPADIETTALGAAYAAGLAVGLWTEDDIFA--ERAEKATIFSPKLDGELRKKRLESW  514

Query  408  CKAVSRTFDLAD  373
            CKA+SRTFDLAD
Sbjct  515  CKAISRTFDLAD  526



>ref|XP_006302137.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35035.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=522

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +GSPVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EEE RKKKV
Sbjct  445  MGSPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSQVFRPAMEEETRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>gb|KHG30375.1| Glycerol kinase [Gossypium arboreum]
Length=550

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQADL
Sbjct  413  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQADL  472

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+ G+ +K  +IF P    E RKKKV
Sbjct  473  LGSSVVRPADIETTALGAAYAAGMAVGVWKEEELFALGQNIKTASIFSPKSSVEWRKKKV  532

Query  417  DSWCKAVSRTFDLAD  373
            DSWCKAV RTF LAD
Sbjct  533  DSWCKAVERTFGLAD  547



>ref|XP_010472924.1| PREDICTED: glycerol kinase-like isoform X1 [Camelina sativa]
 ref|XP_010472925.1| PREDICTED: glycerol kinase-like isoform X2 [Camelina sativa]
Length=522

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + ND+GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNDKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE  RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSKVFRPAMEEGTRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV+RTFDLAD
Sbjct  505  ESWCKAVTRTFDLAD  519



>ref|XP_006389795.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27081.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=522

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGA+ NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGASANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +GSPVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EEE+RKKKV
Sbjct  445  MGSPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSRVFRPAMEEEIRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV RTFDLAD
Sbjct  505  QSWCKAVERTFDLAD  519



>gb|KJB66375.1| hypothetical protein B456_010G138000 [Gossypium raimondii]
Length=522

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++ EF+LRVDGGATVNNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKEEFLLRVDGGATVNNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            LGS VVRPADIETTALGAAYAAG+AVG+W E+E+F+SG+ +K  +IF P    E RKKKV
Sbjct  445  LGSSVVRPADIETTALGAAYAAGIAVGVWKEEELFASGQIIKTASIFSPKSSVEWRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            DSWCKAV RTF LAD
Sbjct  505  DSWCKAVERTFGLAD  519



>emb|CDX67948.1| BnaA07g19880D [Brassica napus]
Length=522

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EEE RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSKVFRPAMEEETRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>emb|CDY37598.1| BnaA02g19720D [Brassica napus]
Length=522

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+PV+EE  RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSKVFRPVMEEATRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_009104463.1| PREDICTED: glycerol kinase [Brassica rapa]
 ref|XP_009104464.1| PREDICTED: glycerol kinase [Brassica rapa]
Length=522

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E+ IF SGEK K   +F+P +EEE RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEENIFESGEKSKNSKVFRPAMEEETRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_002887828.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64087.1| At1g80460 [Arabidopsis lyrata subsp. lyrata]
Length=522

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +GSPVVRP DIETTALGAAYAAGLAVG W E +IF SGEK K   +F+P +EEE RKKKV
Sbjct  445  MGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFESGEKAKNSKVFRPAMEEETRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV RTFDLAD
Sbjct  505  ASWCKAVERTFDLAD  519



>gb|ABK32113.1| At1g80460 [Arabidopsis thaliana]
Length=522

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +GSPVVRP DIETTALGAAYAA LAVG W E +IF SGEK K   +F+P +EE +RKKKV
Sbjct  445  MGSPVVRPVDIETTALGAAYAARLAVGFWKEADIFESGEKAKNSKVFRPAMEEGIRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV RTFDLAD
Sbjct  505  ASWCKAVERTFDLAD  519



>emb|CDX79385.1| BnaC06g19180D [Brassica napus]
Length=522

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNGQGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EEE RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSKVFRPTMEEETRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>emb|CDY39977.1| BnaC06g40550D [Brassica napus]
Length=522

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE  RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKSKNSKVFRPAMEEATRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_010417705.1| PREDICTED: glycerol kinase-like [Camelina sativa]
Length=522

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE +RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSKVFRPAMEEGIRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_010429953.1| PREDICTED: glycerol kinase [Camelina sativa]
Length=522

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE +RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNSKVFRPAMEEGIRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>emb|CDX87311.1| BnaA07g35620D [Brassica napus]
Length=522

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE  RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWREEDIFESGEKSKNSKVFRPAMEEATRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_009106746.1| PREDICTED: glycerol kinase-like [Brassica rapa]
Length=522

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNEKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK K   +F+P +EE  RKKKV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWREEDIFESGEKSKNSKVFRPAMEEATRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
            +SWCKAV RTFDLAD
Sbjct  505  ESWCKAVERTFDLAD  519



>ref|XP_007215813.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
 gb|EMJ17012.1| hypothetical protein PRUPE_ppa004097mg [Prunus persica]
Length=530

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RAV ESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVN LLMQIQADLLGSP
Sbjct  397  RAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNTLLMQIQADLLGSP  456

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V+RPADIETTALGAAYAAGLAVGIWTE EIF+  E+ K  T F P ++EE+RKKK+DSW 
Sbjct  457  VLRPADIETTALGAAYAAGLAVGIWTEKEIFAGEERAKVATTFHPKLDEELRKKKLDSWF  516

Query  405  KAVSRTFDLAD  373
            KA+SRTFDLAD
Sbjct  517  KAISRTFDLAD  527



>ref|NP_178161.1| glycerol kinase [Arabidopsis thaliana]
 sp|Q9M8L4.1|GLPK_ARATH RecName: Full=Glycerol kinase; Short=Glycerokinase; AltName: 
Full=ATP:glycerol 3-phosphotransferase; AltName: Full=Protein 
GLYCEROL INSENSITIVE 1; AltName: Full=Protein NONHOST RESISTANCE 
TO P. S. PHASEOLICOLA 1 [Arabidopsis thaliana]
 gb|AAF27123.1|AC018849_11 putative glycerol kinase; 69575-71670 [Arabidopsis thaliana]
 gb|AAO61418.1| glycerol kinase [Arabidopsis thaliana]
 dbj|BAH19502.1| AT1G80460 [Arabidopsis thaliana]
 gb|AEE36407.1| glycerol kinase-like protein [Arabidopsis thaliana]
Length=522

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N +GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLNNGKGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +GSPVVRP DIETTALGAAYAAGLAVG W E +IF SGEK K   +F+P +EE +RKKKV
Sbjct  445  MGSPVVRPVDIETTALGAAYAAGLAVGFWKEADIFESGEKAKNSKVFRPAMEEGIRKKKV  504

Query  417  DSWCKAVSRTFDLAD  373
             SWCKAV RTFDLAD
Sbjct  505  ASWCKAVERTFDLAD  519



>ref|XP_008228677.1| PREDICTED: glycerol kinase [Prunus mume]
Length=530

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RAV ESM FQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVN LLMQIQADLLGSP
Sbjct  397  RAVLESMAFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNTLLMQIQADLLGSP  456

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V+RPADIETTALGAAYAAGLAVGIWTE EIF+  E+ K  T F P ++E +RKKK+DSW 
Sbjct  457  VLRPADIETTALGAAYAAGLAVGIWTEKEIFAGEERAKVATTFHPKLDEGLRKKKLDSWF  516

Query  405  KAVSRTFDLAD  373
            KA+SRTFDLAD
Sbjct  517  KAISRTFDLAD  527



>ref|XP_006385291.1| glycerol kinase family protein [Populus trichocarpa]
 gb|ERP63088.1| glycerol kinase family protein [Populus trichocarpa]
Length=519

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 5/132 (4%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDA        + GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  390  ARAVLESMCFQVKDVLDSMHKDAAG-----TEEGEFLLRVDGGATVNNLLMQIQADLLGS  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTE+EIF+SGEK K DT F+P + EE+RKKKVDSW
Sbjct  445  PVVRPADIETTALGAAYAAGLAVGVWTEEEIFASGEKSKSDTTFRPKLNEELRKKKVDSW  504

Query  408  CKAVSRTFDLAD  373
             KAV RTFDLAD
Sbjct  505  FKAVERTFDLAD  516



>ref|XP_011044862.1| PREDICTED: glycerol kinase [Populus euphratica]
Length=519

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 116/132 (88%), Gaps = 5/132 (4%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKDA       ++ GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  390  ARAVLESMCFQVKDVLDSMHKDAAG-----SEEGEFLLRVDGGATVNNLLMQIQADLLGS  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTE+EIF+SGEK K DT F+P + EE+RKKKVDSW
Sbjct  445  PVVRPADIETTALGAAYAAGLAVGVWTEEEIFASGEKSKSDTTFRPKLNEELRKKKVDSW  504

Query  408  CKAVSRTFDLAD  373
             KAV RTFDLAD
Sbjct  505  FKAVERTFDLAD  516



>emb|CBI36374.3| unnamed protein product [Vitis vinifera]
Length=117

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  714  MHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTalgaaya  535
            MHKDAG+KGEVKN++GEF+LRVDGGAT+NNLLMQIQADLLG+PVVRPADIETTALGAAYA
Sbjct  1    MHKDAGEKGEVKNEKGEFLLRVDGGATINNLLMQIQADLLGNPVVRPADIETTALGAAYA  60

Query  534  aglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLAD  373
            AGLAVGIWTEDEIF SGEK+K  T F P ++EE R KKV+SWCKAVSRTFDLAD
Sbjct  61   AGLAVGIWTEDEIFDSGEKVKLATTFYPALDEERRNKKVESWCKAVSRTFDLAD  114



>gb|KDO47427.1| hypothetical protein CISIN_1g0098681mg, partial [Citrus sinensis]
Length=477

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  343  ARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDGGATVNNLLMQIQADLLGS  402

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T FKPV+ EE RKKK +SW
Sbjct  403  PVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTSTTFKPVLNEEFRKKKAESW  462

Query  408  CKAVSRTFDLAD  373
            C+AV RTF+LAD
Sbjct  463  CRAVERTFNLAD  474



>gb|KDP37048.1| hypothetical protein JCGZ_06104 [Jatropha curcas]
Length=523

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSM KD G+KGE  N +GEF+LRVDGGATVNNLLMQIQADLLG+
Sbjct  389  ARAVLESMCFQVKDVLDSMQKDTGEKGEQNNAKGEFLLRVDGGATVNNLLMQIQADLLGN  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRPADIETTALGAAYAAGLA+G+W E+EIF++GEK+K  T F P + E+ RKKKV+SW
Sbjct  449  AVVRPADIETTALGAAYAAGLAIGVWKEEEIFATGEKVKTATTFHPNLHEQQRKKKVESW  508

Query  408  CKAVSRTFDLAD  373
            CKAV ++F LAD
Sbjct  509  CKAVEKSFGLAD  520



>gb|ABR26079.1| glycerol kinase [Oryza sativa Indica Group]
Length=189

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  56   ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  115

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +  T+F+P ++E  R+K+ DSW
Sbjct  116  PVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTTVFRPKLDEAHRRKRADSW  174

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  175  YKAVSRSFDLAD  186



>ref|XP_006492058.1| PREDICTED: glycerol kinase-like [Citrus sinensis]
Length=523

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  389  ARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDGGATVNNLLMQIQADLLGS  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T FKPV+ EE RKKK +SW
Sbjct  449  PVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTSTTFKPVLNEEFRKKKAESW  508

Query  408  CKAVSRTFDLAD  373
            C+AV RTF+LAD
Sbjct  509  CRAVERTFNLAD  520



>ref|XP_006427440.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
 gb|ESR40680.1| hypothetical protein CICLE_v10025360mg [Citrus clementina]
Length=523

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  389  ARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDGGATVNNLLMQIQADLLGS  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAA+AAGLA+G++ E+EIF SGE+ K  T FKPV+ EE RKKK +SW
Sbjct  449  PVIRPADIETTALGAAFAAGLAIGVFKEEEIFDSGERTKTSTTFKPVLNEEFRKKKAESW  508

Query  408  CKAVSRTFDLAD  373
            C+AV RTF+LAD
Sbjct  509  CRAVERTFNLAD  520



>ref|XP_006427437.1| hypothetical protein CICLE_v10025756mg [Citrus clementina]
 gb|ESR40677.1| hypothetical protein CICLE_v10025756mg [Citrus clementina]
Length=405

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSM KDA +KG +K+ + EF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  271  ARAVLESMCFQVKDVLDSMQKDAVEKGVIKDAKSEFLLRVDGGATVNNLLMQIQADLLGS  330

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPAD ETTALGAA+A GLA+G++ E+EIF+SGE  K  T FKPV+ EE RKKK +SW
Sbjct  331  PVIRPADKETTALGAAFADGLAIGVFKEEEIFASGEWAKTSTTFKPVLNEEGRKKKAESW  390

Query  408  CKAVSRTFDLAD  373
            C+AV RTF+LAD
Sbjct  391  CRAVERTFNLAD  402



>gb|AAR88660.1| glycerol kinase [Pandanus amaryllifolius]
Length=531

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVL+SMHKD GD GE KN  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  398  ARAVLESMCFQVKDVLNSMHKDVGDVGEAKNKEGEFLLRVDGGATVNNLLMQIQADLLGS  457

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT ++IF+SG  ++K T+F+P ++EE RKK+ +SW
Sbjct  458  PVVRPADIETTALGAAYAAGLATGVWTAEQIFASGH-IEKATVFRPKLDEEKRKKRTESW  516

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  517  CKAVSRTFDLAD  528



>ref|XP_002517681.1| glycerol kinase, putative [Ricinus communis]
 gb|EEF44845.1| glycerol kinase, putative [Ricinus communis]
Length=521

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 119/139 (86%), Gaps = 3/139 (2%)
 Frame = -2

Query  786  Y*QVSH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQI  610
            Y   SH ARAV ESMCFQV+DVLDSMHKD  +K   K+ + EF+LRVDGGAT+NNLLMQI
Sbjct  382  YTNKSHIARAVLESMCFQVKDVLDSMHKDREEKH--KDTKREFLLRVDGGATINNLLMQI  439

Query  609  QADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVR  430
            QADL+G PVVRP+DIETTALGAAYAAGLAVGIWTE EIF+SGEK K DTIF P ++EE+R
Sbjct  440  QADLVGHPVVRPSDIETTALGAAYAAGLAVGIWTEKEIFASGEKAKTDTIFCPKLDEELR  499

Query  429  KKKVDSWCKAVSRTFDLAD  373
            KKKV+SWCKAV RTF LAD
Sbjct  500  KKKVESWCKAVERTFGLAD  518



>ref|XP_010244913.1| PREDICTED: glycerol kinase-like [Nelumbo nucifera]
Length=541

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV DVLDSMHKD GD+GE KND+GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  409  ARAVLESVCFQVNDVLDSMHKDVGDEGEFKNDKGEFLLRVDGGATVNNLLMQIQADLLGS  468

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPAD+ETTALGAAYAAG+AVG+WTED IF+  E+  K TIF P +++E R KK++SW
Sbjct  469  PVVRPADVETTALGAAYAAGIAVGLWTEDVIFA--ERAGKPTIFSPKLDKEQRMKKLESW  526

Query  408  CKAVSRTFDLA  376
             KAVSR FDLA
Sbjct  527  SKAVSRAFDLA  537



>ref|XP_008779159.1| PREDICTED: glycerol kinase-like isoform X1 [Phoenix dactylifera]
Length=476

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDGGAT+NNLLMQIQADLLGS
Sbjct  343  ARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDGGATINNLLMQIQADLLGS  402

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTE++IF++ E  +K TIF+P ++EE RK++ +SW
Sbjct  403  PVVRPADIETTALGAAYAAGLAVGVWTEEQIFAA-EHKEKTTIFRPKLDEEQRKRRNESW  461

Query  408  CKAVSRTFDLAD  373
             KAV+RTFDLA+
Sbjct  462  YKAVTRTFDLAE  473



>ref|XP_008779160.1| PREDICTED: glycerol kinase-like isoform X2 [Phoenix dactylifera]
Length=520

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDGGAT+NNLLMQIQADLLGS
Sbjct  387  ARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDGGATINNLLMQIQADLLGS  446

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+WTE++IF++ E  +K TIF+P ++EE RK++ +SW
Sbjct  447  PVVRPADIETTALGAAYAAGLAVGVWTEEQIFAA-EHKEKTTIFRPKLDEEQRKRRNESW  505

Query  408  CKAVSRTFDLAD  373
             KAV+RTFDLA+
Sbjct  506  YKAVTRTFDLAE  517



>ref|XP_006442413.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
 gb|ESR55653.1| hypothetical protein CICLE_v10020202mg [Citrus clementina]
Length=435

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 117/136 (86%), Gaps = 2/136 (1%)
 Frame = -2

Query  780  QVSHARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            +V  ARAV ESMCFQV+DVLDS+ KDA +KG +K+ +  F+LRVDGGATVNNLLMQIQAD
Sbjct  299  KVHIARAVLESMCFQVKDVLDSLQKDAVEKGVIKDAK--FLLRVDGGATVNNLLMQIQAD  356

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            LLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF+SGE+ K  T FKPV+ EE RKKK
Sbjct  357  LLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFASGERTKTSTTFKPVLNEEFRKKK  416

Query  420  VDSWCKAVSRTFDLAD  373
             +SWC+AV R F+LAD
Sbjct  417  AESWCRAVERIFNLAD  432



>ref|XP_006652916.1| PREDICTED: glycerol kinase-like [Oryza brachyantha]
Length=538

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQA+LLGS
Sbjct  405  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQANLLGS  464

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVGIWT++++F +G   +  T+F+P ++E  RKK+ DSW
Sbjct  465  PVVRPADIETTALGAAYAAGLAVGIWTKEQVF-AGLHRENTTVFRPQLDEIHRKKRADSW  523

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  524  FKAVSRSFDLAD  535



>ref|XP_010097187.1| Glycerol kinase [Morus notabilis]
 gb|EXB67254.1| Glycerol kinase [Morus notabilis]
Length=523

