BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014H08

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI37693.3|  unnamed protein product                                422   4e-146   Vitis vinifera
ref|XP_002283561.1|  PREDICTED: COP9 signalosome complex subunit ...    424   2e-145   Vitis vinifera
gb|KDP33444.1|  hypothetical protein JCGZ_07015                         418   3e-143   Jatropha curcas
ref|XP_008445090.1|  PREDICTED: COP9 signalosome complex subunit ...    417   1e-142   Cucumis melo [Oriental melon]
ref|XP_002527960.1|  jun activation domain binding protein, putative    417   1e-142   Ricinus communis
emb|CDP18325.1|  unnamed protein product                                412   3e-142   Coffea canephora [robusta coffee]
ref|XP_010111938.1|  COP9 signalosome complex subunit 5b                415   5e-142   
ref|XP_009617619.1|  PREDICTED: COP9 signalosome complex subunit ...    414   1e-141   Nicotiana tomentosiformis
ref|XP_004138765.1|  PREDICTED: COP9 signalosome complex subunit ...    414   1e-141   Cucumis sativus [cucumbers]
ref|XP_003522659.1|  PREDICTED: COP9 signalosome complex subunit 5a     414   3e-141   Glycine max [soybeans]
ref|XP_002324396.1|  COP9 complex family protein                        413   5e-141   
ref|XP_007137114.1|  hypothetical protein PHAVU_009G100700g             412   1e-140   Phaseolus vulgaris [French bean]
ref|XP_003526451.1|  PREDICTED: COP9 signalosome complex subunit 5a     412   2e-140   Glycine max [soybeans]
gb|EYU29155.1|  hypothetical protein MIMGU_mgv1a0088021mg               405   4e-140   Erythranthe guttata [common monkey flower]
ref|XP_004291259.1|  PREDICTED: COP9 signalosome complex subunit ...    410   4e-140   Fragaria vesca subsp. vesca
ref|XP_009786152.1|  PREDICTED: COP9 signalosome complex subunit ...    410   4e-140   Nicotiana sylvestris
ref|XP_011045010.1|  PREDICTED: COP9 signalosome complex subunit ...    409   1e-139   Populus euphratica
ref|XP_011031359.1|  PREDICTED: COP9 signalosome complex subunit ...    409   2e-139   Populus euphratica
ref|XP_004501247.1|  PREDICTED: COP9 signalosome complex subunit ...    408   2e-139   Cicer arietinum [garbanzo]
ref|XP_010259860.1|  PREDICTED: COP9 signalosome complex subunit ...    407   7e-139   Nelumbo nucifera [Indian lotus]
ref|XP_011076561.1|  PREDICTED: COP9 signalosome complex subunit ...    407   1e-138   Sesamum indicum [beniseed]
ref|XP_003603531.1|  COP9 signalosome complex subunit 5b                406   1e-138   
gb|ACJ84456.1|  unknown                                                 406   2e-138   Medicago truncatula
ref|XP_011459046.1|  PREDICTED: COP9 signalosome complex subunit ...    405   2e-138   Fragaria vesca subsp. vesca
ref|XP_006382165.1|  COP9 complex family protein                        405   3e-138   Populus trichocarpa [western balsam poplar]
ref|XP_007221779.1|  hypothetical protein PRUPE_ppa007500mg             405   6e-138   Prunus persica
ref|XP_010048447.1|  PREDICTED: COP9 signalosome complex subunit ...    405   7e-138   Eucalyptus grandis [rose gum]
ref|XP_006351153.1|  PREDICTED: COP9 signalosome complex subunit ...    404   9e-138   Solanum tuberosum [potatoes]
gb|AAC26484.1|  putative JUN kinase activation domain binding pro...    404   1e-137   Medicago sativa [alfalfa]
gb|KDO67280.1|  hypothetical protein CISIN_1g018085mg                   404   2e-137   Citrus sinensis [apfelsine]
ref|XP_004241422.1|  PREDICTED: COP9 signalosome complex subunit 5b     402   1e-136   Solanum lycopersicum
ref|XP_006450165.1|  hypothetical protein CICLE_v10008736mg             401   2e-136   Citrus clementina [clementine]
ref|XP_009338826.1|  PREDICTED: COP9 signalosome complex subunit ...    401   2e-136   Pyrus x bretschneideri [bai li]
ref|XP_008378244.1|  PREDICTED: COP9 signalosome complex subunit ...    400   3e-136   Malus domestica [apple tree]
ref|XP_011082082.1|  PREDICTED: COP9 signalosome complex subunit ...    400   4e-136   Sesamum indicum [beniseed]
gb|KDO67279.1|  hypothetical protein CISIN_1g018085mg                   399   1e-135   Citrus sinensis [apfelsine]
ref|XP_006347307.1|  PREDICTED: COP9 signalosome complex subunit ...    399   1e-135   Solanum tuberosum [potatoes]
ref|XP_008393958.1|  PREDICTED: COP9 signalosome complex subunit ...    399   2e-135   
emb|CBL87025.1|  CSN5 protein                                           398   3e-135   Solanum lycopersicum
gb|KHG19604.1|  COP9 signalosome complex subunit 5b -like protein       397   6e-135   Gossypium arboreum [tree cotton]
ref|XP_006450164.1|  hypothetical protein CICLE_v10008736mg             396   1e-134   Citrus clementina [clementine]
ref|NP_001234331.1|  JAB                                                396   2e-134   
gb|KJB55192.1|  hypothetical protein B456_009G068200                    395   3e-134   Gossypium raimondii
ref|XP_007011590.1|  COP9-signalosome 5B                                394   6e-134   
ref|XP_010551182.1|  PREDICTED: COP9 signalosome complex subunit 5b     391   1e-132   Tarenaya hassleriana [spider flower]
ref|XP_010669282.1|  PREDICTED: COP9 signalosome complex subunit ...    389   1e-131   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK24758.1|  unknown                                                 387   8e-131   Picea sitchensis
gb|KJB55195.1|  hypothetical protein B456_009G068200                    385   2e-130   Gossypium raimondii
ref|XP_009420301.1|  PREDICTED: COP9 signalosome complex subunit ...    385   3e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929274.1|  PREDICTED: COP9 signalosome complex subunit ...    384   6e-130   Elaeis guineensis
ref|XP_008810007.1|  PREDICTED: COP9 signalosome complex subunit ...    383   2e-129   Phoenix dactylifera
ref|XP_010477567.1|  PREDICTED: COP9 signalosome complex subunit 5b     382   4e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010914180.1|  PREDICTED: COP9 signalosome complex subunit ...    380   2e-128   Elaeis guineensis
ref|XP_002887356.1|  hypothetical protein ARALYDRAFT_894961             379   8e-128   Arabidopsis lyrata subsp. lyrata
ref|XP_006305189.1|  hypothetical protein CARUB_v10009554mg             375   1e-126   Capsella rubella
ref|XP_002893252.1|  hypothetical protein ARALYDRAFT_472541             375   2e-126   
gb|KFK41544.1|  hypothetical protein AALP_AA2G143000                    375   3e-126   Arabis alpina [alpine rockcress]
gb|EAZ32248.1|  hypothetical protein OsJ_16452                          372   6e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006845674.1|  hypothetical protein AMTR_s00019p00231450          372   3e-125   Amborella trichopoda
gb|AAM65053.1|  putative JUN kinase activator protein                   372   4e-125   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001054112.1|  Os04g0654700                                       372   4e-125   
gb|EEC78160.1|  hypothetical protein OsI_17724                          373   4e-125   Oryza sativa Indica Group [Indian rice]
ref|NP_173705.1|  COP9 signalosome complex subunit 5a                   372   5e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004960128.1|  PREDICTED: COP9 signalosome complex subunit ...    372   5e-125   Setaria italica
emb|CAE03401.3|  OSJNBa0071I13.2                                        372   6e-125   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009115580.1|  PREDICTED: COP9 signalosome complex subunit 5b     371   1e-124   Brassica rapa
ref|XP_010498782.1|  PREDICTED: COP9 signalosome complex subunit ...    371   1e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010415831.1|  PREDICTED: COP9 signalosome complex subunit ...    370   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_010460061.1|  PREDICTED: COP9 signalosome complex subunit ...    370   2e-124   Camelina sativa [gold-of-pleasure]
ref|XP_006652935.1|  PREDICTED: COP9 signalosome complex subunit ...    370   2e-124   Oryza brachyantha
gb|AFK33507.1|  unknown                                                 363   5e-124   Medicago truncatula
ref|XP_010471135.1|  PREDICTED: COP9 signalosome complex subunit ...    368   1e-123   Camelina sativa [gold-of-pleasure]
ref|NP_001149650.1|  COP9 signalosome complex subunit 5b                368   1e-123   Zea mays [maize]
gb|AAC36344.1|  AJH1                                                    367   3e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44380.1|  hypothetical protein AALP_AA1G249900                    366   5e-123   Arabis alpina [alpine rockcress]
ref|XP_006302454.1|  hypothetical protein CARUB_v10020540mg             365   1e-122   Capsella rubella
ref|XP_010427950.1|  PREDICTED: COP9 signalosome complex subunit ...    365   1e-122   Camelina sativa [gold-of-pleasure]
gb|AAC36343.1|  AJH2                                                    364   3e-122   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177279.1|  COP9 signalosome complex subunit 5b                   364   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001775449.1|  predicted protein                                  363   1e-121   
ref|XP_006416142.1|  hypothetical protein EUTSA_v10008042mg             363   2e-121   Eutrema salsugineum [saltwater cress]
ref|XP_010240543.1|  PREDICTED: COP9 signalosome complex subunit ...    359   3e-120   Brachypodium distachyon [annual false brome]
ref|XP_006450163.1|  hypothetical protein CICLE_v10008736mg             358   5e-120   
dbj|BAJ93853.1|  predicted protein                                      357   2e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001752249.1|  predicted protein                                  358   2e-119   
gb|EMS48301.1|  COP9 signalosome complex subunit 5b                     355   6e-119   Triticum urartu
gb|KJB65951.1|  hypothetical protein B456_010G123100                    354   2e-118   Gossypium raimondii
gb|EMT09486.1|  hypothetical protein F775_29820                         355   2e-118   
ref|XP_002961002.1|  hypothetical protein SELMODRAFT_73440              355   2e-118   
ref|XP_002967006.1|  hypothetical protein SELMODRAFT_168868             355   4e-118   
gb|KJB55194.1|  hypothetical protein B456_009G068200                    352   1e-117   Gossypium raimondii
gb|KHG22386.1|  COP9 signalosome complex subunit 5a -like protein       351   4e-117   Gossypium arboreum [tree cotton]
ref|XP_006390791.1|  hypothetical protein EUTSA_v10018788mg             348   4e-116   Eutrema salsugineum [saltwater cress]
emb|CDY25761.1|  BnaA07g10210D                                          347   3e-115   Brassica napus [oilseed rape]
ref|XP_009103210.1|  PREDICTED: COP9 signalosome complex subunit ...    344   2e-114   Brassica rapa
ref|XP_010929275.1|  PREDICTED: COP9 signalosome complex subunit ...    343   4e-114   
gb|KJB55196.1|  hypothetical protein B456_009G068200                    337   9e-112   Gossypium raimondii
ref|NP_973890.1|  COP9 signalosome complex subunit 5a                   335   9e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804896.1|  PREDICTED: COP9 signalosome complex subunit ...    319   1e-106   Phoenix dactylifera
ref|XP_011082083.1|  PREDICTED: COP9 signalosome complex subunit ...    313   1e-102   Sesamum indicum [beniseed]
ref|XP_004353437.1|  signalosome complex protein                        313   2e-102   Acanthamoeba castellanii str. Neff
gb|KJB55193.1|  hypothetical protein B456_009G068200                    303   9e-99    Gossypium raimondii
ref|XP_007248979.1|  PREDICTED: COP9 signalosome complex subunit 5      302   5e-98    Astyanax mexicanus [blind cave fish]
ref|XP_009491803.1|  PREDICTED: COP9 signalosome complex subunit 5      299   9e-98    Pelecanus crispus
ref|XP_009866049.1|  PREDICTED: COP9 signalosome complex subunit 5      296   1e-97    Apaloderma vittatum
ref|NP_957019.1|  COP9 signalosome complex subunit 5                    301   1e-97    Danio rerio [leopard danio]
gb|KFQ58471.1|  COP9 signalosome complex subunit 5                      299   2e-97    Pelecanus crispus
ref|XP_009569185.1|  PREDICTED: COP9 signalosome complex subunit 5      298   2e-97    Cuculus canorus
ref|XP_005019397.1|  PREDICTED: COP9 signalosome complex subunit 5      298   2e-97    
gb|KFW95881.1|  COP9 signalosome complex subunit 5                      298   2e-97    Phalacrocorax carbo [common cormorant]