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQVRDVL+SM KDA +KGE K +  EF+LRVDGGA VNNLLMQ QADLLGS
Sbjct  389  ARAVLESMCFQVRDVLESMKKDALEKGEAKGESEEFLLRVDGGAAVNNLLMQTQADLLGS  448

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRPADIETTALGAAYAAGLAVG+W E++IF SGEK K DT F  +++EE R KKV+SW
Sbjct  449  SVVRPADIETTALGAAYAAGLAVGVWKEEDIFGSGEKAKTDTTFHAILDEEKRNKKVESW  508

Query  408  CKAVSRTFDLAD  373
             KAV+RTFDLAD
Sbjct  509  YKAVTRTFDLAD  520



>gb|KFK42437.1| hypothetical protein AALP_AA2G256400 [Arabis alpina]
Length=522

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDSM KDAG+ G + N  GEF+LRVDGGAT NNLLMQIQADL
Sbjct  385  SHLARAVLESMCFQVKDVLDSMIKDAGENGSLSNSEGEFLLRVDGGATANNLLMQIQADL  444

Query  597  LGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKV  418
            +G+PVVRP DIETTALGAAYAAGLAVG W E++IF SGEK +   +F+P ++EE RK KV
Sbjct  445  MGTPVVRPVDIETTALGAAYAAGLAVGFWKEEDIFESGEKAENSRVFRPNMDEETRKNKV  504

Query  417  DSWCKAVSRTFDLAD  373
             SWC AV RTF LAD
Sbjct  505  KSWCIAVERTFGLAD  519



>emb|CAJ86056.1| H0821G03.7 [Oryza sativa Indica Group]
 emb|CAH68428.1| H0811D08.16 [Oryza sativa Indica Group]
Length=529

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  396  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  455

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +  T+F+P ++E  R+K+ DSW
Sbjct  456  PVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTTVFRPKLDEAHRRKRADSW  514

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  515  YKAVSRSFDLAD  526



>ref|XP_009407371.1| PREDICTED: glycerol kinase [Musa acuminata subsp. malaccensis]
Length=531

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV DVL SMHKDAG++GE K +  EF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  398  ARAVLESICFQVNDVLASMHKDAGERGEAKTNVREFLLRVDGGATVNNLLMQIQADLLGS  457

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPAD+ETTALGAAYAAGLA+G+WTE++I+S+G K +K T+F P ++E  RKK+ +SW
Sbjct  458  PVVRPADVETTALGAAYAAGLAIGVWTEEQIYSAGHK-EKTTVFHPKLDEAHRKKRSESW  516

Query  408  CKAVSRTFDLAD  373
             KAVSRTFDLAD
Sbjct  517  NKAVSRTFDLAD  528



>ref|NP_001054071.1| Os04g0647800 [Oryza sativa Japonica Group]
 dbj|BAF15985.1| Os04g0647800 [Oryza sativa Japonica Group]
Length=529

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  396  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  455

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +   +F+P ++E  R+K+ DSW
Sbjct  456  PVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTRVFRPKLDEAHRRKRADSW  514

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  515  YKAVSRSFDLAD  526



>ref|XP_010537930.1| PREDICTED: glycerol kinase [Tarenaya hassleriana]
Length=522

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVLDSM+KD G+KG VK+++ EF+LRVDGGAT NNLLMQIQADLLGS
Sbjct  388  ARAVLESMCFQVNDVLDSMNKDVGEKGTVKSEK-EFLLRVDGGATANNLLMQIQADLLGS  446

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKK-DTIFKPVIEEEVRKKKVDS  412
             VVRPADIETTALGAAYAAGLAVG W E++IF SGEK K    +FKPV++EE RKKK DS
Sbjct  447  AVVRPADIETTALGAAYAAGLAVGFWKEEDIFESGEKAKNAAAMFKPVLDEETRKKKADS  506

Query  411  WCKAVSRTFDLAD  373
            W KAV +TF+LAD
Sbjct  507  WAKAVEKTFNLAD  519



>gb|AAR18687.1| glycerol kinase-like protein [Oryza sativa Japonica Group]
 gb|EAZ32203.1| hypothetical protein OsJ_16410 [Oryza sativa Japonica Group]
Length=529

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  396  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  455

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLAVG+W++++IF +G   +   +F+P ++E  R+K+ DSW
Sbjct  456  PVVRPADIETTALGAAYAAGLAVGVWSKEQIF-AGLHKENTRVFRPKLDEAHRRKRADSW  514

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  515  YKAVSRSFDLAD  526



>gb|KHN01314.1| Putative glycerol kinase [Glycine soja]
Length=519

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 3/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKD+G   E ++ + EF+LRVDGGATVNNLLMQIQADL+G 
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDSG---ESESQKTEFLLRVDGGATVNNLLMQIQADLVGC  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAAYAAGLA GIW ED IF++ EK+K   +F+PV+ EEVRKKKVDSW
Sbjct  445  PVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEEKLKNARVFRPVMTEEVRKKKVDSW  504

Query  408  CKAVSRTFDLAD  373
            CKAVS+TFDLAD
Sbjct  505  CKAVSKTFDLAD  516



>ref|NP_001237303.1| glycerol kinase [Glycine max]
 gb|AAR86687.1| glycerol kinase [Glycine max]
Length=519

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 116/132 (88%), Gaps = 3/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVLDSMHKD+G   E ++ + EF+LRVDGGATVNNLLMQIQADL+G 
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDSG---ESESQKTEFLLRVDGGATVNNLLMQIQADLVGC  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAAYAAGLA GIW ED IF++ EK+K   +F+PV+ EEVRKKKVDSW
Sbjct  445  PVIRPADIETTALGAAYAAGLATGIWKEDFIFNTEEKLKNARVFRPVMTEEVRKKKVDSW  504

Query  408  CKAVSRTFDLAD  373
            CKAVS+TFDLAD
Sbjct  505  CKAVSKTFDLAD  516



>ref|XP_003580683.1| PREDICTED: glycerol kinase [Brachypodium distachyon]
Length=531

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  398  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  457

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTA+GAAYAAGLA G+WT+++IF +G   +  T+F+P ++E  RKK+ DSW
Sbjct  458  PVVRPADIETTAIGAAYAAGLAAGVWTKEQIF-AGLHKENTTVFRPKLDEAHRKKRGDSW  516

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  517  YKAVSRSFDLAD  528



>ref|XP_006442415.1| hypothetical protein CICLE_v10024258mg [Citrus clementina]
 gb|ESR55655.1| hypothetical protein CICLE_v10024258mg [Citrus clementina]
Length=368

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCF V+DVLDSM KDA +KG +K+ + EFVLRVDGGATVNNLLMQIQADLLGS
Sbjct  234  ARAVLESMCFLVKDVLDSMQKDAVEKGVIKDAKPEFVLRVDGGATVNNLLMQIQADLLGS  293

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIE TALGAA+AAGLA+G++ E+EIF+S E+ K  T FKP++ EE RKKK +S 
Sbjct  294  PVLRPADIEATALGAAFAAGLAIGVFKEEEIFASSERTKTSTTFKPLLNEEFRKKKAESQ  353

Query  408  CKAVSRTFDLAD  373
            C+AV RTF+LAD
Sbjct  354  CRAVERTFNLAD  365



>gb|AGH08245.1| glycerol kinase [Triticum aestivum]
Length=534

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL+SMHKDAG+ GEVK+  GEF+LRVDGGAT+NNLLMQIQADLLGS
Sbjct  401  ARAVLESMCFQVNDVLNSMHKDAGESGEVKSAEGEFLLRVDGGATINNLLMQIQADLLGS  460

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT++EIF +G   +  T+F+P +++  RKK+ DSW
Sbjct  461  PVVRPADIETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTTVFRPKLDDAHRKKRGDSW  519

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  520  YKAVSRSFDLAD  531



>ref|NP_001132106.2| uncharacterized protein LOC100193522 [Zea mays]
 gb|ACG42404.1| glycerol kinase [Zea mays]
 gb|ACF80804.2| unknown [Zea mays]
 tpg|DAA35707.1| TPA: glycerol kinase [Zea mays]
Length=523

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  390  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  449

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT++++F +G   +  T+F+P ++E  RKK+ DSW
Sbjct  450  PVVRPADIETTALGAAYAAGLAAGVWTKEKVF-AGLHKENTTVFRPKLDEAHRKKRADSW  508

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  509  YKAVSRSFDLAD  520



>ref|XP_004977029.1| PREDICTED: glycerol kinase-like [Setaria italica]
Length=523

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  390  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  449

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT +++F +G   +  T+F+P ++E  RKK+ DSW
Sbjct  450  PVVRPADIETTALGAAYAAGLAAGVWTGEQVF-AGLHKENTTVFRPQLDETHRKKRADSW  508

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  509  YKAVSRSFDLAD  520



>ref|XP_003533071.2| PREDICTED: glycerol kinase-like [Glycine max]
Length=124

 Score =   164 bits (414),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 107/125 (86%), Gaps = 4/125 (3%)
 Frame = -2

Query  747  MCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPAD  568
            MCFQV+DVLDSMHKD+G+    K    + +LRVDGGA VNNLLMQIQADL+G P++RPAD
Sbjct  1    MCFQVKDVLDSMHKDSGESESQK----KLLLRVDGGAAVNNLLMQIQADLVGCPIIRPAD  56

Query  567  IETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRT  388
            IETTALGAAYAAGLA+GIW ED +F++ EK+K   +F+P++ EE+RKKKVDSWCKAVS+T
Sbjct  57   IETTALGAAYAAGLAIGIWKEDYVFNTEEKLKNANVFRPLMTEELRKKKVDSWCKAVSKT  116

Query  387  FDLAD  373
            FDLAD
Sbjct  117  FDLAD  121



>gb|EMT01355.1| Putative glycerol kinase [Aegilops tauschii]
Length=561

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL+SMHKDAG+ GEVK+  GEF+LRVDGGAT+NNLLMQIQADLLGS
Sbjct  428  ARAVLESMCFQVNDVLNSMHKDAGESGEVKSAEGEFLLRVDGGATINNLLMQIQADLLGS  487

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT++EIF +G   +  T+F+P +++  RKK+ DSW
Sbjct  488  PVVRPADIETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTTVFRPKLDDAHRKKRGDSW  546

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  547  YKAVSRSFDLAD  558



>gb|KDO41571.1| hypothetical protein CISIN_1g046958mg [Citrus sinensis]
Length=417

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -2

Query  780  QVSHARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            +   ARAV ESMCF V+DVLDS  KDA +KG +K+ + EFVLRVDGGATVNNLLMQIQAD
Sbjct  279  KAHFARAVLESMCFLVKDVLDSKQKDAVEKGVIKDAKPEFVLRVDGGATVNNLLMQIQAD  338

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            LLGSPV+RPADIE+TALGAA+AAGLA+G++ E+EIF+S E+ K  T FKP++ EE RKKK
Sbjct  339  LLGSPVLRPADIESTALGAAFAAGLAIGVFKEEEIFASSERTKTSTTFKPLLNEEFRKKK  398

Query  420  VDSWCKAVSRTFDLAD  373
             +S C+AV RTF+LAD
Sbjct  399  AESQCRAVERTFNLAD  414



>gb|EMS68114.1| Glycerol kinase [Triticum urartu]
Length=479

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  346  ARAVLESMCFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  405

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPAD ETTALGAAYAAGLA G+WT++EIF +G   +  T+F+P +++  RKK+ +SW
Sbjct  406  PVVRPADTETTALGAAYAAGLAAGVWTKEEIF-AGLHKENTTVFRPKLDDAHRKKRGESW  464

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  465  NKAVSRSFDLAD  476



>ref|XP_002448637.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
 gb|EES12965.1| hypothetical protein SORBIDRAFT_06g030600 [Sorghum bicolor]
Length=523

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESM FQV DVL SMHKDAG+ GEVK+  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  390  ARAVLESMSFQVNDVLSSMHKDAGEAGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGS  449

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WT++++F +G   +  T+F+P ++E  RKK+ DSW
Sbjct  450  PVVRPADIETTALGAAYAAGLAAGVWTKEQVF-AGLHKENTTVFRPKLDEAHRKKRADSW  508

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  509  YKAVSRSFDLAD  520



>ref|XP_007135771.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
 gb|ESW07765.1| hypothetical protein PHAVU_010G157400g [Phaseolus vulgaris]
Length=521

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 112/132 (85%), Gaps = 2/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV+DVL+SMHKD+    +V + +    LRVDGGATVNNLLMQIQADLLGS
Sbjct  389  ARAVLESMCFQVKDVLNSMHKDSAQ--DVSSSKEALSLRVDGGATVNNLLMQIQADLLGS  446

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP DIETTALGAAYAAGLA G+W E+ IF+SGEKMK   +F+P++ EEVRKKK +SW
Sbjct  447  PVVRPVDIETTALGAAYAAGLATGVWKEEHIFNSGEKMKNAKVFRPIMSEEVRKKKFESW  506

Query  408  CKAVSRTFDLAD  373
            CKAV+RTFDLAD
Sbjct  507  CKAVTRTFDLAD  518



>ref|XP_010907017.1| PREDICTED: glycerol kinase [Elaeis guineensis]
Length=521

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV DVL+SMHKDAG+ GE ++  GEF+LRVDGGATVNNLLMQIQADLLGS
Sbjct  388  ARAVLESMCFQVNDVLNSMHKDAGEGGEARSKEGEFLLRVDGGATVNNLLMQIQADLLGS  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA G+WTE++IF+  E  +K TIF+P ++E  RK++ +SW
Sbjct  448  PVVRPADIETTALGAAYAAGLATGVWTEEQIFAV-EHREKTTIFRPKLDEAQRKRRNESW  506

Query  408  CKAVSRTFDLAD  373
             KAV+RTFDLA+
Sbjct  507  YKAVTRTFDLAE  518



>ref|XP_003604353.1| Glycerol kinase [Medicago truncatula]
 gb|AES86550.1| glycerol kinase-like protein [Medicago truncatula]
Length=519

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 112/132 (85%), Gaps = 3/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV+DV+DSMHKD+G     ++ + EF+LRVDGGATVNNLLMQ QADLL +
Sbjct  388  ARAVLESICFQVKDVIDSMHKDSGAD---QSKKDEFLLRVDGGATVNNLLMQTQADLLAT  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             V+RPADIETTALGAAYAAGLAVGIW ED +F S + +K  ++F+P++ EE+RKKKVDSW
Sbjct  445  SVIRPADIETTALGAAYAAGLAVGIWKEDFVFDSKDLLKNASVFRPLMVEEIRKKKVDSW  504

Query  408  CKAVSRTFDLAD  373
             KAVSR+FDLAD
Sbjct  505  GKAVSRSFDLAD  516



>ref|XP_004506960.1| PREDICTED: glycerol kinase-like [Cicer arietinum]
Length=519

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 107/132 (81%), Gaps = 3/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV+DV+DSMHKD+G     K+D   F+LRVDGGAT NNLLMQIQADLL +
Sbjct  388  ARAVLESICFQVKDVIDSMHKDSGIDETKKSD---FLLRVDGGATANNLLMQIQADLLAT  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPADIETTALGAAYAAGLA+G+W ED +F   EK+K   +F PV+  +VRKKK DSW
Sbjct  445  PVVRPADIETTALGAAYAAGLAIGVWKEDYVFDCREKLKDAGVFSPVMAADVRKKKTDSW  504

Query  408  CKAVSRTFDLAD  373
             KAV R+FDLAD
Sbjct  505  SKAVGRSFDLAD  516



>ref|XP_008795833.1| PREDICTED: glycerol kinase-like [Phoenix dactylifera]
Length=538

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV DVL+SM+KD  + G V++  G F+LRVDGGA+ NNLLMQ QADLLGS
Sbjct  405  ARAVLESICFQVNDVLESMYKDVVEHGGVESKDGSFLLRVDGGASANNLLMQTQADLLGS  464

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRP +IETTALGAAYAAGLAVGIW+E++IF+ G+  K  TIF+P ++E  R+K+ DSW
Sbjct  465  AVVRPGNIETTALGAAYAAGLAVGIWSEEQIFAFGDNAKA-TIFQPQLDESKRQKRSDSW  523

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  524  CKAVSRTFDLAD  535



>ref|XP_010913342.1| PREDICTED: glycerol kinase-like [Elaeis guineensis]
Length=537

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV DV+ SM KDA D G V++  G F+LRVDGGA+ NNLLMQ QADLLGS
Sbjct  405  ARAVLESICFQVNDVIKSMCKDAADNG-VESKDGLFLLRVDGGASANNLLMQTQADLLGS  463

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRP +IETTALGA YAAGLAVGIW+E++IF+ G+  K  TIF+P ++   R+K+ D W
Sbjct  464  AVVRPGNIETTALGAGYAAGLAVGIWSEEQIFAFGDNAKA-TIFQPQLDASKRQKRSDCW  522

Query  408  CKAVSRTFDLAD  373
            CKAVSRTFDLAD
Sbjct  523  CKAVSRTFDLAD  534



>ref|XP_006852853.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
 gb|ERN14320.1| hypothetical protein AMTR_s00033p00197360 [Amborella trichopoda]
Length=477

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 107/132 (81%), Gaps = 7/132 (5%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQVRDV+++M  DAG+ GE       FVLRVDGGATVNNLLMQ+QADLLGS
Sbjct  351  ARAVLESMCFQVRDVVEAMRADAGE-GE------GFVLRVDGGATVNNLLMQLQADLLGS  403

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPADIETTALGAAYAAGLA G+WTED+IF+SG K   DT+F P + EE R ++  SW
Sbjct  404  PVLRPADIETTALGAAYAAGLATGVWTEDDIFTSGNKASNDTVFNPRVCEEERDRRFKSW  463

Query  408  CKAVSRTFDLAD  373
             KAV ++FDLAD
Sbjct  464  HKAVEKSFDLAD  475



>gb|ABK24550.1| unknown [Picea sitchensis]
Length=534

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RAV ESMCFQV++VL++M  D   + E   +  EF+LRVDGGA+VNNLLMQIQADL+GS
Sbjct  401  SRAVLESMCFQVKEVLNAMSIDV-KQDEKSKENEEFLLRVDGGASVNNLLMQIQADLMGS  459

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPAD ETTALGAAYAAGLA G+WTE++IFSSG K ++ T+F P + +E RKK+ +SW
Sbjct  460  PVLRPADTETTALGAAYAAGLATGVWTEEQIFSSGAKKEEPTVFYPKVGDEHRKKRYESW  519

Query  408  CKAVSRTFDLAD  373
            CKAV RTFDLA+
Sbjct  520  CKAVERTFDLAN  531



>gb|KEH28675.1| glycerol kinase-like protein [Medicago truncatula]
Length=508

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 103/123 (84%), Gaps = 3/123 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES+CFQV+DV+DSMHKD+G     ++ + EF+LRVDGGATVNNLLMQ QADLL +
Sbjct  388  ARAVLESICFQVKDVIDSMHKDSGAD---QSKKDEFLLRVDGGATVNNLLMQTQADLLAT  444

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             V+RPADIETTALGAAYAAGLAVGIW ED +F S + +K  ++F+P++ EE+RKKKVDSW
Sbjct  445  SVIRPADIETTALGAAYAAGLAVGIWKEDFVFDSKDLLKNASVFRPLMVEEIRKKKVDSW  504

Query  408  CKA  400
             KA
Sbjct  505  GKA  507



>gb|ABK25673.1| unknown [Picea sitchensis]
Length=530

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ESMCFQV++VL+SM  D   + E   +  EF+LRVDGGA+VNNLLMQIQADL+GS
Sbjct  397  ARAVLESMCFQVKEVLNSMSIDV-KQDEKSKENEEFLLRVDGGASVNNLLMQIQADLMGS  455

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RPAD ETTALGAAYAAGLA G+WTE++IFSS  K ++ T+F P + +E RKK+ +SW
Sbjct  456  PVLRPADTETTALGAAYAAGLATGVWTEEQIFSSEAKKEEPTVFYPKVGDEQRKKRYESW  515

Query  408  CKAVSRTFDLAD  373
            CKAV RTFDLA+
Sbjct  516  CKAVERTFDLAN  527



>ref|XP_002985935.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
 gb|EFJ13112.1| hypothetical protein SELMODRAFT_123030 [Selaginella moellendorffii]
Length=519

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 7/132 (5%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            AR+V ESMCFQ ++VLDSM KDA  K E K    +FVLRVDGGATVNNLLMQIQADLLG+
Sbjct  393  ARSVLESMCFQAKEVLDSMLKDA--KVEHKE---KFVLRVDGGATVNNLLMQIQADLLGT  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRP DIETTALGAAYAAGLAVG+W E++IF++ E++ +   F P I E  R+K+  SW
Sbjct  448  DVVRPKDIETTALGAAYAAGLAVGLWKEEQIFTADEEVGQT--FTPSIAEPEREKRYTSW  505

Query  408  CKAVSRTFDLAD  373
            CKAV R++ LAD
Sbjct  506  CKAVERSYALAD  517



>ref|XP_002984877.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
 gb|EFJ14127.1| hypothetical protein SELMODRAFT_121015 [Selaginella moellendorffii]
Length=519

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 7/132 (5%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            AR+V ESMCFQ ++VLDSM KDA  K E K    +FVLRVDGGATVNNLLMQIQADLLG+
Sbjct  393  ARSVLESMCFQAKEVLDSMLKDA--KVEHKE---KFVLRVDGGATVNNLLMQIQADLLGT  447

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRP DIETTALGAAYAAGLAVG+W E++IF++ E++ +   F P I E  R+K+  SW
Sbjct  448  DVVRPKDIETTALGAAYAAGLAVGLWKEEQIFTADEEVGQT--FTPSIAEPEREKRYTSW  505

Query  408  CKAVSRTFDLAD  373
            CKAV R++ LAD
Sbjct  506  CKAVERSYALAD  517



>ref|XP_001763943.1| predicted protein [Physcomitrella patens]
 gb|EDQ71347.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 2/132 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ESMC+QV++VL SM  DAG+        GEF+LRVDGGATVNNLLMQ+QADLLGS
Sbjct  395  ARATLESMCYQVKEVLTSMKADAGNIEATVG--GEFLLRVDGGATVNNLLMQLQADLLGS  452

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP DIETTALGAAYAAGLAVG+WT+++I   G   +  T+F   I ++ R K+  SW
Sbjct  453  PVVRPVDIETTALGAAYAAGLAVGVWTKEQIIEQGAVQEAPTVFHSQITDDERNKRCLSW  512

Query  408  CKAVSRTFDLAD  373
             KAV R+F LA+
Sbjct  513  NKAVERSFGLAE  524



>gb|KHN38002.1| Glycerol kinase [Glycine soja]
Length=100

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -2

Query  747  MCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPAD  568
            MCFQV+DVLDS++KD+G+    K    +F+LRVDGGA VNNLLMQIQADL+G P++RPAD
Sbjct  1    MCFQVKDVLDSIYKDSGESESQK----KFLLRVDGGAAVNNLLMQIQADLVGCPIIRPAD  56

Query  567  IETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEE  436
            IETTALGAAYAAGLA+GIW ED +F++ EK+K   +F+P++ EE
Sbjct  57   IETTALGAAYAAGLAIGIWKEDYVFNTEEKLKNANVFRPLMTEE  100



>gb|KDO39537.1| hypothetical protein CISIN_1g0368922mg, partial [Citrus sinensis]
Length=110

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -2

Query  609  QADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVR  430
             ADLLGSPV+RPADIETTALGAA+AAGLA+G++ E+EIF+SGE+ K  T FKPV+ EE R
Sbjct  29   SADLLGSPVIRPADIETTALGAAFAAGLAIGVFKEEEIFASGERTKTSTTFKPVLNEEFR  88

Query  429  KKKVDSWCKAVSRTFDLAD  373
            KKK +SWC+AV R F+LAD
Sbjct  89   KKKAESWCRAVERIFNLAD  107



>ref|XP_007023296.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY25918.1| Actin-like ATPase superfamily protein isoform 3 [Theobroma cacao]
Length=448

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQ  607
            ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQ
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQ  441



>ref|XP_007023295.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY25917.1| Actin-like ATPase superfamily protein isoform 2 [Theobroma cacao]
Length=450

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQ  607
            ARAV ESMCFQV+DVLDSMHKDAG+KGEVKN++GEF+LRVDGGATVNNLLMQIQ
Sbjct  388  ARAVLESMCFQVKDVLDSMHKDAGEKGEVKNEKGEFLLRVDGGATVNNLLMQIQ  441



>emb|CDY72493.1| BnaCnng77930D [Brassica napus]
Length=198

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 11/74 (15%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDS++          N++ EF+LRVDGGAT NNLLMQIQADL
Sbjct  96   SHIARAVLESMCFQVKDVLDSLN----------NEKAEFLLRVDGGATANNLLMQIQADL  145

Query  597  LGSPVVRPADIETT  556
            +G+PVVRP DIETT
Sbjct  146  MGTPVVRPVDIETT  159



>emb|CDY03893.1| BnaC07g11180D [Brassica napus]
Length=188

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 11/74 (15%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV DVLDS++          N++GEF+LRVDGGAT NNLLM IQADL
Sbjct  86   SHIARAVLESMCFQVNDVLDSLN----------NEKGEFLLRVDGGATANNLLMHIQADL  135

Query  597  LGSPVVRPADIETT  556
            +G+PVVRP DIETT
Sbjct  136  MGTPVVRPVDIETT  149



>gb|KDO47430.1| hypothetical protein CISIN_1g036432mg, partial [Citrus sinensis]
Length=81

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -2

Query  606  ADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRK  427
            ADLLGSPV+RPAD ETTALGAA+A GLA+G++ E+EIF+SGE  K  T FKPV+ EE RK
Sbjct  1    ADLLGSPVIRPADKETTALGAAFADGLAIGVFKEEEIFASGEWAKTSTTFKPVLNEEGRK  60

Query  426  KKVDSWCKAVSRTFDLAD  373
            KK +SWC+AV RTF+LAD
Sbjct  61   KKAESWCRAVERTFNLAD  78



>emb|CDY03995.1| BnaC02g37100D [Brassica napus]
Length=180

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 11/74 (15%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADL  598
            SH ARAV ESMCFQV+DVLDS++          N++GEF LRVDG AT NNLLM IQADL
Sbjct  78   SHIARAVLESMCFQVKDVLDSLN----------NEKGEFFLRVDGAATANNLLMHIQADL  127

Query  597  LGSPVVRPADIETT  556
            +G+PVVRP DIETT
Sbjct  128  MGTPVVRPVDIETT  141



>ref|WP_020538754.1| glycerol kinase [Lewinella cohaerens]
Length=499

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 83/131 (63%), Gaps = 11/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ FQ +DVLD+M KDAG        R    L+VDGGA+ NNLLMQ QAD+L  P
Sbjct  376  RATLESLAFQTKDVLDAMEKDAG--------RPLTTLKVDGGASANNLLMQFQADMLDVP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP+ IETTALGAAY AG+AVG W+++E+ +   K + D  F P +  E R K    W 
Sbjct  428  VERPSIIETTALGAAYLAGIAVGYWSQEELAA---KWQLDASFSPDMISEDRAKLYKGWQ  484

Query  405  KAVSRTFDLAD  373
            KAV RT D  D
Sbjct  485  KAVKRTMDWED  495



>ref|WP_009289239.1| MULTISPECIES: glycerol kinase [Anaerostipes]
 gb|EFV23466.1| glycerol kinase [Anaerostipes sp. 3_2_56FAA]
 emb|CDC33870.1| glycerol kinase [Anaerostipes sp. CAG:276]
Length=498

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ FQV DVL +M  D G             L+VDGGA+ NNLLMQ+QAD+ G+P
Sbjct  376  RATLESIAFQVNDVLKAMEADGGIHLSS--------LKVDGGASQNNLLMQMQADISGAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA +ETTA+GAAY AGLAVG W   E  S  E M+ D +F+P I EE R+KKV  W 
Sbjct  428  VHRPACVETTAMGAAYLAGLAVGYWDSKEKLS--ENMEIDCVFEPQISEEEREKKVSGWK  485

Query  405  KAVSRTFDLA  376
            +AV  ++  A
Sbjct  486  RAVRYSYGWA  495



>ref|WP_006567424.1| glycerol kinase [Anaerostipes caccae]
 gb|EDR97336.1| glycerol kinase [Anaerostipes caccae DSM 14662]
Length=498

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 83/130 (64%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ FQV DVL +M  D G             L+VDGGA+ NNLLMQ+QAD+ G+P
Sbjct  376  RATLESIAFQVNDVLKAMEADGGIHLSS--------LKVDGGASQNNLLMQMQADISGAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA +ETTA+GAAY AGLAVG W   E  S  E M+ D +F+P I EE R+KKV  W 
Sbjct  428  VHRPACVETTAMGAAYLAGLAVGYWDSKEKLS--ENMEIDCVFEPQISEEEREKKVSGWK  485

Query  405  KAVSRTFDLA  376
            +AV  ++  A
Sbjct  486  RAVRYSYGWA  495



>ref|WP_041694822.1| glycerol kinase [Alicyclobacillus acidocaldarius]
Length=501

 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M +D+G   E+K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  379  RATLESLAYQTKDILDAMQRDSGI--ELKS------LRVDGGAVANNLLMQFQADILGVP  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAVG WT+DEI  SG+    D  F P ++ E R +    W 
Sbjct  431  VERPQIAESTALGAAYLAGLAVGFWTKDEIARSGD---LDRRFDPQMDSETRARLYRGWQ  487

Query  405  KAVSRTFDLA  376
            +AV RT   A
Sbjct  488  RAVERTMGWA  497



>ref|XP_003288686.1| hypothetical protein DICPUDRAFT_34436 [Dictyostelium purpureum]
 gb|EGC34771.1| hypothetical protein DICPUDRAFT_34436 [Dictyostelium purpureum]
Length=529

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 83/132 (63%), Gaps = 14/132 (11%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV ES C Q  +VL++M KD+GD            LRVDGG   NNLL+Q QADLL  
Sbjct  386  ARAVLESTCLQTYEVLEAMQKDSGDT--------LLELRVDGGMAKNNLLLQTQADLLSL  437

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVV+P ++ETT  GAA+AAGLAVG+W E   F  G K      F P ++++ + KKV+ W
Sbjct  438  PVVKPCNLETTCFGAAFAAGLAVGVWKESMEFKVGSK------FTPQLDQKNKMKKVNEW  491

Query  408  CKAVSRTFDLAD  373
             KAVS++ +  D
Sbjct  492  KKAVSKSLNWVD  503



>gb|AEJ42051.1| glycerol kinase [Alicyclobacillus acidocaldarius subsp. acidocaldarius 
Tc-4-1]
Length=525

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M +D+G   E+K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  403  RATLESLAYQTKDILDAMQRDSGI--ELKS------LRVDGGAVANNLLMQFQADILGVP  454

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAVG WT+DEI  SG+    D  F P ++ E R +    W 
Sbjct  455  VERPQIAESTALGAAYLAGLAVGFWTKDEIARSGD---LDRRFDPQMDSETRARLYRGWQ  511

Query  405  KAVSRTFDLA  376
            +AV RT   A
Sbjct  512  RAVERTMGWA  521



>ref|WP_040288263.1| glycerol kinase, partial [Alicyclobacillus hesperidum]
Length=502

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M  D+G    +K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  378  RATLESLAYQTKDILDAMQADSGI--HLKS------LRVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAVG WT DEI  +GE  +K   F+P ++E+ R +    W 
Sbjct  430  VERPLVTESTALGAAYLAGLAVGFWTMDEIAQNGEIERK---FEPEMDEQTRHELYRGWQ  486

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  487  KAVKRTMGWA  496



>gb|EJY57173.1| glycerol kinase [Alicyclobacillus hesperidum URH17-3-68]
Length=514

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M  D+G    +K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  378  RATLESLAYQTKDILDAMQADSGI--HLKS------LRVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAVG WT DEI  +GE  +K   F+P ++E+ R +    W 
Sbjct  430  VERPLVTESTALGAAYLAGLAVGFWTMDEIAQNGEIERK---FEPEMDEQTRHELYRGWQ  486

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  487  KAVKRTMGWA  496



>ref|WP_030528182.1| glycerol kinase [Phycicoccus jejuensis]
Length=505

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RDV D+M KD+G + EV        L+VDGG T N+L MQIQAD+LG 
Sbjct  382  ARATLEAICYQSRDVADAMEKDSGVRLEV--------LKVDGGVTANDLCMQIQADVLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP   ETTALG+AYAAGLAVG W++ E   +     +D  + PV  EE R++    W
Sbjct  434  PVSRPVVAETTALGSAYAAGLAVGFWSDPEELRA--NWNEDRRWTPVWSEEERQEGYRGW  491

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  492  QKAVTRTLD  500



>ref|WP_034782288.1| glycerol kinase, partial [Exiguobacterium mexicanum]
 gb|KGI83764.1| glycerol kinase, partial [Exiguobacterium mexicanum]
Length=190

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 83/132 (63%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M  D+G++ +         LRVDGGA  NN LMQ QAD+LG+P
Sbjct  68   RATLESIAYQTRDVLDAMQADSGERLKA--------LRVDGGAVANNFLMQFQADILGTP  119

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   E+TALGAAY AGLAVG W + DE+ S   K   + +FKP IE   R  K + W
Sbjct  120  VERPEVRESTALGAAYLAGLAVGFWNDLDELQS---KATIERVFKPGIETTERNFKYEGW  176

Query  408  CKAVSRTFDLAD  373
             KAV+R  +  D
Sbjct  177  KKAVARAQEWED  188



>ref|XP_002951253.1| hypothetical protein VOLCADRAFT_91722 [Volvox carteri f. nagariensis]
 gb|EFJ47782.1| hypothetical protein VOLCADRAFT_91722 [Volvox carteri f. nagariensis]
Length=504

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 84/132 (64%), Gaps = 15/132 (11%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFV-LRVDGGATVNNLLMQIQADLLGS  589
            RA+ E++CFQ R+VLD+M +DA    E+    G    LRVDGGA  N+LLMQ+QADLL  
Sbjct  373  RAMLEAICFQTREVLDAMRRDA----ELDEHHGGLAALRVDGGAAANDLLMQLQADLLQV  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRPA  ETT+LGAA AAGLAV +W+++E           T F+P +      ++ D W
Sbjct  429  PVVRPAFRETTSLGAALAAGLAVNMWSKEEA----------TAFQPGVTPAAAGRRYDRW  478

Query  408  CKAVSRTFDLAD  373
             KAV R  DLAD
Sbjct  479  RKAVERALDLAD  490



>ref|WP_013824342.1| glycerol kinase [Desulfotomaculum kuznetsovii]
 gb|AEG16836.1| Glycerol kinase [Desulfotomaculum kuznetsovii DSM 6115]
Length=501

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +S+ +Q RDVL++M  D+G K +         L+VDGGA  NNLLMQ QAD+LG P
Sbjct  378  RATLDSLAYQTRDVLEAMEVDSGIKLQA--------LKVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA IETTA GAA  AGLAVG W+  E  ++G ++  D  F+P + EE R++    W 
Sbjct  430  VERPAVIETTARGAANLAGLAVGFWSGKEELAAGYQL--DRRFEPAMSEEQRERLYRGWK  487

Query  405  KAVSRTFDLAD  373
             AV+R  D A+
Sbjct  488  LAVTRAMDWAE  498