ref|XP_007885057.1|  PREDICTED: COP9 signalosome complex subunit ...    298   2e-97    Callorhinchus milii [Australian ghost shark]
ref|XP_009512046.1|  PREDICTED: COP9 signalosome complex subunit 5      297   2e-97    Phalacrocorax carbo [common cormorant]
ref|XP_009883867.1|  PREDICTED: COP9 signalosome complex subunit 5      298   3e-97    Charadrius vociferus
gb|KFV70073.1|  COP9 signalosome complex subunit 5                      298   3e-97    Picoides pubescens
ref|XP_004697588.1|  PREDICTED: COP9 signalosome complex subunit 5      298   3e-97    Echinops telfairi [lesser hedgehog tenrec]
gb|KFR15387.1|  COP9 signalosome complex subunit 5                      298   4e-97    Opisthocomus hoazin [hoatzin]
gb|KFO04966.1|  COP9 signalosome complex subunit 5                      298   4e-97    Balearica regulorum gibbericeps
ref|XP_006006855.1|  PREDICTED: COP9 signalosome complex subunit ...    300   4e-97    Latimeria chalumnae
ref|XP_008852995.1|  PREDICTED: COP9 signalosome complex subunit ...    297   5e-97    Nannospalax galili
gb|KFR04453.1|  COP9 signalosome complex subunit 5                      298   5e-97    Nipponia nippon
ref|XP_005392181.1|  PREDICTED: COP9 signalosome complex subunit ...    298   5e-97    
gb|EOB01530.1|  COP9 signalosome complex subunit 5                      298   5e-97    Anas platyrhynchos [duck]
ref|XP_008565069.1|  PREDICTED: COP9 signalosome complex subunit ...    298   5e-97    Galeopterus variegatus [Malayan flying lemur]
ref|XP_009453744.1|  PREDICTED: COP9 signalosome complex subunit ...    298   5e-97    
gb|KFZ45477.1|  COP9 signalosome complex subunit 5                      298   5e-97    Antrostomus carolinensis
ref|NP_989109.1|  COP9 signalosome complex subunit 5                    299   5e-97    Xenopus tropicalis [western clawed frog]
ref|XP_006860136.1|  PREDICTED: COP9 signalosome complex subunit 5      298   6e-97    Chrysochloris asiatica
ref|XP_005042220.1|  PREDICTED: COP9 signalosome complex subunit 5      298   6e-97    
gb|KFP12389.1|  COP9 signalosome complex subunit 5                      298   6e-97    Egretta garzetta
ref|XP_010134433.1|  PREDICTED: COP9 signalosome complex subunit 5      297   6e-97    Buceros rhinoceros silvestris
gb|KGL93740.1|  COP9 signalosome complex subunit 5                      297   6e-97    Charadrius vociferus
gb|KFV78011.1|  COP9 signalosome complex subunit 5                      298   7e-97    Struthio camelus australis
ref|XP_009957073.1|  PREDICTED: COP9 signalosome complex subunit ...    298   7e-97    Leptosomus discolor
gb|AAD03468.1|  38 kDa Mov34 homolog                                    299   8e-97    Homo sapiens [man]
ref|XP_009333319.1|  PREDICTED: COP9 signalosome complex subunit 5      296   8e-97    Pygoscelis adeliae
gb|KFZ51066.1|  COP9 signalosome complex subunit 5                      297   9e-97    Podiceps cristatus
gb|KFO71148.1|  COP9 signalosome complex subunit 5                      297   9e-97    Cuculus canorus
ref|XP_006090662.1|  PREDICTED: COP9 signalosome complex subunit 5      299   9e-97    
ref|XP_009575600.1|  PREDICTED: COP9 signalosome complex subunit 5      296   1e-96    Fulmarus glacialis
gb|KFW04486.1|  COP9 signalosome complex subunit 5                      296   1e-96    Fulmarus glacialis
gb|KFU88065.1|  COP9 signalosome complex subunit 5                      297   1e-96    Chaetura pelagica
gb|AAX37104.1|  COP9 constitutive photomorphogenic-like subunit 5       298   1e-96    synthetic construct
gb|KFW88042.1|  COP9 signalosome complex subunit 5                      298   1e-96    Manacus vitellinus
ref|XP_535093.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    298   1e-96    Canis lupus familiaris [dogs]
ref|XP_005517166.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009957065.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    Leptosomus discolor
ref|XP_009083868.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    
ref|XP_005150844.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    Melopsittacus undulatus
ref|XP_010574205.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    Haliaeetus leucocephalus
gb|ELR58372.1|  COP9 signalosome complex subunit 5                      298   1e-96    Bos mutus
ref|XP_001512862.1|  PREDICTED: COP9 signalosome complex subunit 5      298   1e-96    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005866406.1|  PREDICTED: COP9 signalosome complex subunit 5      298   1e-96    Myotis brandtii
ref|XP_004679877.1|  PREDICTED: COP9 signalosome complex subunit 5      298   1e-96    Condylura cristata
ref|NP_006828.2|  COP9 signalosome complex subunit 5                    298   1e-96    Homo sapiens [man]
gb|AAP36860.1|  Homo sapiens COP9 constitutive photomorphogenic h...    298   1e-96    synthetic construct
ref|XP_001494265.1|  PREDICTED: COP9 signalosome complex subunit ...    298   1e-96    
ref|NP_001179068.1|  COP9 signalosome complex subunit 5                 298   1e-96    Bos taurus [bovine]
ref|NP_001098770.1|  COP9 signalosome complex subunit 5                 298   2e-96    Sus scrofa [pigs]
gb|AAB16847.1|  Jun activation domain binding protein                   298   2e-96    Homo sapiens [man]
ref|XP_001368118.1|  PREDICTED: COP9 signalosome complex subunit 5      298   2e-96    Monodelphis domestica
gb|KFP96001.1|  COP9 signalosome complex subunit 5                      298   2e-96    Leptosomus discolor
ref|XP_007885051.1|  PREDICTED: COP9 signalosome complex subunit ...    298   2e-96    Callorhinchus milii [Australian ghost shark]
ref|NP_001034400.1|  COP9 signalosome complex subunit 5                 298   2e-96    Gallus gallus [bantam]
ref|XP_009083861.1|  PREDICTED: COP9 signalosome complex subunit ...    298   2e-96    Serinus canaria [canary]
ref|XP_005150843.1|  PREDICTED: COP9 signalosome complex subunit ...    298   2e-96    Melopsittacus undulatus
ref|XP_007527171.1|  PREDICTED: COP9 signalosome complex subunit 5      298   2e-96    Erinaceus europaeus [common hedgehog]
ref|NP_038743.1|  COP9 signalosome complex subunit 5 isoform 1          298   2e-96    Mus musculus [mouse]
ref|XP_010574204.1|  PREDICTED: COP9 signalosome complex subunit ...    298   2e-96    Haliaeetus leucocephalus
gb|KHN16463.1|  COP9 signalosome complex subunit 5b                     293   2e-96    Glycine soja [wild soybean]
gb|KFW63060.1|  COP9 signalosome complex subunit 5                      296   2e-96    Pygoscelis adeliae
ref|NP_001264030.1|  COP9 signalosome complex subunit 5 isoform 2       297   2e-96    Mus musculus [mouse]
ref|XP_006237820.1|  PREDICTED: COP9 signalosome complex subunit ...    297   2e-96    Rattus norvegicus [brown rat]
ref|NP_001020866.1|  COP9 signalosome complex subunit 5                 298   2e-96    Rattus norvegicus [brown rat]
gb|KFO89731.1|  COP9 signalosome complex subunit 5                      296   2e-96    Buceros rhinoceros silvestris
ref|XP_004602468.1|  PREDICTED: COP9 signalosome complex subunit 5      298   2e-96    Sorex araneus [Eurasian shrew]
gb|EGW14995.1|  COP9 signalosome complex subunit 5                      297   2e-96    Cricetulus griseus [Chinese hamsters]
pdb|4D18|E  Chain E, Crystal Structure Of The Cop9 Signalosome          297   3e-96    Homo sapiens [man]
ref|XP_006131546.1|  PREDICTED: COP9 signalosome complex subunit ...    297   3e-96    
ref|XP_004814144.1|  PREDICTED: COP9 signalosome complex subunit ...    298   3e-96    
ref|XP_008173762.1|  PREDICTED: COP9 signalosome complex subunit ...    297   3e-96    Chrysemys picta bellii
ref|XP_007429682.1|  PREDICTED: COP9 signalosome complex subunit 5      297   3e-96    Python bivittatus
ref|XP_008565067.1|  PREDICTED: COP9 signalosome complex subunit ...    297   4e-96    Galeopterus variegatus [Malayan flying lemur]
ref|XP_008106749.1|  PREDICTED: COP9 signalosome complex subunit 5      297   4e-96    Anolis carolinensis [Carolina anole]
ref|NP_001086291.1|  COP9 signalosome complex subunit 5                 297   4e-96    Xenopus laevis [clawed frog]
ref|XP_006943314.1|  PREDICTED: COP9 signalosome complex subunit ...    296   4e-96    Felis catus [cat]
ref|XP_008704973.1|  PREDICTED: COP9 signalosome complex subunit ...    296   4e-96    Ursus maritimus [white bear]
ref|XP_011219513.1|  PREDICTED: COP9 signalosome complex subunit ...    296   4e-96    Ailuropoda melanoleuca
ref|XP_005311431.1|  PREDICTED: COP9 signalosome complex subunit ...    297   6e-96    Chrysemys picta bellii
gb|KFM00893.1|  COP9 signalosome complex subunit 5                      297   6e-96    Aptenodytes forsteri
ref|XP_007080737.1|  PREDICTED: COP9 signalosome complex subunit ...    296   6e-96    Panthera tigris altaica
ref|XP_006131545.1|  PREDICTED: COP9 signalosome complex subunit ...    296   6e-96    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001636625.1|  predicted protein                                  296   7e-96    Nematostella vectensis
ref|XP_005977666.1|  PREDICTED: COP9 signalosome complex subunit ...    297   8e-96    Pantholops hodgsonii [Tibetan antelope]
ref|XP_009274936.1|  PREDICTED: COP9 signalosome complex subunit 5      296   8e-96    Aptenodytes forsteri
gb|ELU08061.1|  hypothetical protein CAPTEDRAFT_163387                  294   1e-95    Capitella teleta
ref|XP_007066265.1|  PREDICTED: COP9 signalosome complex subunit 5      296   1e-95    Chelonia mydas [green seaturtle]
ref|NP_001232700.1|  putative JUN activation binding protein vari...    296   2e-95    Taeniopygia guttata
ref|XP_003831400.1|  PREDICTED: COP9 signalosome complex subunit 5      295   2e-95    Pan paniscus [bonobo]
gb|AET43978.1|  COP9 signalosome subunit 5                              295   2e-95    Reishia clavigera
ref|XP_008072512.1|  PREDICTED: COP9 signalosome complex subunit 5      297   2e-95    Carlito syrichta
gb|EAW86930.1|  COP9 constitutive photomorphogenic homolog subuni...    297   2e-95    Homo sapiens [man]
ref|XP_638491.1|  Mov34/MPN/PAD-1 family protein                        295   4e-95    Dictyostelium discoideum AX4
ref|XP_001179203.2|  PREDICTED: COP9 signalosome complex subunit ...    292   5e-95    
ref|XP_006779523.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    296   5e-95    
ref|XP_007651216.1|  PREDICTED: COP9 signalosome complex subunit ...    296   5e-95    
ref|XP_006069586.1|  PREDICTED: COP9 signalosome complex subunit ...    296   7e-95    
ref|XP_004637626.1|  PREDICTED: COP9 signalosome complex subunit 5      290   7e-95    
ref|XP_006752490.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    293   1e-94    Leptonychotes weddellii
ref|XP_011448116.1|  PREDICTED: COP9 signalosome complex subunit ...    293   1e-94    Crassostrea gigas
ref|XP_007634273.1|  PREDICTED: COP9 signalosome complex subunit ...    296   1e-94    
gb|ELW64697.1|  COP9 signalosome complex subunit 5                      298   1e-94    Tupaia chinensis
gb|KJB65952.1|  hypothetical protein B456_010G123100                    292   1e-94    Gossypium raimondii
gb|KJB65950.1|  hypothetical protein B456_010G123100                    291   2e-94    Gossypium raimondii
ref|XP_003292126.1|  Mov34/MPN/PAD-1 family protein                     292   2e-94    Dictyostelium purpureum
ref|XP_006901120.1|  PREDICTED: COP9 signalosome complex subunit ...    289   4e-94    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_011448117.1|  PREDICTED: COP9 signalosome complex subunit ...    293   4e-94    
ref|XP_008989617.1|  PREDICTED: LOW QUALITY PROTEIN: COP9 signalo...    293   8e-94    
ref|XP_001200311.2|  PREDICTED: COP9 signalosome complex subunit ...    297   2e-93    
ref|XP_009045703.1|  hypothetical protein LOTGIDRAFT_224262             290   3e-93    Lottia gigantea
gb|ERE86124.1|  COP9 signalosome complex subunit 5                      299   3e-92    Cricetulus griseus [Chinese hamsters]
gb|KFP72154.1|  COP9 signalosome complex subunit 5                      281   6e-92    Acanthisitta chloris
gb|ETE60341.1|  COP9 signalosome complex subunit 5                      287   1e-91    Ophiophagus hannah
ref|XP_005099578.1|  PREDICTED: COP9 signalosome complex subunit ...    285   2e-91    Aplysia californica
ref|XP_009074279.1|  PREDICTED: COP9 signalosome complex subunit 5      280   3e-91    Acanthisitta chloris
ref|XP_004638141.1|  PREDICTED: COP9 signalosome complex subunit ...    285   3e-91    Octodon degus