>ref|WP_040860438.1| glycerol kinase [Nocardia niigatensis]
Length=508

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 86/133 (65%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M +D+G +           LRVDGG T N L MQIQAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQQDSGVR--------LGTLRVDGGVTANELAMQIQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+ ++    ++D  ++P + EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWRSTDELVAN---WREDRNWQPAMTEEQRRRGYTR  490

Query  411  WCKAVSRTFDLAD  373
            W KAVSRT D  D
Sbjct  491  WRKAVSRTLDWVD  503



>ref|WP_026960945.1| glycerol kinase [Alicyclobacillus herbarius]
Length=503

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 85/131 (65%), Gaps = 12/131 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M KD+G   E++       LRVDGGA+ NNLLMQ QAD+LG P
Sbjct  378  RATLESLAYQTKDILDAMQKDSGI--ELQQ------LRVDGGASANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            VVRPA IE+TALGAAY AGLAVG WTE ++  +G  +++   F P +  E R      W 
Sbjct  430  VVRPAVIESTALGAAYLAGLAVGFWTEADL--TGGAIERR--FDPCMPPETRNALYAGWK  485

Query  405  KAVSRTFDLAD  373
             AVSR    AD
Sbjct  486  NAVSRVMGWAD  496



>ref|WP_018267275.1| glycerol kinase [Methylosinus sp. LW4]
Length=493

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 86/132 (65%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ FQ RDV+ +M +D+G   E         LRVDGG  VN LLMQ QAD+LG+
Sbjct  372  ARAALEAVAFQTRDVVAAMAEDSGVALEE--------LRVDGGMAVNALLMQFQADILGA  423

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP  IETTALGAAY AGLAVG W +    ++  + +K   + P++  E R++++  W
Sbjct  424  PVVRPRCIETTALGAAYTAGLAVGFWKDKREIATHWRAEKR--WSPMMSTEERERRIAKW  481

Query  408  CKAVSRTFDLAD  373
             KAV+R+FD  D
Sbjct  482  AKAVTRSFDWTD  493



>ref|WP_033086797.1| glycerol kinase [Nocardia seriolae]
 dbj|GAM45888.1| glycerol kinase [Nocardia seriolae]
Length=512

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 85/130 (65%), Gaps = 12/130 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M +D+G    VK D     LRVDGG T N L MQIQAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQQDSG----VKLD----TLRVDGGVTANELAMQIQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W   DE+ ++    ++D  ++P   E+ R+K    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWRNTDELVAN---WREDKNWQPAWTEDARQKGYAR  490

Query  411  WCKAVSRTFD  382
            W KAVSRT D
Sbjct  491  WLKAVSRTLD  500



>ref|XP_005851284.1| hypothetical protein CHLNCDRAFT_18995 [Chlorella variabilis]
 gb|EFN59182.1| hypothetical protein CHLNCDRAFT_18995 [Chlorella variabilis]
Length=543

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 8/131 (6%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA+ E++CFQ  DVL +M +DA D  E++       L VDGGA+ N+LLMQ+QAD+L  P
Sbjct  384  RAMLEAICFQTLDVLLAMQQDA-DCSELRT------LFVDGGASQNSLLMQMQADILQVP  436

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA +ETT+LGAA AAG+ VG WT +E F    K    T+F+P I      ++   W 
Sbjct  437  VRRPAHMETTSLGAALAAGIGVGFWTAEEAFED-LKHNTGTLFEPQITAAAASRRHAKWK  495

Query  405  KAVSRTFDLAD  373
            KAV R+F LAD
Sbjct  496  KAVERSFALAD  506



>ref|WP_027488741.1| glycerol kinase [Rhizobium undicola]
Length=502

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 3/128 (2%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+MHKD       + D+   VLRVDGG + +N  MQ  AD+L +
Sbjct  375  ARAALEAVCYQTRDLLDAMHKDWASDSRERADQA-MVLRVDGGMSASNWTMQRLADILDA  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RPA +ETTALGAA+ A    G+W + E F+      +D  F P ++E  R +K+  W
Sbjct  434  PVDRPAIVETTALGAAFLAASRAGLWPDREAFA--RAWARDERFTPAMDEATRTQKLRGW  491

Query  408  CKAVSRTF  385
             +AV RT 
Sbjct  492  REAVKRTL  499



>ref|WP_018085303.1| glycerol kinase [Desulfurispora thermophila]
Length=499

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 79/131 (60%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVL +M  D+G K           L+VDGGA  NNLLMQ QAD+LG P
Sbjct  378  RAALESLAYQTRDVLGAMEADSGIK--------LTALKVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLAVG W   E  +S  + K D+ F P +  E R+K    W 
Sbjct  430  VERPQVIETTALGAAYLAGLAVGFWQSKEELAS--RWKLDSRFAPQMAAEQREKLYRGWQ  487

Query  405  KAVSRTFDLAD  373
            KAV R  D A+
Sbjct  488  KAVRRAMDWAE  498



>ref|XP_003056322.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59698.1| predicted protein [Micromonas pusilla CCMP1545]
Length=558

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 92/156 (59%), Gaps = 25/156 (16%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDA----GDKGEVKND-----RGEF----VLRVDGGATVN  628
            ARA+ +++CFQV+DVLD+M  D     G+ G V+N         F    VLRVDGGAT N
Sbjct  401  ARALLDAICFQVKDVLDAMIADVCRRPGESGYVENSDQLKSTASFSVPNVLRVDGGATAN  460

Query  627  NLLMQIQADLLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFS------------SG  484
             LLMQ QAD+LG  + RP D+ETTALGAA AAG+  G+W+E+++F+             G
Sbjct  461  ALLMQTQADVLGMEISRPRDVETTALGAALAAGIGAGLWSEEDVFAREGDFERVGDGDGG  520

Query  483  EKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRTFDLA  376
                  T F+P    E R K+   WC+AV ++F LA
Sbjct  521  ADETATTTFEPRTTAEERAKRFALWCEAVGKSFGLA  556



>ref|XP_641267.1| hypothetical protein DDB_G0280371 [Dictyostelium discoideum AX4]
 sp|Q54VT8.1|GLPK_DICDI RecName: Full=Probable glycerol kinase; Short=GK; Short=Glycerokinase; 
AltName: Full=ATP:glycerol 3-phosphotransferase [Dictyostelium 
discoideum]
 gb|EAL67412.1| hypothetical protein DDB_G0280371 [Dictyostelium discoideum AX4]
Length=539

 Score = 99.0 bits (245),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 14/132 (11%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            AR+V ES C Q  +VLD+M KD+G+K           LRVDGG   NNLL+QIQ+DLLG 
Sbjct  419  ARSVLESTCLQTFEVLDAMQKDSGNK--------LVELRVDGGMAKNNLLLQIQSDLLGL  470

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVV+P  +ETT  GAA+AAG+A G+W E   F  G K      F P ++E  + +K+  W
Sbjct  471  PVVKPISLETTCFGAAFAAGIATGVWKETMQFKIGGK------FTPQLDENHKTQKLKEW  524

Query  408  CKAVSRTFDLAD  373
             KA+S++ D  D
Sbjct  525  KKAISKSLDWID  536



>emb|CAN60752.1| hypothetical protein VITISV_031768 [Vitis vinifera]
Length=180

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = -2

Query  735  VRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPADIETT  556
             +DVL SMHKDAG+KGEVKN++  F+L V GGAT+ NLLMQIQADLL +PVVRP DIETT
Sbjct  107  AKDVLVSMHKDAGEKGEVKNEKEVFLLTVAGGATITNLLMQIQADLLRNPVVRPGDIETT  166

Query  555  algaayaaglAVGI  514
            ALGAAYA GLAVGI
Sbjct  167  ALGAAYATGLAVGI  180



>ref|WP_012809514.1| glycerol kinase [Alicyclobacillus acidocaldarius]
 gb|ACV57119.1| glycerol kinase [Alicyclobacillus acidocaldarius subsp. acidocaldarius 
DSM 446]
Length=501

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +S+ +Q +D+LD+M +D+G   E+K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  379  RATLDSLAYQTKDILDAMQRDSGI--ELKS------LRVDGGAVANNLLMQFQADILGVP  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAVG W++DEI  SG+  ++   F P ++ E R +    W 
Sbjct  431  VERPRITESTALGAAYLAGLAVGFWSKDEIARSGDIERR---FDPQMDAETRARLYRGWQ  487

Query  405  KAVSRTFDLA  376
            +AV RT   A
Sbjct  488  RAVERTMGWA  497



>ref|WP_028239012.1| glycerol kinase [Pseudomonas azotifigens]
Length=499

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 83/131 (63%), Gaps = 12/131 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++      RG   LRVDGGA  NN LMQ QADLLG+P
Sbjct  378  RATLESIAYQTRDVLDAMQQDAGER-----LRG---LRVDGGAVANNFLMQFQADLLGTP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RPA  ETTALGAAY AGLA G W   DE+ S   K   + +F+P +  E R++    W
Sbjct  430  VERPAMKETTALGAAYLAGLATGYWGSLDELRS---KATIERVFEPAMSPEHRERLYRGW  486

Query  408  CKAVSRTFDLA  376
             KAV RT   A
Sbjct  487  RKAVERTRGWA  497



>ref|WP_014400151.1| glycerol kinase [Corallococcus coralloides]
 gb|AFE08938.1| glycerol kinase [Corallococcus coralloides DSM 2259]
Length=494

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  777  VSH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            V+H ARA  E +  Q+ D+ ++M KD+G        R   V + DGGA  NNLLMQ QAD
Sbjct  374  VAHLARATLEGVALQIHDLAEAMRKDSG--------RNIPVFKADGGAAANNLLMQYQAD  425

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            LLG PVVRP ++ETT+LGAA+  GL  G+WT  +        K D  FKP ++ EVR + 
Sbjct  426  LLGVPVVRPRNLETTSLGAAFLGGLGAGVWTSPDAIR--RAWKADKTFKPKMKPEVRARH  483

Query  420  VDSWCKAVSR  391
            ++ W +AVSR
Sbjct  484  LEKWKQAVSR  493



>gb|EFA75245.1| Glycerol kinase 2 [Polysphondylium pallidum PN500]
Length=519

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 15/132 (11%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA+ ES CFQ  +VL SM KD+ DK           LRVDGG T+N+LL+QIQAD+LG 
Sbjct  402  ARAMLESTCFQTYEVLKSMEKDSNDK--------LVELRVDGGMTMNDLLLQIQADILGL  453

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP ++ETT  GAAYAAGL VG+W+    F  G++   +    P I+     K+++ W
Sbjct  454  PVVRPHNLETTCFGAAYAAGLTVGVWSSAMQFHIGKRFTPN----PNID---HMKRINDW  506

Query  408  CKAVSRTFDLAD  373
             KAVS++ D  D
Sbjct  507  HKAVSKSVDWVD  518



>ref|WP_037022450.1| glycerol kinase [Pseudomonas sp. 20_BN]
 emb|CDZ93506.1| glycerol kinase [Pseudomonas sp. 20_BN]
Length=500

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 82/127 (65%), Gaps = 12/127 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG+            LRVDGGA  NN LMQ QADLLG+P
Sbjct  379  RAALESIAYQTRDVLDAMQQDAGEPLRS--------LRVDGGAVANNFLMQFQADLLGTP  430

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W++ DE+ S   K + + +F+P ++E  R+     W
Sbjct  431  VERPEMKETTALGAAYLAGLATGFWSDLDELRS---KARVERLFEPALDEARREALYGGW  487

Query  408  CKAVSRT  388
             KAVSRT
Sbjct  488  KKAVSRT  494



>ref|WP_025845445.1| glycerol kinase [Paenibacillus ehimensis]
Length=500

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA   S+ +Q +DVL +M  D+G K +         LRVDGGAT NNLLMQ QAD+LG P
Sbjct  378  RATLNSLAYQTKDVLGAMEIDSGLKLQS--------LRVDGGATANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AG+AVG W + EI +   +   DT+F+P I+E  R K    W 
Sbjct  430  VQRPQITETTALGAAYMAGIAVGFWDKTEIAA---RAGSDTVFEPGIDEPTRAKLYRGWK  486

Query  405  KAVSRTF  385
            KAV RT 
Sbjct  487  KAVDRTM  493



>ref|WP_028052024.1| glycerol kinase [Carboxydothermus ferrireducens]
Length=500

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ESM +Q RDVL +M  D+G K +         L+VDGGA  NNLLMQ QAD+LG P
Sbjct  378  RAALESMAYQTRDVLSAMEADSGIKLQA--------LKVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP +IETTA+GAAY AGLAVG W + +   +  K K    F+P ++E+ R+K    W 
Sbjct  430  VERPVNIETTAMGAAYLAGLAVGFWADKQELVT--KYKVSRRFEPTMDEQTREKLYKGWQ  487

Query  405  KAVSRT  388
            +AV+R 
Sbjct  488  RAVTRA  493



>ref|WP_011344733.1| glycerol kinase [Carboxydothermus hydrogenoformans]
 sp|Q3AB25.1|GLPK_CARHZ RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Carboxydothermus 
hydrogenoformans Z-2901]
 gb|ABB15269.1| glycerol kinase [Carboxydothermus hydrogenoformans Z-2901]
Length=500

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 80/126 (63%), Gaps = 10/126 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ESM +Q RDVL +M  D+G K +         L+VDGGA  NNLLMQ QAD+LG P
Sbjct  378  RAALESMAYQTRDVLSAMEADSGIKLQA--------LKVDGGAVANNLLMQFQADILGVP  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP +IETTA+GAAY AGLAVG W + +   +  K K    F+P ++E+ R+K    W 
Sbjct  430  VERPVNIETTAMGAAYLAGLAVGFWADKQELVA--KYKVSRRFEPTMDEQTREKLYKGWQ  487

Query  405  KAVSRT  388
            +AV+R 
Sbjct  488  RAVTRA  493



>ref|WP_040732517.1| glycerol kinase [Nocardia tenerifensis]
Length=506

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D  + P   EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDKRWNPTGSEEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAVSRT D  D
Sbjct  491  WQKAVSRTLDWID  503



>ref|WP_041059389.1| glycerol kinase [Cohnella sp. VKM B-2846]
 gb|KIL37645.1| glycerol kinase [Cohnella sp. VKM B-2846]
Length=500

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 11/128 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +S+ +Q +DVL +M  D+G K +         LRVDGGAT NNLLMQ QAD+LG  
Sbjct  378  RATLDSLAYQTKDVLGAMESDSGLKLQA--------LRVDGGATANNLLMQFQADILGVA  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP+  ETTALGAAY AG+AVG W +++I    +K  ++T+F+P +E+  R+K    W 
Sbjct  430  VQRPSVTETTALGAAYMAGIAVGFWNKNDI---AQKAGENTMFEPHMEDTERQKLYRGWK  486

Query  405  KAVSRTFD  382
            KAV RT +
Sbjct  487  KAVKRTMN  494



>ref|WP_019045228.1| MULTISPECIES: glycerol kinase [Actinomycetales]
 dbj|GAD87706.1| glycerol kinase [Nocardia asteroides NBRC 15531]
Length=505

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+ +Q RDV+++M +D+G +           LRVDGG T+N L MQIQADLLG 
Sbjct  382  ARATLESIAYQTRDVVEAMQRDSGVR--------LATLRVDGGVTMNKLAMQIQADLLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG+WT  DE+ ++     +D  + P   +E R +    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGVWTSTDELLAN---WHEDVRWFPTWSDEQRARGYGR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV RT D AD
Sbjct  491  WLKAVERTLDWAD  503



>gb|EGL82842.1| Carbohydrate kinase, FGGY [Caldalkalibacillus thermarum TA2.A1]
Length=114

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -2

Query  747  MCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPAD  568
            M +Q +DVLD+M KDAG K +         L+VDGGA  NN LMQ QAD+LG  V RP  
Sbjct  1    MAYQTKDVLDAMQKDAGLKLKT--------LKVDGGAVTNNFLMQFQADILGVNVERPKV  52

Query  567  IETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWCKAVSRT  388
             ETTALGAAY AGL VG W +DEI  + +    DT F+P +  E R      W KAV RT
Sbjct  53   TETTALGAAYLAGLEVGFWNKDEIIHNAQ---LDTTFQPHMSAEKRDTLYKKWQKAVKRT  109

Query  387  FD  382
             +
Sbjct  110  MN  111



>ref|WP_024728558.1| glycerol kinase [Clostridiales bacterium VE202-09]
Length=498

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ FQV DVL +M  D G             L+VDGGA+ NNLLMQ+QAD+ G+P
Sbjct  376  RATLESIAFQVNDVLKAMEADGGIHLSS--------LKVDGGASQNNLLMQMQADISGAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA +ETTA+GAAY AGLAVG W   E  S  E M  D +F+  I EE R+KKV  W 
Sbjct  428  VHRPACVETTAMGAAYLAGLAVGYWDSKEELS--ENMDIDCVFETQISEEEREKKVSGWK  485

Query  405  KAVSRTFDLA  376
            +AV  ++  A
Sbjct  486  RAVRYSYGWA  495



>gb|KHF78769.1| Glycerol kinase [Acinetobacter sp. neg1]
Length=504

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   +EV +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECGQEVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_023461610.1| glycerol kinase [Asticcacaulis sp. YBE204]
 gb|ESQ79502.1| glycerol kinase [Asticcacaulis sp. YBE204]
Length=494

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 82/127 (65%), Gaps = 11/127 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ FQ  DVL++M +D GD  E         LRVDGGA+ NNL+MQ QAD+LG 
Sbjct  373  ARAALEAIAFQSADVLEAMQRDGGDLKE---------LRVDGGASANNLMMQFQADILGV  423