gb|KDR11248.1|  COP9 signalosome complex subunit 5                      284   5e-91    Zootermopsis nevadensis
dbj|BAN21083.1|  jun activation domain binding protein                  284   5e-91    Riptortus pedestris
dbj|BAM18530.1|  COP9 complex homolog subunit 5                         284   6e-91    Papilio xuthus [Chinese swallowtail]
gb|ADP30958.1|  COP9 constitutive photomorphogenic-like protein s...    284   8e-91    Penaeus monodon [giant tiger prawn]
ref|XP_008548790.1|  PREDICTED: COP9 signalosome complex subunit ...    283   1e-90    Microplitis demolitor
ref|NP_001138802.1|  JAB-MPN domain protein                             283   2e-90    Bombyx mori [silk moth]
gb|AEE62710.1|  unknown                                                 282   4e-90    Dendroctonus ponderosae
gb|EPB91337.1|  COP9 signalosome complex subunit 5a                     281   4e-90    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_010732391.1|  PREDICTED: COP9 signalosome complex subunit 5      281   5e-90    Larimichthys crocea [croceine croaker]
ref|XP_009029035.1|  hypothetical protein HELRODRAFT_185158             281   6e-90    Helobdella robusta
gb|EHJ73122.1|  JAB-MPN domain protein                                  283   9e-90    
ref|XP_004524030.1|  PREDICTED: COP9 signalosome complex subunit ...    281   1e-89    
ref|XP_005722652.1|  PREDICTED: COP9 signalosome complex subunit ...    278   2e-89    Pundamilia nyererei
ref|XP_008185322.1|  PREDICTED: COP9 complex homolog subunit 5 is...    280   3e-89    Acyrthosiphon pisum
ref|XP_005797898.1|  PREDICTED: COP9 signalosome complex subunit ...    280   3e-89    Xiphophorus maculatus
emb|CBN81931.1|  COP9 signalosome complex subunit 5                     279   3e-89    Dicentrarchus labrax [European sea bass]
ref|XP_008305996.1|  PREDICTED: COP9 signalosome complex subunit 5      279   3e-89    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005066755.1|  PREDICTED: COP9 signalosome complex subunit 5      281   3e-89    
ref|XP_004081080.1|  PREDICTED: COP9 signalosome complex subunit 5      279   3e-89    Oryzias latipes [Japanese rice fish]
ref|XP_007554550.1|  PREDICTED: COP9 signalosome complex subunit 5      279   3e-89    Poecilia formosa
gb|ACO09632.1|  COP9 signalosome complex subunit 5                      279   4e-89    Osmerus mordax
ref|XP_003967989.1|  PREDICTED: COP9 signalosome complex subunit ...    279   4e-89    
emb|CAG00664.1|  unnamed protein product                                279   4e-89    Tetraodon nigroviridis
ref|XP_008394459.1|  PREDICTED: COP9 signalosome complex subunit 5      279   4e-89    Poecilia reticulata
ref|XP_006634059.1|  PREDICTED: COP9 signalosome complex subunit ...    278   1e-88    Lepisosteus oculatus
ref|XP_003443502.1|  PREDICTED: COP9 signalosome complex subunit ...    278   1e-88    Oreochromis niloticus
ref|XP_972769.1|  PREDICTED: COP9 signalosome complex subunit 5         278   2e-88    
ref|NP_001158520.1|  COP9 signalosome complex subunit 5                 277   2e-88    Oncorhynchus mykiss
ref|XP_008485715.1|  PREDICTED: COP9 signalosome complex subunit ...    278   2e-88    Diaphorina citri
ref|XP_008479869.1|  PREDICTED: COP9 signalosome complex subunit ...    278   2e-88    Diaphorina citri
ref|XP_010884175.1|  PREDICTED: COP9 signalosome complex subunit 5      277   2e-88    Esox lucius
ref|XP_011297758.1|  PREDICTED: COP9 signalosome complex subunit 5      277   4e-88    Fopius arisanus
gb|KIZ06923.1|  COP9 signalosome complex subunit 5                      278   4e-88    Monoraphidium neglectum
ref|NP_001156462.1|  COP9 complex homolog subunit 5                     276   4e-88    Acyrthosiphon pisum
ref|XP_006565324.1|  PREDICTED: COP9 signalosome complex subunit ...    277   5e-88    Apis mellifera [bee]
ref|XP_004354957.1|  Mov34/MPN/PAD-1 family protein                     277   6e-88    Cavenderia fasciculata
ref|XP_003399827.1|  PREDICTED: COP9 signalosome complex subunit ...    276   6e-88    Bombus terrestris [large earth bumblebee]
ref|XP_623836.1|  PREDICTED: COP9 signalosome complex subunit 5 i...    276   7e-88    Apis mellifera [bee]
ref|XP_003486847.1|  PREDICTED: COP9 signalosome complex subunit ...    276   7e-88    Bombus impatiens
ref|XP_011267966.1|  PREDICTED: COP9 signalosome complex subunit 5      276   8e-88    Camponotus floridanus
ref|XP_004524029.1|  PREDICTED: COP9 signalosome complex subunit ...    276   8e-88    Ceratitis capitata [medfly]
ref|XP_011332242.1|  PREDICTED: COP9 signalosome complex subunit 5      276   9e-88    Ooceraea biroi
emb|CDH56438.1|  cop9 signalosome complex subunit 5a-like               276   1e-87    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003700698.1|  PREDICTED: COP9 signalosome complex subunit ...    276   1e-87    Megachile rotundata
ref|XP_005648133.1|  Mov34-domain-containing protein                    276   1e-87    Coccomyxa subellipsoidea C-169
gb|ETN63713.1|  jun activation domain binding protein                   276   1e-87    Anopheles darlingi [American malaria mosquito]
ref|XP_011147629.1|  PREDICTED: COP9 signalosome complex subunit ...    276   1e-87    Harpegnathos saltator
ref|XP_011147628.1|  PREDICTED: COP9 signalosome complex subunit ...    276   2e-87    
dbj|GAM27607.1|  hypothetical protein SAMD00019534_107830               275   2e-87    Acytostelium subglobosum LB1
ref|XP_008217730.1|  PREDICTED: COP9 signalosome complex subunit ...    276   2e-87    Nasonia vitripennis
ref|XP_008217721.1|  PREDICTED: COP9 signalosome complex subunit ...    276   2e-87    
emb|CDS11961.1|  Putative COP9 signalosome complex subunit 5a           275   2e-87    Lichtheimia ramosa
ref|XP_011049626.1|  PREDICTED: COP9 signalosome complex subunit ...    275   2e-87    Acromyrmex echinatior
gb|ACI68431.1|  COP9 signalosome complex subunit 5                      275   2e-87    Salmo salar
ref|XP_011292660.1|  PREDICTED: COP9 signalosome complex subunit 5      275   3e-87    
ref|XP_011049625.1|  PREDICTED: COP9 signalosome complex subunit ...    275   3e-87    
ref|XP_011147627.1|  PREDICTED: COP9 signalosome complex subunit ...    276   3e-87    
gb|EFN79117.1|  COP9 signalosome complex subunit 5                      276   3e-87    
ref|XP_011171452.1|  PREDICTED: COP9 signalosome complex subunit 5      275   3e-87    
gb|KFB47242.1|  hypothetical protein ZHAS_00015265                      274   5e-87    
ref|XP_001649479.1|  AAEL014747-PA                                      274   5e-87    
ref|XP_003424702.2|  PREDICTED: COP9 signalosome complex subunit ...    275   6e-87    
ref|XP_011209192.1|  PREDICTED: COP9 signalosome complex subunit 5      273   7e-87    
ref|XP_011049624.1|  PREDICTED: COP9 signalosome complex subunit ...    275   8e-87    
gb|AII16527.1|  COP9 signalosome complex subunit 5                      273   9e-87    
emb|CEG78022.1|  Putative COP9 signalosome complex subunit 5a           273   1e-86    
emb|CEG64164.1|  Putative COP9 signalosome complex subunit 5a           272   2e-86    
ref|XP_006675144.1|  hypothetical protein BATDEDRAFT_15731              272   2e-86    
ref|XP_011182476.1|  PREDICTED: COP9 signalosome complex subunit 5      272   3e-86    
gb|KFH67419.1|  COP9 signalosome complex subunit 5                      273   4e-86    
gb|ESA08506.1|  hypothetical protein GLOINDRAFT_349082                  273   4e-86    
ref|XP_003399828.1|  PREDICTED: COP9 signalosome complex subunit ...    271   5e-86    
ref|XP_002129245.1|  PREDICTED: COP9 signalosome complex subunit ...    273   5e-86    
emb|CDY12502.1|  BnaC07g13420D                                          271   6e-86    
gb|EFA83038.1|  Mov34/MPN/PAD-1 family protein                          272   9e-86    
ref|NP_001262639.1|  COP9 complex homolog subunit 5, isoform B          270   1e-85    
ref|XP_002103175.1|  GD19103                                            270   1e-85    
gb|AAD27862.2|AF132563_1  LD14392p                                      271   1e-85    
ref|XP_001862398.1|  COP9 signalosome complex subunit 5                 273   1e-85    
ref|NP_477442.1|  COP9 complex homolog subunit 5, isoform A             270   1e-85    
ref|XP_001980192.1|  GG17007                                            270   1e-85    
ref|XP_002074130.1|  GK14483                                            270   1e-85    
ref|XP_001359383.1|  GA13321                                            270   1e-85    
ref|XP_001990340.1|  GH19288                                            270   2e-85    
ref|XP_002056387.1|  GJ10255                                            270   2e-85    
ref|XP_004363323.1|  constitutive photomorphogenic 9 complex chai...    270   2e-85    
ref|XP_001998673.1|  GI23503                                            269   3e-85    
gb|AAD28608.1|AF129083_1  COP9 signalosome subunit 5 CSN5               268   6e-85    
ref|XP_312032.5|  AGAP002880-PA                                         267   3e-84    
ref|XP_006028872.1|  PREDICTED: COP9 signalosome complex subunit 5      264   7e-84    
ref|XP_010149546.1|  PREDICTED: COP9 signalosome complex subunit 5      262   1e-83    
ref|XP_001954897.1|  GF18500                                            265   1e-83    
gb|EMC87035.1|  COP9 signalosome complex subunit 5                      262   2e-83    
ref|XP_005851620.1|  hypothetical protein CHLNCDRAFT_19207              266   2e-83    
gb|KFV92888.1|  COP9 signalosome complex subunit 5                      262   2e-83    
ref|XP_006150523.1|  PREDICTED: COP9 signalosome complex subunit ...    263   5e-83    
gb|KFQ67876.1|  COP9 signalosome complex subunit 5                      261   5e-83    
dbj|BAD92371.1|  COP9 signalosome subunit 5 variant                     261   9e-83    
emb|CEP10016.1|  hypothetical protein                                   266   1e-82    
ref|XP_004842148.1|  PREDICTED: COP9 signalosome complex subunit ...    262   1e-82    
ref|XP_002952633.1|  hypothetical protein VOLCADRAFT_81927              263   1e-82    
ref|XP_001694818.1|  COP signalosome subunit 5                          260   8e-82    
gb|KJB65954.1|  hypothetical protein B456_010G123100                    258   9e-82    
ref|XP_005770092.1|  hypothetical protein EMIHUDRAFT_75732              260   2e-81    
ref|XP_011502813.1|  PREDICTED: COP9 signalosome complex subunit 5      259   3e-81    
gb|KIK24601.1|  hypothetical protein PISMIDRAFT_678215                  256   9e-81    
emb|CDP99135.1|  Protein BM-CSN-5, isoform b                            258   1e-80    
gb|EDL14299.1|  COP9 (constitutive photomorphogenic) homolog, sub...    254   1e-80    
gb|EPY74001.1|  COP9 signalosome complex subunit 5 isoform 1            263   1e-80    
emb|CDP99134.1|  Protein BM-CSN-5, isoform d                            258   2e-80    
ref|XP_002422812.1|  COP9 signalosome complex subunit, putative         256   3e-80    
dbj|GAN00834.1|  COP9-signalosome 5B                                    257   7e-80    
gb|KFO20318.1|  COP9 signalosome complex subunit 5                      262   1e-79    
ref|XP_009552267.1|  Metallo peptidase M67A                             256   1e-79    
ref|XP_003740357.1|  PREDICTED: COP9 signalosome complex subunit ...    254   2e-79    
ref|XP_007394451.1|  hypothetical protein PHACADRAFT_253814             255   3e-79    
gb|EFO27045.2|  COP9 signalosome complex subunit 5                      253   1e-78    
ref|XP_003137030.1|  COP9 signalosome complex subunit 5                 253   2e-78    
gb|KIO05285.1|  hypothetical protein M404DRAFT_999877                   253   2e-78    
gb|KII84562.1|  hypothetical protein PLICRDRAFT_179381                  253   2e-78    
gb|AAL82571.1|  Jun activation domain binding protein                   246   3e-78    
emb|CCM01188.1|  predicted protein                                      250   3e-78    
ref|XP_007263567.1|  Mov34-domain-containing protein                    251   5e-78    
gb|KIK72494.1|  hypothetical protein PAXRUDRAFT_836440                  246   1e-77    
gb|KJA26913.1|  hypothetical protein HYPSUDRAFT_36079                   251   1e-77    
ref|XP_007313368.1|  hypothetical protein SERLADRAFT_456480             250   2e-77    
gb|KIJ90495.1|  hypothetical protein K443DRAFT_686728                   250   2e-77    