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP   ETTALGAAY AGLAVG W + E   +    + D +F+P + ++ R  ++ +W
Sbjct  424  PVVRPTVTETTALGAAYLAGLAVGYWADTEELRA--LWQVDRVFEPAMSDDERAGRLATW  481

Query  408  CKAVSRT  388
             KAV R+
Sbjct  482  RKAVERS  488



>ref|WP_005259085.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2168]
 gb|ENX20751.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2168]
Length=504

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   +EV +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECGQEVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_004770367.1| glycerol kinase 1 [Acinetobacter sp. NIPH 758]
 gb|ENU94222.1| glycerol kinase 1 [Acinetobacter sp. NIPH 758]
Length=504

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   +EV +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECGQEVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_005231833.1| MULTISPECIES: glycerol kinase 1 [Acinetobacter]
 gb|EKU56776.1| glycerol kinase [Acinetobacter sp. WC-323]
 gb|ENX04730.1| glycerol kinase 1 [Acinetobacter sp. NIPH 1847]
 gb|ENX36701.1| glycerol kinase 1 [Acinetobacter sp. NIPH 3623]
 gb|EXB26046.1| glycerol kinase [Acinetobacter baumannii 1437282]
 gb|EXB46182.1| glycerol kinase [Acinetobacter baumannii 146457]
 gb|EYT16984.1| glycerol kinase [Acinetobacter baumannii 1000160]
Length=504

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   +EV +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECGQEVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_018592342.1| glycerol kinase [Terrisporobacter glycolicus]
Length=509

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 14/132 (11%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ FQV DVL +M  D+G + E         L+VDGGA+ NNLLMQ+Q+D++ +P
Sbjct  376  RATLESLAFQVNDVLQAMKADSGIELEA--------LKVDGGASANNLLMQMQSDMIDAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWT--EDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            V RP  +ETTA+GAAY AGLAVG W   ED I + G     D IF+P I  E RK+K++ 
Sbjct  428  VKRPVCVETTAMGAAYLAGLAVGYWQSKEDVIKNWG----IDEIFEPAISCEERKEKIEG  483

Query  411  WCKAVSRTFDLA  376
            W KAV R++  A
Sbjct  484  WNKAVKRSYGWA  495



>ref|WP_029872306.1| glycerol kinase [Rhizobium leguminosarum]
Length=497

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++C+Q RD+LD+MHKD       KN   + VLRVDGG   +N  MQ  ADLL +
Sbjct  375  SRAALEAVCYQTRDLLDAMHKD------WKNGTEDTVLRVDGGMVASNWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRDGFSA--TWKRDRRFEPEMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  KNAVKRTL  494



>ref|WP_027676630.1| glycerol kinase [Agrobacterium larrymoorei]
Length=497

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 8/131 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q  D+LD+MHKD       KN  G+ VLRVDGG   ++  MQ  +DL+ +
Sbjct  375  ARAALEAVCYQTGDLLDAMHKD------WKNANGDTVLRVDGGMVASDWTMQRLSDLIDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W   + FS  E   +D  F+P +EEEVR++K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPGMKEFS--EAWSRDRRFEPQMEEEVRERKLKGW  486

Query  408  CKAVSRTFDLA  376
              AV RT   A
Sbjct  487  KNAVRRTLSNA  497



>ref|WP_021899791.1| glycerol kinase [Eggerthella sp. CAG:1427]
 emb|CCY06425.1| glycerol kinase [Eggerthella sp. CAG:1427]
Length=498

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 79/130 (61%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +QV DVL +M  D+G             LRVDGGA+ NN LMQ QAD++G+P
Sbjct  376  RATLESIAYQVNDVLGAMEADSG--------IALTSLRVDGGASANNFLMQTQADIIGAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTA+GAAY AGLAVG W   E     E    D  F+P IEE  R++K+  W 
Sbjct  428  VKRPQCIETTAMGAAYLAGLAVGYWESREEVE--ENWAVDQTFEPAIEEVKRQEKIKGWN  485

Query  405  KAVSRTFDLA  376
            KAV  +FD A
Sbjct  486  KAVRYSFDWA  495



>ref|WP_036991283.1| glycerol kinase, partial [Pseudomonas stutzeri]
Length=156

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  35   RAALESIAYQTRDVLDAMQQDAGERLRA--------LRVDGGAVANNFLMQFQADMLGTQ  86

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W++ DE+ S   K   + +F+P    E R+     W
Sbjct  87   VERPQMKETTALGAAYLAGLATGFWSDLDELRS---KSSIERVFEPACGSEQREALYRGW  143

Query  408  CKAVSRTFDLAD  373
             KAV RT + A+
Sbjct  144  QKAVDRTRNWAE  155



>ref|WP_025028478.1| glycerol kinase [Bacillus mannanilyticus]
Length=500

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 83/128 (65%), Gaps = 11/128 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +S+ +Q +DVL +M KD+G    +K+      LRVDGGA  NN+LMQ Q+D+LG  
Sbjct  378  RATLDSLAYQTKDVLSAMEKDSGIT--LKS------LRVDGGAVANNVLMQFQSDILGVQ  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETTALGAAY +GLAVG W +++I +S      D +F+P +EEE R K    W 
Sbjct  430  VERPAVTETTALGAAYLSGLAVGFWNKEDILNSSS---LDKVFEPYMEEEKRSKLYKKWQ  486

Query  405  KAVSRTFD  382
            KAV RT D
Sbjct  487  KAVKRTMD  494



>ref|WP_035625622.1| glycerol kinase [Lachnospiraceae bacterium C6A11]
Length=496

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ ++ +DVL +M KD G K           LRVDGGA+ NN L+Q +ADL+ + 
Sbjct  376  RATLESIAYETQDVLTAMEKDTGLKLSE--------LRVDGGASANNFLLQTEADLINAT  427

Query  585  VVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V+RP  +E+TA+GAA+ AGLAVG W + DE+ +    +  D +F PVI EE R+KK+  W
Sbjct  428  VIRPGCLESTAMGAAFLAGLAVGYWESRDELRTV---LSIDRVFNPVISEEEREKKLSGW  484

Query  408  CKAVSRTFDLAD  373
             KAV R+FD A+
Sbjct  485  KKAVERSFDWAE  496



>ref|WP_027508274.1| glycerol kinase [Rhizobium sullae]
Length=497

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+M KD       +N + + VLRVDGG   ++  MQ  ADLL +
Sbjct  375  ARAALEAVCYQTRDLLDAMQKD------WRNGKDDTVLRVDGGMVASDWTMQRLADLLEA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RPA +ETTALGAA+ AG   G+W + + FS+  K K+D  F+P ++E+ R  K+  W
Sbjct  429  PVDRPAILETTALGAAWLAGSRAGVWPDRKTFSA--KWKRDRRFEPDMDEKTRAAKIKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVKRTL  494



>gb|EHY77295.1| glycerol kinase [Pseudomonas stutzeri ATCC 14405 = CCUG 16156]
Length=156

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 81/132 (61%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  35   RAALESIAYQTRDVLDAMQQDAGERLRA--------LRVDGGAVANNFLMQFQADMLGTQ  86

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W++ DE+ S   K   + +F+P    E R+     W
Sbjct  87   VERPQMKETTALGAAYLAGLATGFWSDLDELRS---KSSIERVFEPACGSEQREALYRGW  143

Query  408  CKAVSRTFDLAD  373
             KAV RT + A+
Sbjct  144  QKAVDRTRNWAE  155



>ref|WP_008337869.1| glycerol kinase [Alicyclobacillus acidocaldarius]
 gb|EED08018.1| glycerol kinase [Alicyclobacillus acidocaldarius LAA1]
Length=501

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 84/130 (65%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +D+LD+M +D+G   E+K+      LRVDGGA  NNLLMQ QAD+LG P
Sbjct  379  RATLESLAYQTKDILDAMQRDSGI--ELKS------LRVDGGAVANNLLMQFQADILGVP  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   E+TALGAAY AGLAV  W++DEI  SG+  ++   F P ++ E R +    W 
Sbjct  431  VERPRITESTALGAAYLAGLAVEFWSKDEIARSGDIERR---FDPQMDAETRARLYRGWQ  487

Query  405  KAVSRTFDLA  376
            +AV RT   A
Sbjct  488  RAVERTMGWA  497



>ref|WP_042264218.1| glycerol kinase [Nocardia brasiliensis]
 dbj|GAJ86376.1| glycerol kinase [Nocardia brasiliensis NBRC 14402]
Length=506

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D  + P   EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDKRWNPTWTEEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_004652021.1| glycerol kinase 1 [Acinetobacter sp. NIPH 809]
 gb|ENU25319.1| glycerol kinase 1 [Acinetobacter sp. NIPH 809]
Length=504

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_024878177.1| glycerol kinase [Methylosinus sp. LW3]
Length=493

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 86/132 (65%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ FQ RD++ +M +D+G   E         LRVDGG  VN LLMQ QAD+LG+
Sbjct  372  ARAALEAVAFQTRDIVAAMAEDSGVALEE--------LRVDGGMAVNALLMQFQADILGA  423

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP  IETTALGAAYAAGLA G W +    ++  + +K   + P + +E R++++  W
Sbjct  424  PVVRPRCIETTALGAAYAAGLASGFWKDKREIAAHWRAEKR--WSPTMSKEERERRIGKW  481

Query  408  CKAVSRTFDLAD  373
             KAV+R+FD  D
Sbjct  482  AKAVTRSFDWTD  493



>ref|WP_016541215.1| Glycerol kinase [Acinetobacter gyllenbergii]
 gb|EPF90637.1| glycerol kinase [Acinetobacter gyllenbergii CIP 110306]
 gb|EPH33946.1| Glycerol kinase [Acinetobacter gyllenbergii MTCC 11365]
 gb|ESK35541.1| glycerol kinase [Acinetobacter gyllenbergii NIPH 230]
Length=504

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_005296128.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2100]
 gb|ENX40479.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2100]
Length=504

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|XP_006302136.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
 gb|EOA35034.1| hypothetical protein CARUB_v10020141mg [Capsella rubella]
Length=444

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQ  607
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGAT NNLLMQIQ
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGATANNLLMQIQ  441



>ref|WP_013549579.1| glycerol kinase [Cellulophaga algicola]
 gb|ADV48089.1| glycerol kinase [Cellulophaga algicola DSM 14237]
Length=495

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 82/129 (64%), Gaps = 11/129 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            A+A  +S+ +QV+D+L +M  D+G K +         L+VDGGA  NN LMQ QAD+L  
Sbjct  374  AKATLDSLGYQVKDILQAMQSDSGIKLKC--------LKVDGGAAANNYLMQFQADILNK  425

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             V+RP  IE+TALGAAY AG+ VG+W+ED+I  S      D IF+P + +++R K    W
Sbjct  426  NVIRPKSIESTALGAAYMAGITVGMWSEDDILKS---RTVDKIFEPNVSKQLRNKMYAGW  482

Query  408  CKAVSRTFD  382
             KAV RT +
Sbjct  483  KKAVKRTMN  491



>ref|WP_036687373.1| glycerol kinase [Paenibacillus sp. MSt1]
 gb|KEQ23842.1| glycerol kinase [Paenibacillus sp. MSt1]
Length=500

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 78/127 (61%), Gaps = 11/127 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA   S+ +Q +DVL +M  D+G K +         LRVDGGAT NNLLMQ QAD+LG  
Sbjct  378  RATLNSLAYQTKDVLGAMEIDSGLKLQS--------LRVDGGATANNLLMQFQADILGVA  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AG+AVG W + EI S   +   DTIF+P I+E  R K    W 
Sbjct  430  VQRPQITETTALGAAYMAGIAVGFWDKAEIAS---RAGSDTIFEPGIDEPTRAKLYRGWK  486

Query  405  KAVSRTF  385
            KAV RT 
Sbjct  487  KAVDRTM  493



>ref|WP_025242527.1| glycerol kinase [Pseudomonas stutzeri]
 gb|AHL76321.1| glycerol kinase [Pseudomonas stutzeri]
Length=503

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 82/132 (62%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QADLLG+ 
Sbjct  382  RAALESIAYQTRDVLDAMQQDAGERLRS--------LRVDGGAVANNFLMQFQADLLGTH  433

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W+  DE+ S   K   + IF+P  ++E R+     W
Sbjct  434  VERPQMKETTALGAAYLAGLATGFWSSLDELRS---KATIERIFEPACDDEKREALYQGW  490

Query  408  CKAVSRTFDLAD  373
             KAV RT D A+
Sbjct  491  KKAVGRTRDWAE  502



>ref|WP_036584799.1| glycerol kinase [Paenibacillus darwinianus]
 gb|EXX85821.1| glycerol kinase [Paenibacillus darwinianus]
 gb|EXX89236.1| glycerol kinase [Paenibacillus darwinianus]
 gb|EXX90035.1| glycerol kinase [Paenibacillus darwinianus]
Length=500

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 78/128 (61%), Gaps = 11/128 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA   S+ +Q +DVL +M  D+G + +         LRVDGGAT NNLLMQ QAD+LG  
Sbjct  378  RATLNSLAYQTKDVLRAMESDSGLRLQS--------LRVDGGATANNLLMQFQADILGVD  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLAVG W   E+ S+      DT F P +EE VR K  + W 
Sbjct  430  VCRPQVTETTALGAAYLAGLAVGFWDRSELMSNS---TTDTRFAPHMEEAVRTKLYNGWK  486

Query  405  KAVSRTFD  382
            KAV RT +
Sbjct  487  KAVKRTME  494



>ref|WP_009610750.1| glycerol kinase [Caldanaerobacter subterraneus]
 sp|Q8R8J4.1|GLPK_THETN RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 gb|AAM25180.1| Glycerol kinase [Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 gb|EEB75597.1| glycerol kinase [Caldanaerobacter subterraneus subsp. pacificus 
DSM 12653]
Length=497

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVL++M +D+G K +         L+VDGGA+ NN LMQ QAD+LG P
Sbjct  376  RATLESIAYQTRDVLEAMQEDSGIKLQA--------LKVDGGASANNFLMQFQADILGVP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLAVG W   E       +  D  F+P +EEE R+K    W 
Sbjct  428  VDRPQVIETTALGAAYLAGLAVGFWNSREEIEKNWNI--DRRFEPAMEEEKREKLYRGWK  485

Query  405  KAVSRTFDLAD  373
            KAV R    A+
Sbjct  486  KAVERAMKWAE  496



>ref|WP_022587917.1| glycerol kinase [Caldanaerobacter subterraneus]
 gb|ERM92050.1| glycerol kinase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=497

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVL++M +D+G K +         L+VDGGA+ NN LMQ QAD+LG P
Sbjct  376  RATLESIAYQTRDVLEAMQEDSGIKLQA--------LKVDGGASANNFLMQFQADILGVP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLAVG W   E       +  D  F+P +EEE R+K    W 
Sbjct  428  VDRPQVIETTALGAAYLAGLAVGFWNSREEIEKNWNI--DRRFEPAMEEEKREKLYRGWK  485

Query  405  KAVSRTFDLAD  373
            KAV R    A+
Sbjct  486  KAVERAMKWAE  496



>ref|WP_018326861.1| glycerol kinase [Rhizobium giardinii]
Length=497

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+MHKD       ++D  E VLRVDGG  V++  MQ  ADLL +
Sbjct  375  ARAALEAVCYQTRDLLDAMHKD------WRSDGKETVLRVDGGMVVSDWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALG A+ AG   G+W   + F+  +   KD  F+P ++E  RK K+  W
Sbjct  429  PVDRPTILETTALGVAWLAGSRAGVWPNQKDFA--KSWAKDHRFEPKMDEATRKTKIKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  KDAVRRTL  494



>ref|WP_034666258.1| glycerol kinase [Cellulophaga sp. E6(2014)]
 gb|KGK31387.1| glycerol kinase [Cellulophaga sp. E6(2014)]
Length=495

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 82/129 (64%), Gaps = 11/129 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            A+A  +S+ +QV+D+L +M  D+G K +         L+VDGGA  NN LMQ QAD+L  
Sbjct  374  AKATLDSLGYQVKDILQAMQSDSGIKLKC--------LKVDGGAAANNYLMQFQADILNK  425

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             V+RP  IE+TALGAAY AG+ +G+W+ED+I  S      D IF+P + +++R K    W
Sbjct  426  NVIRPKSIESTALGAAYMAGITIGMWSEDDILKS---RTVDKIFEPNVSKQLRNKMYAGW  482

Query  408  CKAVSRTFD  382
             KAV RT +
Sbjct  483  KKAVKRTMN  491



>ref|WP_043663224.1| glycerol kinase [Nocardia vulneris]
 gb|KIA66675.1| glycerol kinase [Nocardia vulneris]
Length=506

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D  + P   EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDKRWNPTGTEEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_033429062.1| glycerol kinase [Saccharothrix syringae]
Length=500

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 86/130 (66%), Gaps = 12/130 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+D+M+ D+G             L+VDGG  VN LLMQ QAD+LG 
Sbjct  379  ARAVLEATAFQTREVIDAMNADSG--------VALTSLKVDGGMVVNELLMQFQADILGV  430

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D  ++P ++EE R++    
Sbjct  431  PVIRPVVNETTALGAAYAAGLAVGFWESEDDIR---QNWARDKQWEPAMDEEARERHYHL  487

Query  411  WCKAVSRTFD  382
            W KAV+RTFD
Sbjct  488  WKKAVTRTFD  497



>ref|WP_035945306.1| hypothetical protein [Fusobacterium perfoetens]
Length=142

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 10/128 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVL++M +D+G    +K +     L+VDGGA  N+ LM+ QAD+LG+ 
Sbjct  21   RATLESIAYQTRDVLEAMQEDSG----LKLNH----LKVDGGAAANDFLMEFQADILGTS  72

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  +ETT LG AY  GLAVG W   E  SS  K++K+  F P + EE ++KK   W 
Sbjct  73   VRRPETLETTGLGVAYLTGLAVGFWESKEEISSQWKLEKE--FLPTMCEEEKEKKYRGWK  130