dbj|GAA27173.1|  COP9 signalosome complex subunit 5                     249   2e-77    
gb|KGB40099.1|  COP9 signalosome complex subunit 5                      249   3e-77    
ref|XP_007383497.1|  Mov34-domain-containing protein                    249   3e-77    
emb|CCD78036.1|  Jab1/MPN domain metalloenzyme (M67 family)             248   5e-77    
dbj|BAJ34223.1|  unnamed protein product                                245   7e-77    
gb|KDR72698.1|  hypothetical protein GALMADRAFT_252900                  248   8e-77    
ref|XP_001839727.2|  jun coactivator Jab1                               249   8e-77    
gb|KIM86852.1|  hypothetical protein PILCRDRAFT_289786                  248   1e-76    
gb|KIP09733.1|  hypothetical protein PHLGIDRAFT_18515                   248   1e-76    
ref|XP_003029105.1|  hypothetical protein SCHCODRAFT_70193              248   1e-76    
ref|XP_007337040.1|  Mov34-domain-containing protein                    247   3e-76    
gb|KIK40381.1|  hypothetical protein CY34DRAFT_807228                   246   5e-76    
emb|CDO75755.1|  hypothetical protein BN946_scf184921.g31               246   7e-76    
ref|XP_008041270.1|  Mov34-domain-containing protein                    246   8e-76    
ref|XP_006262064.1|  PREDICTED: COP9 signalosome complex subunit 5      244   1e-75    
ref|XP_007363558.1|  Mov34-domain-containing protein                    246   1e-75    
gb|EIE80444.1|  hypothetical protein RO3G_05149                         244   1e-75    
ref|XP_005833249.1|  hypothetical protein GUITHDRAFT_107880             244   2e-75    
gb|KIM42468.1|  hypothetical protein M413DRAFT_444883                   245   2e-75    
gb|EMD34840.1|  hypothetical protein CERSUDRAFT_117048                  245   2e-75    
ref|XP_007303304.1|  Mov34-domain-containing protein                    245   2e-75    
ref|XP_001882520.1|  predicted protein                                  244   3e-75    
ref|XP_003384689.1|  PREDICTED: COP9 signalosome complex subunit ...    243   4e-75    
ref|XP_007876876.1|  hypothetical protein PFL1_01182                    244   5e-75    
gb|EPS97388.1|  hypothetical protein FOMPIDRAFT_1025013                 244   5e-75    
gb|KDQ24552.1|  hypothetical protein PLEOSDRAFT_1094348                 244   5e-75    
ref|XP_007867853.1|  Mov34-domain-containing protein                    243   9e-75    
emb|CDJ85538.1|  Mov34 MPN PAD-1 domain containing protein              243   2e-74    
emb|CDJ96405.1|  Mov34 MPN PAD-1 domain containing protein              243   2e-74    
ref|XP_007332426.1|  hypothetical protein AGABI1DRAFT_62649             242   2e-74    
gb|KDQ08143.1|  hypothetical protein BOTBODRAFT_38129                   242   2e-74    
gb|ERG87648.1|  cop9 signalosome complex subunit 5                      241   2e-74    
gb|KDE08164.1|  COP9 signalosome complex subunit 5                      243   2e-74    
gb|KIJ18085.1|  hypothetical protein PAXINDRAFT_167370                  242   2e-74    
ref|XP_006464013.1|  hypothetical protein AGABI2DRAFT_209023            242   2e-74    
ref|XP_008148613.1|  PREDICTED: COP9 signalosome complex subunit 5      240   2e-74    
gb|KIM56673.1|  hypothetical protein SCLCIDRAFT_1220107                 242   5e-74    
gb|KDD74343.1|  hypothetical protein H632_c1386p0                       238   7e-74    
ref|XP_007856350.1|  cop9 signalosome complex subunit 5                 241   8e-74    
ref|XP_005705078.1|  COP9 signalosome complex subunit 5                 239   2e-73    
ref|XP_004588161.1|  PREDICTED: COP9 signalosome complex subunit 5      237   3e-73    
gb|KHJ84222.1|  Mov34/MPN/PAD-1 family protein                          236   6e-73    
gb|KIL64761.1|  hypothetical protein M378DRAFT_77858                    238   8e-73    
ref|XP_002114449.1|  hypothetical protein TRIADDRAFT_27810              237   9e-73    
gb|KIY62389.1|  Mov34-domain-containing protein                         237   2e-72    
ref|XP_002837843.1|  hypothetical protein                               236   4e-72    
ref|XP_001900779.1|  COP9 signalosome complex subunit 5                 235   4e-72    
gb|EJW89035.1|  JAB-MPN domain-containing protein                       235   5e-72    
gb|KDQ60418.1|  hypothetical protein JAAARDRAFT_32821                   236   6e-72    
gb|ETN69927.1|  Mov34/MPN/PAD-1 family protein                          234   7e-72    
emb|CDJ03438.1|  COP9 signalosome complex subunit 5                     235   7e-72    
gb|KIY49923.1|  Mov34-domain-containing protein                         236   1e-71    
emb|CEL63357.1|  COP9 signalosome complex subunit 5                     234   3e-71    
gb|EMS21844.1|  COP9 signalosome complex subunit 5                      233   1e-70    
gb|EFX73885.1|  hypothetical protein DAPPUDRAFT_109433                  231   1e-70    
gb|EYC46046.1|  hypothetical protein Y032_0410g948                      233   1e-70    
gb|EUB63749.1|  COP9 signalosome complex subunit                        232   1e-70    
gb|EYC46045.1|  hypothetical protein Y032_0410g948                      233   1e-70    
gb|KIK65834.1|  hypothetical protein GYMLUDRAFT_38312                   232   1e-70    
gb|EGU11163.1|  COP9 signalosome complex subunit 5                      233   2e-70    
emb|CDS15909.1|  COP9 signalosome complex subunit 5                     231   3e-70    
gb|EWC48220.1|  COP9 signalosome complex subunit 5                      231   3e-70    
ref|XP_003089147.1|  hypothetical protein CRE_15192                     231   3e-70    
ref|XP_011120074.1|  hypothetical protein AOL_s00054g456                231   3e-70    
gb|EUC54240.1|  COP9 signalosome complex subunit 5                      232   3e-70    
gb|EGT48387.1|  hypothetical protein CAEBREN_22923                      231   4e-70    
ref|XP_003101399.1|  CRE-CSN-5 protein                                  231   4e-70    
gb|EGT56002.1|  hypothetical protein CAEBREN_15614                      231   4e-70    
ref|NP_500841.1|  Protein CSN-5                                         231   7e-70    
ref|XP_009162505.1|  hypothetical protein T265_00468                    245   9e-70    