Query  405  KAVSRTFD  382
            KAV R  +
Sbjct  131  KAVKRAME  138



>ref|WP_029901568.1| glycerol kinase [Nocardia brasiliensis]
Length=506

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D  + P   EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDKRWNPTGTEEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_018133536.1| glycerol kinase [Effusibacillus pohliae]
Length=500

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 79/127 (62%), Gaps = 11/127 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA   S+ +Q +DVL +M  D+G + +         LRVDGGAT NNLLMQ QAD+LG  
Sbjct  378  RATLHSLAYQTKDVLSAMESDSGIRLQA--------LRVDGGATANNLLMQFQADILGVQ  429

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETTALGAAY AG+AVG W + E+ S     + D +F+P ++E+ R +    W 
Sbjct  430  VERPAITETTALGAAYLAGIAVGFWNKQELASDS---RLDAVFEPQMDEQTRSRLYKGWK  486

Query  405  KAVSRTF  385
            KAV RT 
Sbjct  487  KAVKRTM  493



>ref|WP_014982240.1| glycerol kinase [Nocardia brasiliensis]
 gb|AFT99384.1| glycerol kinase [Nocardia brasiliensis ATCC 700358]
Length=506

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W+  DE+    +   +D  + P   EE R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSSTDELV---QNWHEDKRWNPTGTEEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_042617374.1| glycerol kinase [Agrobacterium tumefaciens]
 gb|KIQ02828.1| glycerol kinase [Agrobacterium tumefaciens]
Length=497

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q  D+LD+MHKD       KN  G+ VLRVDGG   ++  MQ  +DL+ +
Sbjct  375  ARAALEAVCYQTGDLLDAMHKD------WKNANGDTVLRVDGGMVASDWTMQRLSDLINA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS  E   +D  F+P +++E R++K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSKAGVWPDMKAFS--EAWSRDNRFEPQMDDETRERKIKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVRRTL  494



>ref|WP_038341960.1| glycerol kinase [Acinetobacter sp. A47]
Length=504

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K +         LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLKT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFTPECGQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_005243524.1| MULTISPECIES: glycerol kinase [Acinetobacter]
 gb|ENX12308.1| glycerol kinase 1 [Acinetobacter sp. CIP 64.2]
Length=504

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_016651637.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2036]
 gb|EPG40864.1| glycerol kinase 1 [Acinetobacter sp. NIPH 2036]
Length=504

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_042846678.1| glycerol kinase [Providencia rettgeri]
Length=508

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 83/132 (63%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M  D+G++ +         LRVDGGA  NN LMQ QAD+LG+P
Sbjct  386  RATLESIAYQTRDVLDAMQADSGERLKA--------LRVDGGAVANNFLMQFQADILGTP  437

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   E+TALGAAY AGLAVG W + DE+ S   K   + +FKP IE   R  K + W
Sbjct  438  VERPEVRESTALGAAYLAGLAVGFWNDLDELQS---KATIERVFKPGIETTERNFKYEGW  494

Query  408  CKAVSRTFDLAD  373
             KAV+R  +  D
Sbjct  495  KKAVARAQEWED  506



>ref|WP_014445904.1| glycerol kinase [Actinoplanes missouriensis]
 dbj|BAL91016.1| putative glycerol kinase [Actinoplanes missouriensis 431]
Length=505

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 86/133 (65%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RDV+D+M +D+G    V  D    VL+VDGG TVNNL MQIQAD+LG 
Sbjct  382  ARATLEAICYQTRDVVDAMAQDSG----VTLD----VLKVDGGITVNNLCMQIQADVLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+    E   +   ++P   +E R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWKSTDELR---ENWNESQRWQPNWSQEQREQGFGK  490

Query  411  WCKAVSRTFDLAD  373
            W KAV RT D  D
Sbjct  491  WKKAVQRTLDWVD  503



>ref|WP_005269757.1| glycerol kinase 1 [Acinetobacter sp. NIPH 1859]
 gb|ENX36247.1| glycerol kinase 1 [Acinetobacter sp. NIPH 1859]
Length=504

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_027888454.1| glycerol kinase [Meiothermus taiwanensis]
Length=496

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ +Q RDVL++M  DAG K           LRVDGGATVN+LLMQ QAD+LG+
Sbjct  375  ARAALEAIAYQSRDVLEAMKADAGLKLSE--------LRVDGGATVNDLLMQFQADILGT  426

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP   ETTALGAAY AG+ VG+ T+ +I       K+   F+P + +E R +    W
Sbjct  427  PVVRPQVTETTALGAAYLAGVGVGLLTQAQIARRWAVQKR---FEPAMGQEERARLYSGW  483

Query  408  CKAVSRTFDLAD  373
             KAV R    AD
Sbjct  484  KKAVERAKSWAD  495



>ref|WP_018880210.1| glycerol kinase [Thioalkalivibrio sp. ALE9]
Length=506

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 78/130 (60%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NNL+MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMAQDAGI--------GLKALRVDGGAVANNLMMQFQADMLGVR  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AGL VG WT DE+   G     D +F+P +E   R +    W 
Sbjct  431  VERPAVTESTALGAAWLAGLGVGFWTRDELRQKG---ALDRVFEPQMEAATRDRYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_004801481.1| glycerol kinase 1 [Acinetobacter sp. CIP 56.2]
 gb|ENV11353.1| glycerol kinase 1 [Acinetobacter sp. CIP 56.2]
Length=504

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_005202079.1| MULTISPECIES: glycerol kinase 1 [Acinetobacter]
 gb|ENX58738.1| glycerol kinase 1 [Acinetobacter sp. CIP 70.18]
 gb|ENX62542.1| glycerol kinase 1 [Acinetobacter sp. ANC 3880]
Length=504

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_005144845.1| MULTISPECIES: glycerol kinase 1 [Acinetobacter]
 gb|ENW78616.1| glycerol kinase 1 [Acinetobacter sp. ANC 3929]
 gb|ENW95160.1| glycerol kinase 1 [Acinetobacter sp. ANC 4105]
 gb|ENX56737.1| glycerol kinase 1 [Acinetobacter sp. NIPH 1867]
 gb|EOR09180.1| glycerol kinase 1 [Acinetobacter sp. CIP 110321]
Length=504

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD++G+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADIMGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   ++V +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIENTFVPECSQDVTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_040752000.1| glycerol kinase [Nocardia transvalensis]
Length=506

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARAALEAICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+  + ++ K+   + P   EE R+     
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWKDTDELAQNWQESKR---WNPTSTEEQRESGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAVSRT D  D
Sbjct  491  WKKAVSRTLDWID  503



>ref|WP_039846864.1| glycerol kinase [Rhizobium gallicum]
 gb|AJD42073.1| glycerol kinase 1 [Rhizobium gallicum bv. gallicum R602]
Length=497

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+M KD       KN + + VLRVDGG   ++  MQ  ADLL +
Sbjct  375  ARAALEAVCYQTRDLLDAMQKD------WKNGKDDTVLRVDGGMVASDWTMQRLADLLEA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+  + K+D  F+P ++E+ R  KV  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRKTFSA--RWKRDRRFEPDMDEKTRAAKVKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVKRTL  494



>ref|WP_040775205.1| glycerol kinase [Nocardia pneumoniae]
Length=506

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 86/133 (65%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VQLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W++ DE+  +  + K+   + P   +E R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSDTDELEQNWNEAKR---WSPTWSQEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_021860355.1| glycerol kinase [Dorea sp. CAG:105]
 emb|CCX75902.1| glycerol kinase [Dorea sp. CAG:105]
Length=502

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 80/130 (62%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +QV DVL +M  D+G    +   +    L+VDGGA+ NN LMQ +ADL G+P
Sbjct  379  RATLESIAYQVNDVLKAMEADSG----IHLSK----LKVDGGASANNFLMQAEADLTGAP  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  +ETTA+GAAY AG+AVG W + E       +  D IF P I EE RKK++  W 
Sbjct  431  VERPECVETTAMGAAYLAGIAVGYWKDKEDVRKNRAV--DHIFTPAITEEERKKRLKGWN  488

Query  405  KAVSRTFDLA  376
            KAV   FD A
Sbjct  489  KAVRYAFDWA  498



>ref|WP_034270380.1| glycerol kinase [Amycolatopsis halophila]
Length=506

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 81/132 (61%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+D+M  D+G    V  D    VLRVDGG T N+L MQIQAD+LG 
Sbjct  382  ARATLESICYQTRDVVDAMAADSG----VTLD----VLRVDGGVTANSLCMQIQADILGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP   ETTALGAAYAAGLAVG W   +         +D  ++P   E+ R++    W
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWQNTDELE--RNWNEDVRWQPTWSEQQRERGYGRW  491

Query  408  CKAVSRTFDLAD  373
             KAV RT D  D
Sbjct  492  KKAVERTLDWID  503



>ref|WP_022514753.1| glycerol kinase [Roseburia sp. CAG:182]
 emb|CDF43889.1| glycerol kinase [Roseburia sp. CAG:182]
Length=503

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +QV DV+  M +DAG K +         LRVDGGA+ NN LMQ QAD++ +P
Sbjct  376  RATLESIAYQVCDVISVMEEDAGIKLQS--------LRVDGGASANNFLMQFQADMIHAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTA GAAY AGLAVG W + E     +++ +  +F+P ++EE RKKK+  W 
Sbjct  428  VERPECIETTARGAAYLAGLAVGYWKDKEDVRRNQRIAR--VFEPSMDEEERKKKMKGWN  485

Query  405  KAVSRTFDLA  376
            KAV   F  A
Sbjct  486  KAVRYAFGWA  495



>ref|WP_002442632.1| glycerol kinase [Staphylococcus caprae]
 gb|EES40557.1| glycerol kinase [Staphylococcus caprae M23864:W1]
Length=499

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+C+Q RDV+++M KD+G   EV+N      LRVDGGA  NN LMQ QAD++ S 
Sbjct  377  RATLESLCYQTRDVMEAMSKDSGI--EVQN------LRVDGGAVKNNFLMQFQADIVNSA  428

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLAVG W   E     E+ K +T F+P +EEE R K    W 
Sbjct  429  VERPEIQETTALGAAYLAGLAVGFWDNKEDIR--ERWKLETEFEPKMEEEQRTKLYKGWK  486

Query  405  KAVSRT--FDLAD  373
            KAV  T  F L D
Sbjct  487  KAVEATQVFKLED  499



>ref|WP_026599807.1| glycerol kinase [Methylocystis sp. LW5]
Length=493

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 86/132 (65%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            AR+  E++ FQ RD++ +M +D+G   E         LRVDGG  VN LLMQ QAD+LG+
Sbjct  372  ARSALEAVAFQTRDIVAAMAEDSGVALEE--------LRVDGGMAVNALLMQFQADILGA  423

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP  IETTALGAAYAAGLA G W +    ++  + +K   + P + +E R++++  W
Sbjct  424  PVVRPRCIETTALGAAYAAGLASGFWKDKREIAAHWRAEKR--WSPTMSKEERERRIGKW  481

Query  408  CKAVSRTFDLAD  373
             KAV+R+FD  D
Sbjct  482  AKAVTRSFDWTD  493



>ref|WP_027882694.1| glycerol kinase [Meiothermus rufus]
Length=496

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 81/132 (61%), Gaps = 11/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ +Q RDVL++M  D+G +           LRVDGGA+ N+LLMQ QAD+LG+
Sbjct  375  ARAALEAIAYQSRDVLEAMEADSGLRLSE--------LRVDGGASTNDLLMQFQADILGT  426

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP   ETTALGAAY A + VG+ T ++I       K+   F P + EE R++  + W
Sbjct  427  PVVRPQVTETTALGAAYLAAVGVGLLTREQIAQRWAVQKR---FAPAMPEEARQRLYNGW  483

Query  408  CKAVSRTFDLAD  373
             KAV R    AD
Sbjct  484  KKAVERAKHWAD  495



>ref|WP_031173082.1| glycerol kinase, partial [Streptosporangium roseum]
Length=145

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RDV+++M +D+G    V  D    VLRVDGG T N+L MQIQAD+LG 
Sbjct  22   ARATLEAICYQSRDVVEAMRQDSG----VALD----VLRVDGGVTANDLCMQIQADILGV  73

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV +P   ETTALGAAYAAGLAVG W + DE+    +  ++D  ++P   +E R      
Sbjct  74   PVSKPVVAETTALGAAYAAGLAVGFWKSTDEL---KQNWQEDRRWQPAWSDERRTVGYAG  130

Query  411  WCKAVSRTFDLAD  373
            W KAV RT D  D
Sbjct  131  WKKAVDRTLDWVD  143



>ref|WP_002491397.1| glycerol kinase [Staphylococcus epidermidis]
 gb|EHS01627.1| glycerol kinase [Staphylococcus epidermidis VCU129]
 gb|EJE06811.1| glycerol kinase [Staphylococcus epidermidis NIHLM037]
 gb|EJE18662.1| glycerol kinase [Staphylococcus epidermidis NIHLM015]
Length=499

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+C+Q RDV+++M KD+G   EV+N      LRVDGGA  NN +MQ QAD++ S 
Sbjct  377  RATLESLCYQTRDVMEAMSKDSGI--EVQN------LRVDGGAVKNNFIMQFQADIVNSS  428

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLAVG W + E     E+ K  T FKP ++E+ R K+   W 
Sbjct  429  VERPEIQETTALGAAYLAGLAVGFWDDKEDIR--ERWKLQTEFKPEMDEDQRHKRYSGWK  486

Query  405  KAVSRT--FDLAD  373
            KAV  T  F L D
Sbjct  487  KAVKATQVFKLED  499



>ref|WP_034336705.1| glycerol kinase [Deinococcus misasensis]
Length=496

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+CFQ  DVL +M +D+G   E+K       LRVDGGA+ NNL+MQ QAD+LG 
Sbjct  374  ARAALESICFQTADVLHAMQEDSGI--ELKE------LRVDGGASRNNLMMQFQADILGV  425

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP   ETTALGAAY AGLAVG W + +  S  ++ + D  F+P ++ E R + +  W
Sbjct  426  PVVRPKVTETTALGAAYLAGLAVGYWPDLKDIS--KQWQVDERFEPQMDPETRNRLLSGW  483

Query  408  CKAVSRTFDLAD  373
             KAV R  +  D
Sbjct  484  KKAVDRARNWED  495



>ref|WP_014187637.1| glycerol kinase [Desulfosporosinus orientis]
 gb|AET70835.1| glycerol kinase [Desulfosporosinus orientis DSM 765]
Length=498

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 77/136 (57%), Gaps = 10/136 (7%)
 Frame = -2

Query  780  QVSHARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            Q    RA  ESM +Q +DVL +M KDAG   +         LRVDGGA  NN LMQ Q+D
Sbjct  373  QAHLIRATLESMAYQTKDVLGAMEKDAGITLQT--------LRVDGGAVANNFLMQFQSD  424

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            +LG  V RP  IETTALGAAY AGLAVG W   E   S  K+ +   F P + EE R K 
Sbjct  425  ILGVGVERPEVIETTALGAAYLAGLAVGYWKNKEEICSSWKLNRS--FTPKMSEEYRSKL  482

Query  420  VDSWCKAVSRTFDLAD  373
               W KAV R+ D  D
Sbjct  483  YRGWLKAVERSKDWED  498



>ref|WP_005620047.1| glycerol kinase [Pseudomonas avellanae]
 gb|EKG30838.1| glycerol kinase [Pseudomonas avellanae BPIC 631]
Length=501

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 86/129 (67%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  376  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  427

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K  + W
Sbjct  428  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPACEEAHREKLYEGW  484

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  485  QKAVARTRD  493



>ref|WP_030104795.1| glycerol kinase [Actinoalloteichus cyanogriseus]
Length=505

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 12/132 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+D+M+ D+G    +K+      L+VDGG  VN LLMQ QAD+LG 
Sbjct  380  ARAVLEATAFQTREVIDAMNADSGVA--LKS------LKVDGGMVVNELLMQFQADILGV  431

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETTALGAAYAAGLAVG W +ED+I        +DT + P + E+ R+ +   
Sbjct  432  PVIRPKVNETTALGAAYAAGLAVGFWDSEDDIR---RNWIQDTQWDPSLAEQTREARYRE  488

Query  411  WCKAVSRTFDLA  376
            W KAV+RTFD A
Sbjct  489  WKKAVTRTFDWA  500



>ref|WP_026419357.1| glycerol kinase [Actinoalloteichus cyanogriseus]
Length=505

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 12/132 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+D+M+ D+G    +K+      L+VDGG  VN LLMQ QAD+LG 
Sbjct  380  ARAVLEATAFQTREVIDAMNADSGVA--LKS------LKVDGGMVVNELLMQFQADILGV  431

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETTALGAAYAAGLAVG W +ED+I        +DT + P + E+ R+ +   
Sbjct  432  PVIRPKVNETTALGAAYAAGLAVGFWDSEDDIR---RNWIQDTQWDPSLAEQTREARYRE  488

Query  411  WCKAVSRTFDLA  376
            W KAV+RTFD A
Sbjct  489  WKKAVTRTFDWA  500



>ref|XP_006389796.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
 gb|ESQ27082.1| hypothetical protein EUTSA_v10018399mg [Eutrema salsugineum]
Length=455

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -2

Query  774  SH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQ  607
            SH ARAV ESMCFQV+DVLDSM+KDAG+KG + N++GEF+LRVDGGA+ NNLLMQIQ
Sbjct  385  SHIARAVLESMCFQVKDVLDSMNKDAGEKGSLDNEKGEFLLRVDGGASANNLLMQIQ  441



>ref|WP_014853593.1| glycerol kinase [Pseudomonas stutzeri]
 gb|AFN78802.1| glycerol kinase [Pseudomonas stutzeri DSM 10701]
Length=503

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QADLLG+ 
Sbjct  382  RAALESIAYQTRDVLDAMQQDAGEQLRS--------LRVDGGAVTNNFLMQFQADLLGTR  433

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLA G W+  E   S  K   + +F+P  +++ R+     W 
Sbjct  434  VERPRMKETTALGAAYLAGLATGFWSSLEELRS--KASIERVFEPACDDDRREALYKGWK  491

Query  405  KAVSRTFDLAD  373
            KAVSRT D A+
Sbjct  492  KAVSRTRDWAE  502



>ref|WP_004265295.1| glycerol kinase [Providencia rettgeri]
 gb|EFE51541.1| glycerol kinase [Providencia rettgeri DSM 1131]
 gb|EKT59837.1| glycerol kinase [Providencia rettgeri Dmel1]
Length=508

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 83/132 (63%), Gaps = 12/132 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M  D+G++ +         LRVDGGA  NN LMQ Q+D+LG+P
Sbjct  386  RATLESIAYQTRDVLDAMQADSGERLKA--------LRVDGGAVANNFLMQFQSDILGTP  437

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   E+TALGAAY AGLAVG W+  DE+ S   K   + +FKP IE   R  K + W
Sbjct  438  VERPEVRESTALGAAYLAGLAVGFWSNLDELQS---KATIERVFKPGIETTERNFKYEGW  494

Query  408  CKAVSRTFDLAD  373
             KAV+R  +  D
Sbjct  495  KKAVARAQEWED  506



>ref|WP_025428008.1| glycerol kinase [Ensifer adhaerens]
 gb|AHK45117.1| glycerol kinase [Ensifer adhaerens OV14]
Length=495

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+L++MHKD    G+      E VLRVDGG  V++  MQ  +DLL +
Sbjct  375  ARAALEAVCYQTRDLLEAMHKDWRSNGK------ETVLRVDGGMVVSDWTMQRLSDLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALG A+ AG   G+W + E F+  +   +D  F+P ++E  RK K+  W
Sbjct  429  PVDRPTILETTALGVAWLAGSRAGVWPKQEEFA--KSWARDRRFEPAMDEATRKTKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVKRTL  494



>gb|KGS12834.1| glycerol kinase, partial [Pseudomonas coronafaciens]
Length=415

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  290  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  341

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K    W
Sbjct  342  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPTCEEAHREKLYAGW  398

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  399  QKAVARTRD  407



>ref|WP_018880584.1| glycerol kinase [Thioalkalivibrio sp. ALE30]
Length=506

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NN++MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMARDAGI--------GLKALRVDGGAVANNVMMQFQADMLGVQ  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AGLAVG WT DE+    +K   D +F+P ++   R++    W 
Sbjct  431  VERPAVTESTALGAAWLAGLAVGFWTRDEL---AQKGGLDRVFEPQMDAATREQYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_044198816.1| glycerol kinase [Hyalangium minutum]
 gb|KFE60838.1| Glycerol kinase [Hyalangium minutum]
Length=494

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  777  VSH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            V+H ARAV E +  Q+RD+ D+M  D+G        R     +VDGGA  NNLLMQ QAD
Sbjct  374  VAHLARAVLEGIALQIRDLADAMRHDSG--------RAIPSFKVDGGAAANNLLMQYQAD  425

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            +L +PVVRP ++ETT+LGAA+  GL  G+W+  E        K +  FKP ++ EVR++ 
Sbjct  426  VLDTPVVRPRNLETTSLGAAFLGGLGAGVWSSPEAIR--RAWKAERTFKPKMKPEVRERH  483

Query  420  VDSWCKAVSR  391
            +  W +AV R
Sbjct  484  LAKWKRAVER  493



>ref|WP_002476673.1| glycerol kinase [Staphylococcus epidermidis]
 gb|EJD80627.1| glycerol kinase [Staphylococcus epidermidis NIHLM095]
 gb|EJD83171.1| glycerol kinase [Staphylococcus epidermidis NIHLM087]
 gb|EJD99349.1| glycerol kinase [Staphylococcus epidermidis NIHLM040]
 gb|EKS39099.1| glycerol kinase [Staphylococcus epidermidis BVS058A4]
Length=499

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+C+Q RDV+++M KD+G   EV+N      LRVDGGA  NN +MQ QAD++ S 
Sbjct  377  RATLESLCYQTRDVMEAMSKDSGI--EVQN------LRVDGGAVKNNFIMQFQADIVNSS  428

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLAVG W + E     E+ K  T FKP ++EE R K    W 
Sbjct  429  VERPEIQETTALGAAYLAGLAVGFWDDKEDIR--ERWKLQTEFKPEMDEEQRHKLYSGWK  486

Query  405  KAVSRT--FDLAD  373
            KAV  T  F L D
Sbjct  487  KAVKATQVFKLED  499



>gb|ENW19110.1| glycerol kinase 1 [Acinetobacter haemolyticus NIPH 261]
Length=376

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD+L + 
Sbjct  255  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADILSTS  306

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W+  ++     +M  +  F P   +E  +K    W 
Sbjct  307  VERPAMKETTGMGAAFLAGLAVGFWS--DLNELKRRMTIENTFTPACTQEETEKLYTGWL  364

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  365  KAVGRTRDWAE  375



>ref|WP_002473610.1| glycerol kinase [Staphylococcus epidermidis]
 gb|EHM69301.1| glycerol kinase [Staphylococcus epidermidis VCU071]
Length=499

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+C+Q RDV+++M KD+G   EV+N      LRVDGGA  NN +MQ QAD++ S 
Sbjct  377  RATLESLCYQTRDVMEAMSKDSGI--EVQN------LRVDGGAVKNNFIMQFQADIVNSS  428

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP   ETTALGAAY AGLAVG W + E     E+ K  T FKP ++EE R K    W 
Sbjct  429  VERPEIQETTALGAAYLAGLAVGFWDDKEDIR--ERWKLQTEFKPEMDEEQRHKLYSGWK  486

Query  405  KAVSRT--FDLAD  373
            KAV  T  F L D
Sbjct  487  KAVKATQVFKLED  499



>ref|WP_013777682.1| glycerol kinase [Tepidanaerobacter acetatoxydans]
 ref|YP_007271289.1| glycerol kinase [Tepidanaerobacter acetatoxydans Re1]
 gb|AEE90759.1| Glycerol kinase [Tepidanaerobacter acetatoxydans Re1]
 emb|CCP25313.1| glycerol kinase [Tepidanaerobacter acetatoxydans Re1]
Length=497

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+C+Q RDVL++M KD+G    +K+      L+VDGGA  NN LMQ Q+D+LG P
Sbjct  376  RAALESICYQTRDVLEAMQKDSGIT--LKS------LKVDGGAVANNFLMQFQSDILGVP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLAVG W +    S+  K + D  FKP ++ + +++    W 
Sbjct  428  VDRPKVIETTALGAAYLAGLAVGYWKDKNDISA--KWQIDRTFKPQMDIDTKERLYKGWK  485

Query  405  KAVSRTFDLAD  373
            KAV R+ D  D
Sbjct  486  KAVKRSMDWED  496



>ref|WP_035375252.1| glycerol kinase, partial [Acinetobacter haemolyticus]
Length=392

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD+L + 
Sbjct  271  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADILSTS  322

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W+  ++     +M  +  F P   +E  +K    W 
Sbjct  323  VERPAMKETTGMGAAFLAGLAVGFWS--DLNELKRRMTIENTFTPACTQEETEKLYTGWL  380

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  381  KAVGRTRDWAE  391



>ref|WP_028739490.1| glycerol kinase [Rhizobium mongolense]
Length=497

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+M KD       KN + + VLRVDGG   ++  MQ  ADLL +
Sbjct  375  ARAALEAVCYQTRDLLDAMQKD------WKNGKDDTVLRVDGGMVASDWTMQRLADLLEA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+    K+D  F+P ++E+ R  KV  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRKTFSA--TWKRDRRFEPDMDEKTRAAKVKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVKRTL  494



>ref|WP_019558077.1| glycerol kinase [Thioalkalivibrio sp. ALE12]
Length=506

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NN++MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMAQDAGI--------GLKALRVDGGAVANNVMMQFQADMLGVQ  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AGLAVG WT DE+    +K   D +F+P ++   R++    W 
Sbjct  431  VERPAVTESTALGAAWLAGLAVGFWTRDEL---AQKGGLDRVFEPQMDAATREQYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_013767675.1| glycerol kinase [Haliscomenobacter hydrossis]
 gb|AEE53140.1| Glycerol kinase [Haliscomenobacter hydrossis DSM 1100]
Length=498

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 75/131 (57%), Gaps = 11/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q +DVL +M KDAG            VLRVDGGA  NNLLMQ QAD+LG  
Sbjct  376  RATLESLAYQTKDVLGAMEKDAGTP--------LAVLRVDGGACANNLLMQFQADILGVS  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLA G WT  ++ S   K   D  F P +  E R K    W 
Sbjct  428  VERPKIIETTALGAAYLAGLACGFWTMADLQS---KWHLDRAFHPNMSAEERAKLYKGWQ  484

Query  405  KAVSRTFDLAD  373
            KAV RT    D
Sbjct  485  KAVERTMGWED  495



>ref|WP_037127087.1| glycerol kinase [Rhizobium sp. CF097]
Length=497

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+LD+MHKD       K+D  E VLRVDGG  V++  MQ  ADLL +
Sbjct  375  ARAALEAVCYQTRDLLDAMHKD------WKSDGKETVLRVDGGMVVSDWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALG A+ AG   G+W   + F+  +   +D  F+P ++E+ R  K+  W
Sbjct  429  PVDRPTILETTALGVAWLAGSRAGVWPNQKDFA--KSWARDCRFEPKMDEKCRTGKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RSAVKRTL  494



>ref|WP_024637957.1| hypothetical protein, partial [Mycobacterium avium]
Length=189

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 81/132 (61%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RDV+D+M  D+G + EV        L+VDGG T N+L MQIQAD+LG 
Sbjct  66   ARATLEAICYQSRDVVDAMAADSGVRLEV--------LKVDGGITGNDLCMQIQADVLGV  117

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
             VVRP   ETTALGAAYAAGLAVG W +     +    ++D  + P   +E R      W
Sbjct  118  DVVRPVVAETTALGAAYAAGLAVGFWADPGELRA--NWREDKRWTPAWSDEQRAAGYAGW  175

Query  408  CKAVSRTFDLAD  373
             KAV RT D AD
Sbjct  176  RKAVQRTLDWAD  187



>emb|CBI25161.3| unnamed protein product [Vitis vinifera]
Length=66

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 54/67 (81%), Positives = 60/67 (90%), Gaps = 1/67 (1%)
 Frame = -2

Query  714  MHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTalgaaya  535
            MHKDAG+KGEVKN++ EF+L V GGAT+ NLLMQIQADLL +PVVRP DIETTALGAAYA
Sbjct  1    MHKDAGEKGEVKNEK-EFLLTVAGGATITNLLMQIQADLLRNPVVRPGDIETTALGAAYA  59

Query  534  aglAVGI  514
             GLAVGI
Sbjct  60   TGLAVGI  66



>ref|XP_785650.3| PREDICTED: glycerol kinase-like, partial [Strongylocentrotus 
purpuratus]
Length=530

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 84/129 (65%), Gaps = 13/129 (10%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E++C+Q R++LD+M +D+G   E         LRVDGG T NNLLMQ+QAD L  
Sbjct  368  ARAVLEAVCYQTRELLDAMDQDSGIPLEK--------LRVDGGMTQNNLLMQLQADTLNI  419

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP+  ETTALG A AAG AVG+W + E  S+G     DT F PVIEE+VR+     W
Sbjct  420  PVVRPSMPETTALGVAMAAGHAVGVW-KIEDASAG---NTDT-FTPVIEEDVRESHYAKW  474

Query  408  CKAVSRTFD  382
              AV ++ +
Sbjct  475  KLAVQKSMN  483



>ref|WP_039799920.1| glycerol kinase [Nocardia araoensis]
Length=506

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 84/133 (63%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VRLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+  +  + K+   + P    E R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWNDTDELEQNWNEAKR---WHPTWSAEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_034048000.1| glycerol kinase, partial [Pseudomonas aeruginosa]
Length=189

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 12/127 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  66   RATLESIAYQTRDVLDAMQRDAGERLRA--------LRVDGGAVANNFLMQFQADILGTR  117

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W+  DE+ S   K   + +F+P  +E  R+K    W
Sbjct  118  VERPVMRETTALGAAYLAGLACGFWSSLDELKS---KAVIERVFEPECDEPRREKLYAGW  174

Query  408  CKAVSRT  388
             KAV RT
Sbjct  175  KKAVERT  181



>ref|WP_043623789.1| glycerol kinase [Ensifer sp. ZNC0028]
Length=495

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++C+Q RD+L++MHKD       +N+  E VLRVDGG   ++  MQ  +DLL +
Sbjct  375  ARAALEAVCYQTRDLLEAMHKD------WRNNGKETVLRVDGGMVASDWTMQRLSDLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALG A+ AG   G+W + E F+  +   +D  F+P ++E+ RK K   W
Sbjct  429  PVDRPVILETTALGVAWLAGSRAGVWPKQEDFA--KSWARDRRFEPAMDEKTRKAKFKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RNAVKRTL  494



>ref|WP_018882042.1| MULTISPECIES: glycerol kinase [Thioalkalivibrio]
Length=506

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NN++MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMAQDAGI--------GLKALRVDGGAVANNVMMQFQADMLGVQ  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AGLAVG WT DE+    +K   D +F+P ++   R++    W 
Sbjct  431  VERPAVTESTALGAAWLAGLAVGFWTRDEL---AQKGGLDRVFEPQMDAATREQYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_015517270.1| glycerol kinase [Eubacterium rectale]
 ref|YP_007773644.1| glycerol kinase [Eubacterium rectale DSM 17629]
 emb|CBK91530.1| glycerol kinase [Eubacterium rectale DSM 17629]
Length=498

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ESM FQV DVL++M  D+G             LRVDGGA+ NNLLMQ+QAD+  +P
Sbjct  376  RATLESMAFQVNDVLEAMKADSGINLTS--------LRVDGGASANNLLMQMQADISNAP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  +ETTA+GAAY AGLAVG W  D +         D +F+P IE ++R+KK+  W 
Sbjct  428  VNRPVCVETTAMGAAYLAGLAVGYW--DSMDDIKRNWAIDRVFEPEIEADLREKKLKMWK  485

Query  405  KAVSRTFDLA  376
            KAV+  F+ A
Sbjct  486  KAVACAFNWA  495



>ref|WP_005055194.1| glycerol kinase 1 [Acinetobacter beijerinckii]
 gb|ENW04389.1| glycerol kinase 1 [Acinetobacter beijerinckii ANC 3835]
Length=504

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 78/131 (60%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G+K           LRVDGG T NN LMQ QAD+LG+ 
Sbjct  383  RATLESIAYQTRDVLDAMQQDSGEKLRT--------LRVDGGVTANNFLMQFQADILGTS  434

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  ETT +GAA+ AGLAVG W++     S  +M  +  F P   +   +K    W 
Sbjct  435  VERPAMKETTGMGAAFLAGLAVGFWSDLNELKS--RMTIEHTFTPECSQSKTEKLYKGWL  492

Query  405  KAVSRTFDLAD  373
            KAV RT D A+
Sbjct  493  KAVGRTRDWAE  503



>ref|WP_014692584.1| glycerol kinase [Actinoplanes sp. SE50/110]
 gb|AEV86513.1| glycerol kinase [Actinoplanes sp. SE50/110]
Length=505

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 83/133 (62%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+D+M +D+G    V  D    VL+VDGG T NNL MQIQAD+LG 
Sbjct  382  ARATLESICYQTRDVVDAMAQDSG----VTLD----VLKVDGGITANNLCMQIQADVLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+    E   +   ++P    E R +    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWKSTDELR---ENWNESQRWQPTWSAERRDQGHGR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV RT D  D
Sbjct  491  WKKAVQRTLDWVD  503



>ref|XP_002500482.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61740.1| predicted protein [Micromonas sp. RCC299]
Length=527

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 20/144 (14%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA+ E++CFQ  DVL++M KDA       +D     L VDGGAT N L+MQ QADLLG 
Sbjct  386  ARALLEAICFQTVDVLEAMRKDA-------SDLDMTALHVDGGATANGLMMQTQADLLGL  438

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSG-------------EKMKKDTIFKPV  448
             V RPA++ETTA+GAA AAG+  G+++E  +F                ++M     F+P 
Sbjct  439  RVFRPANVETTAMGAALAAGVGAGLFSERAVFEDTPADESIADAEWLRDEMANRAYFEPA  498

Query  447  IEEEVRKKKVDSWCKAVSRTFDLA  376
            I E+ R ++   WC AV R+ +LA
Sbjct  499  IGEDERARRYAGWCDAVERSLNLA  522



>ref|WP_043688472.1| glycerol kinase [Nocardia abscessus]
Length=506

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VRLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W++ DE+  +  + ++   + P    E R++    
Sbjct  434  PVSRPVVAETTALGAAYAAGLAVGFWSDTDELEQNWNEARR---WSPTWSAEQRERGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV+RT D  D
Sbjct  491  WKKAVARTLDWID  503



>ref|WP_014905211.1| glycerol kinase [Desulfosporosinus meridiei]
 gb|AFQ46305.1| glycerol kinase [Desulfosporosinus meridiei DSM 13257]
Length=498

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 79/137 (58%), Gaps = 12/137 (9%)
 Frame = -2

Query  780  QVSHARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            Q    RA  E+M +Q +DVL +M KDA    +         LRVDGGA  NNLLMQ QAD
Sbjct  373  QAHLIRATLEAMAYQTKDVLGAMEKDAQITLQA--------LRVDGGAVANNLLMQFQAD  424

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKK  424
            LLG  V RP  IETTALGAAY AGL VG W  + EI SS    + D  FKP + EE R K
Sbjct  425  LLGVKVERPEVIETTALGAAYLAGLGVGFWKNQGEICSS---WRMDRCFKPDMSEERRTK  481

Query  423  KVDSWCKAVSRTFDLAD  373
                W KAV R+ D  D
Sbjct  482  LYRGWQKAVERSKDWED  498



>dbj|GAK59206.1| glycerol kinase 2 [bacterium UASB270]
Length=498

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 78/131 (60%), Gaps = 10/131 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ESM +Q RDVLD+M  D+G+K +         LRVDGGAT ++ LMQ QAD+LG 
Sbjct  377  ARATLESMAYQTRDVLDAMEADSGEKAKS--------LRVDGGATRSDFLMQFQADILGI  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP+  E  A GA Y AGL VG W + +     +  K D IF+P + ++ R+   D W
Sbjct  429  PVERPSVTEMAARGAGYLAGLGVGFWKDKQEIE--QHWKLDRIFEPTMSKDQREGLYDGW  486

Query  408  CKAVSRTFDLA  376
             KAV R+   A
Sbjct  487  KKAVQRSLAWA  497



>ref|WP_011426358.1| glycerol kinase [Rhizobium etli]
 gb|ABC91888.1| glycerol kinase protein [Rhizobium etli CFN 42]
Length=497

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++CFQ RD+LD+M KD       KN   + VLRVDGG   ++  MQ  ADLL +
Sbjct  375  SRAALEAVCFQTRDLLDAMQKD------WKNSGDDTVLRVDGGMVASDWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + E FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPMILETTALGAAWLAGSRAGVWPDKEDFST--TWKRDRRFEPDMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RSAVRRTL  494



>ref|WP_017965422.1| glycerol kinase [Rhizobium leguminosarum]
Length=497

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++C+Q RD+LD+M KD       KN   + VLRVDGG   +N  MQ  ADLL +
Sbjct  375  SRAALEAVCYQTRDLLDAMQKD------WKNGTDDTVLRVDGGMVASNWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRDEFSA--TWKRDRRFEPEMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  KNAVKRTL  494



>ref|WP_028478492.1| glycerol kinase [Nocardia sp. CNY236]
Length=506

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 85/133 (64%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV+++M  D+G    V+ D    VLRVDGG T N L MQ+QAD LG 
Sbjct  382  ARATLESICYQTRDVVEAMQADSG----VRLD----VLRVDGGVTANELCMQLQADFLGV  433

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG WT+ DE+  +  + K+   ++P    + R++    
Sbjct  434  PVSRPEVAETTALGAAYAAGLAVGFWTDTDELEQNWHEAKR---WEPTWSPQQREQGYAR  490

Query  411  WCKAVSRTFDLAD  373
            W KAV RT D  D
Sbjct  491  WQKAVDRTLDWID  503



>ref|WP_020921972.1| glycerol kinase 2 [Rhizobium etli]
 gb|AGS22922.1| glycerol kinase 2 [Rhizobium etli bv. mimosae str. Mim1]
Length=497

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++CFQ RD+LD+M KD       KN   + VLRVDGG   ++  MQ  ADLL +
Sbjct  375  SRAALEAVCFQTRDLLDAMQKD------WKNSGDDTVLRVDGGMVASDWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + E FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPMILETTALGAAWLAGSRAGVWPDKEDFST--TWKRDRRFEPDMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  RSAVRRTL  494



>ref|WP_004396510.1| glycerol kinase [Pseudomonas syringae]
 gb|EGH66943.1| glycerol kinase [Pseudomonas syringae pv. actinidiae str. M302091]
 gb|EPM54889.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19103]
 gb|EPM57832.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19071]
 gb|EPM60036.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19073]
 gb|EPM73928.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 18886]
 gb|EPM76300.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19072]
 gb|EPM88664.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19068]
 gb|EPM97429.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19104]
 gb|EPN02287.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19070]
 gb|EPN05059.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19102]
 gb|EPN11394.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 9855]
 gb|EPN66168.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19079]
 gb|EPN70540.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19101]
 gb|EPN78021.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 18801]
 gb|EPN78691.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 19097]
 gb|KAK40049.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 18884]
 gb|KCU98859.1| glycerol kinase [Pseudomonas syringae pv. actinidiae ICMP 9617]
Length=501

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  376  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  427

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K    W
Sbjct  428  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPACEEAHREKLYAGW  484

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  485  QKAVARTRD  493



>ref|WP_014829396.1| glycerol kinase [Desulfosporosinus acidiphilus]
 gb|AFM43416.1| glycerol kinase [Desulfosporosinus acidiphilus SJ4]
Length=498

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 82/128 (64%), Gaps = 10/128 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +S+ +Q +DVL +M  D+G    +K+      LRVDGGA  NNLLMQ QAD+LG+ 
Sbjct  377  RAALDSLAYQTKDVLGAMEADSGI--SLKS------LRVDGGAVANNLLMQFQADILGTK  428

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGAAY AGLAVG W+  E  +S  +   +  F+P +EEE RKK    W 
Sbjct  429  VDRPEIIETTALGAAYLAGLAVGFWSSKEELAS--RWLLNQRFEPQMEEEKRKKLYKGWL  486

Query  405  KAVSRTFD  382
            KAV RT D
Sbjct  487  KAVERTKD  494



>ref|WP_027736969.1| glycerol kinase [Streptomyces sp. CNT360]
Length=503

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 90/129 (70%), Gaps = 12/129 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  +Q R+V+D+M++D+G   E+ +      L+VDGG TVN+LLMQ QAD+LG 
Sbjct  378  ARAVLEATSWQTREVVDAMYQDSGV--EITS------LKVDGGMTVNSLLMQHQADVLGV  429

Query  588  PVVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETT LGAAYAAGLA G+W++ DE+ S     ++D  + P + EE R+++  +
Sbjct  430  PVIRPVIAETTCLGAAYAAGLATGVWSDLDELRS---HWRRDAEWTPAMSEEDREREYAN  486

Query  411  WCKAVSRTF  385
            W KAV R+F
Sbjct  487  WHKAVERSF  495



>ref|WP_020051183.1| glycerol kinase [Rhizobium leguminosarum]
Length=497

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++C+Q RD+LD+M KD       KN   + VLRVDGG   +N  MQ  ADLL +
Sbjct  375  SRAALEAVCYQTRDLLDAMQKD------WKNGAEDTVLRVDGGMVASNWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRDGFSA--TWKRDRRFEPEMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  KNAVKRTL  494



>ref|WP_014757439.1| MULTISPECIES: glycerol kinase [Thermoanaerobacterium]
 ref|YP_006391119.1| glycerol kinase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|AFK85520.1| Glycerol kinase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
 gb|ETO37837.1| glycerol kinase [Thermoanaerobacterium aotearoense SCUT27]
Length=496

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 80/131 (61%), Gaps = 10/131 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVL++M  D+G K           L+VDGGA+ NN LMQ QAD+LG P
Sbjct  376  RATLESLAYQTRDVLEAMQDDSGIKLSA--------LKVDGGASANNFLMQFQADILGVP  427

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RP  IETTALGA+Y AG+A G W+  E     +    D  F+P +++E R+K    W 
Sbjct  428  VDRPTVIETTALGASYLAGIATGFWSGRE--EVAKNWGVDRHFEPNMDDETREKLYAGWK  485

Query  405  KAVSRTFDLAD  373
            KAV R+ + AD
Sbjct  486  KAVERSMNWAD  496



>ref|WP_033441033.1| glycerol kinase [Saccharothrix sp. NRRL B-16314]
Length=501

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+D+M  D+G    +K+      L+VDGG  VN LLMQ QAD+LG 
Sbjct  380  ARAVLEATAFQTREVIDAMDADSGVP--LKS------LKVDGGMVVNELLMQFQADILGV  431

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETTALGAAYAAGLAVG W +ED+I    +   +D  + P +++E R +    
Sbjct  432  PVIRPVVNETTALGAAYAAGLAVGFWASEDDIR---QNWAQDKQWDPAMDDETRARTYAQ  488

Query  411  WCKAVSRTFDLAD  373
            W KAV+RTFD  D
Sbjct  489  WKKAVTRTFDWVD  501



>ref|WP_028483991.1| glycerol kinase [Thioalkalivibrio sp. ALE17]
Length=506

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NN++MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMAQDAGI--------GLKALRVDGGAVANNVMMQFQADMLGVR  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AG AVG WT DE+    +K   D +F+P ++   R++    W 
Sbjct  431  VERPAVTESTALGAAWLAGQAVGFWTRDEL---AQKGGLDRVFEPQMDAATREEYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_005889324.1| MULTISPECIES: glycerol kinase [Pseudomonas syringae group]
 gb|EGI01671.1| glycerol kinase [Pseudomonas syringae pv. oryzae str. 1_6]
Length=501

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  376  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  427

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K    W
Sbjct  428  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPTCEEAHREKLYAGW  484

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  485  QKAVARTRD  493



>ref|WP_010315712.1| glycerol kinase [Saccharopolyspora spinosa]
Length=500

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+++M+ D+G    +K+      L+VDGG  VN LLMQ QAD+LG 
Sbjct  379  ARAVLEATAFQTREVIEAMNADSGVP--LKS------LKVDGGMVVNELLMQFQADILGV  430

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV+RP   ETTALGAAYAAGLAVG W  +E   S     KD  + P +  E+R+K+   W
Sbjct  431  PVIRPVVAETTALGAAYAAGLAVGFWASEEDIRS--NWAKDKQWDPQMPTELREKQYHQW  488

Query  408  CKAVSRTFD  382
             KAV++TFD
Sbjct  489  QKAVTKTFD  497



>ref|WP_026273704.1| glycerol kinase, partial [Salinispora pacifica]
Length=407

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 86/133 (65%), Gaps = 12/133 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  ES+C+Q RDV ++M KD+G    V   R    L+VDGG TVN+L MQ+QAD+LG 
Sbjct  284  ARATLESICYQSRDVAEAMAKDSG----VALGR----LKVDGGVTVNDLCMQLQADILGV  335

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV RP   ETTALGAAYAAGLAVG W + DE+  +  + ++   ++P    E R+ + D 
Sbjct  336  PVSRPTVAETTALGAAYAAGLAVGFWRSTDELRENWNESRR---WQPTWPSEQREAEYDR  392

Query  411  WCKAVSRTFDLAD  373
            W +AV RT D  D
Sbjct  393  WKRAVQRTLDWVD  405



>ref|WP_019340977.1| glycerol kinase [Pseudomonas stutzeri]
Length=503

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 80/129 (62%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +DAG++           LRVDGGA  NN LMQ QADLLG+ 
Sbjct  382  RAALESIAYQTRDVLDAMQQDAGERLRS--------LRVDGGAVANNFLMQFQADLLGTH  433

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAAY AGLA G W+  DE+ S   K   + IF+P  + + R+     W
Sbjct  434  VERPQMKETTALGAAYLAGLATGFWSSLDELRS---KATIERIFEPACDSDQREALYKGW  490

Query  408  CKAVSRTFD  382
             KAVSRT D
Sbjct  491  KKAVSRTRD  499



>ref|WP_036293668.1| glycerol kinase [Methylosinus sp. PW1]
Length=493

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 85/132 (64%), Gaps = 10/132 (8%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARA  E++ FQ  DV+ +M +D+G   E         LRVDGG  VN LLMQ QAD+LG+
Sbjct  372  ARAALEAVAFQTHDVVAAMAEDSGVALEE--------LRVDGGMAVNALLMQFQADILGA  423

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PVVRP  IETTALGAAYAAGLA G W +    ++  + +K   + P++  E R++++  W
Sbjct  424  PVVRPRCIETTALGAAYAAGLASGFWKDKREIAAHWRAEKR--WSPMMSTEDRERRIAKW  481

Query  408  CKAVSRTFDLAD  373
             KAV+R+FD  D
Sbjct  482  AKAVTRSFDWTD  493



>ref|WP_019333936.1| glycerol kinase [Pseudomonas syringae]
 gb|EPM71502.1| glycerol kinase [Pseudomonas syringae pv. theae ICMP 3923]
Length=501

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  376  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  427

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K    W
Sbjct  428  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPACEEAHREKLYAGW  484

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  485  QKAVARTRD  493



>ref|WP_005764834.1| MULTISPECIES: glycerol kinase [Pseudomonas syringae group]
 ref|NP_793929.1| glycerol kinase [Pseudomonas syringae pv. tomato str. DC3000]
 sp|Q87XL0.1|GLPK_PSESM RecName: Full=Glycerol kinase; AltName: Full=ATP:glycerol 3-phosphotransferase; 
AltName: Full=Glycerokinase; Short=GK [Pseudomonas 
syringae pv. tomato str. DC3000]
 gb|AAO57624.1| glycerol kinase [Pseudomonas syringae pv. tomato str. DC3000]
 gb|EEB57948.1| glycerol kinase [Pseudomonas syringae pv. tomato T1]
 gb|EGH95713.1| glycerol kinase [Pseudomonas syringae pv. lachrymans str. M302278]
 gb|KGK95750.1| glycerol kinase [Pseudomonas syringae pv. tomato]
Length=501

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 85/129 (66%), Gaps = 12/129 (9%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  ES+ +Q RDVLD+M +D+G++  +K+      LRVDGGA  NN LMQ QAD+LG+ 
Sbjct  376  RAALESIAYQTRDVLDAMQQDSGER--LKS------LRVDGGAVANNFLMQFQADILGTH  427

Query  585  VVRPADIETTalgaayaaglAVGIWTE-DEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            V RP   ETTALGAA+ AGLA+G W+  DE+ +   K   + +F+P  EE  R+K    W
Sbjct  428  VERPQMRETTALGAAFLAGLAIGFWSSLDELRN---KAVIERVFEPACEEAHREKLYAGW  484

Query  408  CKAVSRTFD  382
             KAV+RT D
Sbjct  485  QKAVARTRD  493



>ref|WP_016698736.1| glycerol kinase [Actinoalloteichus spitiensis]
Length=505

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 86/132 (65%), Gaps = 12/132 (9%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            ARAV E+  FQ R+V+D+M+ D+G   +         L+ DGG  VN+LLMQ QAD+LG 
Sbjct  380  ARAVLEATAFQTREVIDAMNADSGVALKA--------LKADGGMVVNDLLMQFQADILGV  431

Query  588  PVVRPADIETTalgaayaaglAVGIW-TEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDS  412
            PV+RP   ETTALGAAYAAGLAVG W  ED+I        +DT ++P + E+ R+ +   
Sbjct  432  PVIRPKVNETTALGAAYAAGLAVGFWGGEDDIR---RNWIQDTQWEPSLAEQTREARYRE  488

Query  411  WCKAVSRTFDLA  376
            W KAV+RTFD A
Sbjct  489  WKKAVTRTFDWA  500



>ref|WP_027683508.1| glycerol kinase [Rhizobium leguminosarum]
Length=497

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 8/128 (6%)
 Frame = -2

Query  768  ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGS  589
            +RA  E++C+Q RD+LD+M KD       KN   + VLRVDGG   +N  MQ  ADLL +
Sbjct  375  SRAALEAVCYQTRDLLDAMQKD------WKNGTEDTVLRVDGGMVASNWTMQRLADLLDA  428

Query  588  PVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSW  409
            PV RP  +ETTALGAA+ AG   G+W + + FS+    K+D  F+P ++E+VR  K+  W
Sbjct  429  PVDRPVILETTALGAAWLAGSRAGVWPDRDDFSA--TWKRDRRFEPEMDEKVRAAKLKGW  486

Query  408  CKAVSRTF  385
              AV RT 
Sbjct  487  KNAVKRTL  494



>ref|WP_018877452.1| glycerol kinase [Thioalkalivibrio sp. ALE28]
Length=506

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 79/130 (61%), Gaps = 11/130 (8%)
 Frame = -2

Query  765  RAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQADLLGSP  586
            RA  +++ +Q RDV+D+M +DAG         G   LRVDGGA  NN++MQ QAD+LG  
Sbjct  379  RATLDALAYQTRDVIDAMAQDAGI--------GLKALRVDGGAVANNVMMQFQADMLGVR  430

Query  585  VVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKKVDSWC  406
            V RPA  E+TALGAA+ AGL VG WT DE+   G     D +F+P ++   R++    W 
Sbjct  431  VERPAVTESTALGAAWLAGLGVGFWTRDELVQKG---GLDRVFEPQMDAATREQYYRGWK  487

Query  405  KAVSRTFDLA  376
            KAV RT   A
Sbjct  488  KAVKRTMGWA  497



>ref|WP_026955253.1| glycerol kinase [Algoriphagus vanfongensis]
Length=498

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 84/131 (64%), Gaps = 12/131 (9%)
 Frame = -2

Query  777  VSH-ARAVXESMCFQVRDVLDSMHKDAGDKGEVKNDRGEFVLRVDGGATVNNLLMQIQAD  601
            ++H +RA  E++ +QV DV+ +M KDAG+K +         LRVDGGAT NN LMQ QAD
Sbjct  374  IAHFSRATLEAIAYQVHDVIKAMEKDAGEKTKE--------LRVDGGATANNFLMQFQAD  425

Query  600  LLGSPVVRPADIETTalgaayaaglAVGIWTEDEIFSSGEKMKKDTIFKPVIEEEVRKKK  421
            +L   + RP  IETTA+GAA+ AGLA+G WT++EI +       D  FKP +E+  R+  
Sbjct  426  MLDCEIKRPQIIETTAIGAAFLAGLAIGFWTKEEIHA---LWNSDKSFKPKMEDAKRENL  482

Query  420  VDSWCKAVSRT  388
            +  W KAV R+
Sbjct  483  LHFWKKAVERS  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566999573790