gb|KIO31911.1|  hypothetical protein M407DRAFT_14046                    231   1e-69    
ref|XP_007772746.1|  Mov34-domain-containing protein                    232   2e-69    
ref|XP_002633848.1|  C. briggsae CBR-CSN-5 protein                      229   3e-69    
gb|KIM33767.1|  hypothetical protein M408DRAFT_325370                   229   3e-69    
emb|CEF98127.1|  JAB/MPN domain                                         228   3e-69    
ref|XP_011109554.1|  hypothetical protein H072_3584                     229   3e-69    
emb|CCA72027.1|  probable COP9 signalosome subunit 5 CSN5               229   3e-69    
gb|KIJ63800.1|  hypothetical protein HYDPIDRAFT_40823                   229   3e-69    
ref|XP_003079540.1|  COP9 signalosome, subunit CSN5 (ISS)               229   4e-69    
gb|KIN05013.1|  hypothetical protein OIDMADRAFT_142793                  228   4e-69    
gb|EPZ33258.1|  JAB1/Mov34/MPN/PAD-1 domain-containing protein          226   2e-68    
gb|ESZ94555.1|  COP9 signalosome complex subunit 5                      226   3e-68    
ref|XP_002678028.1|  jun kinase activation domain binding protein       226   3e-68    
gb|KFV44427.1|  COP9 signalosome complex subunit 5                      220   3e-68    
dbj|BAB63008.1|  hypothetical protein                                   221   4e-68    
ref|XP_009814186.1|  PREDICTED: COP9 signalosome complex subunit 5      220   4e-68    
emb|CCG82078.1|  putative COP9 signalosome subunit 5                    226   5e-68    
ref|XP_002408598.1|  COP9 signalosome, subunit CSN5, putative           222   6e-68    
gb|KHN85679.1|  COP9 signalosome complex subunit 5                      226   1e-67    
gb|EZF23226.1|  COP9 signalosome complex subunit 5                      223   2e-67    
dbj|GAD91695.1|  COP9 signalosome complex subunit 5                     223   3e-67    
emb|CCO32282.1|  COP9 signalosome complex subunit 5                     234   3e-67    
ref|XP_005712040.1|  unnamed protein product                            224   4e-67    
ref|XP_003234683.1|  COP9 signalosome complex subunit 5                 223   5e-67    
ref|XP_007289754.1|  COP9 signalosome complex subunit 5                 224   5e-67    
ref|XP_004047172.1|  PREDICTED: COP9 signalosome complex subunit 5      226   7e-67    
ref|XP_003170580.1|  COP9 signalosome complex subunit 5                 222   8e-67    
ref|XP_008083662.1|  JAB1/MPN                                           222   9e-67    
gb|EGD96904.1|  COP9 signalosome complex subunit 5                      221   2e-66    
pdb|4F7O|A  Chain A, Crystal Structure Of Csn5                          218   2e-66    
gb|KHJ81212.1|  hypothetical protein OESDEN_19102                       214   3e-66    
ref|XP_001551965.1|  hypothetical protein BC1G_09577                    221   3e-66    
ref|XP_001743582.1|  hypothetical protein                               220   6e-66    
ref|XP_003056186.1|  predicted protein                                  219   6e-66    
ref|XP_006815652.1|  PREDICTED: COP9 signalosome complex subunit ...    218   7e-66    
ref|XP_007779451.1|  COP9 signalosome complex subunit 5                 219   8e-66    
gb|AHY82401.1|  COP9 signalosome complex subunit 5                      216   2e-65    
gb|KIJ37072.1|  hypothetical protein M422DRAFT_33926                    220   2e-65    
gb|KIJ25292.1|  hypothetical protein M422DRAFT_785628                   220   2e-65    
ref|XP_003023342.1|  hypothetical protein TRV_02444                     218   3e-65    
ref|XP_003010514.1|  hypothetical protein ARB_03215                     218   3e-65    
ref|XP_001595259.1|  hypothetical protein SS1G_03348                    218   3e-65    
gb|EJT99231.1|  Mov34-domain-containing protein                         219   5e-65    
emb|CCF50521.1|  probable COP9 signalosome subunit 5 CSN5               219   5e-65    
gb|EKG20488.1|  Mov34/MPN/PAD-1                                         218   6e-65    
gb|KIR85968.1|  COP9 signalosome complex subunit 5                      218   1e-64    
gb|AAO41956.1|  putative c-JUN coactivator protein AJH1                 209   2e-64    
ref|XP_007002685.1|  hypothetical protein TREMEDRAFT_60014              216   2e-64    
emb|CCU75067.1|  COP9 signalosome complex subunit 5                     215   3e-64    
gb|EPQ62061.1|  Catalytic subunit of the COP9 signalosome complex       215   4e-64    
gb|AFR97407.1|  COP9 signalosome complex subunit 5                      216   4e-64    
ref|XP_009267304.1|  COP9 signalosome complex subunit 5                 215   4e-64    
ref|XP_002848322.1|  COP9 signalosome complex subunit 5                 215   4e-64    
ref|XP_010756604.1|  COP9 signalosome complex subunit 5                 215   4e-64    
emb|CAX73045.1|  COP9 complex homolog subunit 5                         209   5e-64    
ref|XP_001940104.1|  COP9 signalosome complex subunit 5                 215   8e-64    
emb|CCX31218.1|  Similar to COP9 signalosome complex subunit 5; a...    214   8e-64    
ref|XP_567446.1|  hypothetical protein                                  215   9e-64    
ref|XP_007586662.1|  putative cop9 signalosome complex subunit 5 ...    214   1e-63    
gb|KIW00274.1|  hypothetical protein PV09_08164                         213   1e-63    
ref|XP_006956806.1|  hypothetical protein WALSEDRAFT_59607              213   2e-63    
dbj|GAA97544.1|  hypothetical protein E5Q_04222                         214   2e-63    
ref|XP_004842149.1|  PREDICTED: COP9 signalosome complex subunit ...    210   3e-63    
gb|KIR60500.1|  COP9 signalosome complex subunit 5                      214   3e-63    
ref|XP_007800048.1|  COP9 signalosome complex subunit 5                 213   3e-63    
gb|EXX54839.1|  Rri1p                                                   210   4e-63    
ref|XP_001806244.1|  hypothetical protein SNOG_16117                    214   4e-63    
ref|XP_002626520.1|  COP9 signalosome complex subunit 5                 213   4e-63    
gb|KIR47282.1|  COP9 signalosome complex subunit 5                      213   6e-63    
gb|KFX90480.1|  hypothetical protein V490_06441                         212   6e-63    
ref|XP_003196240.1|  COP9 signalosome complex subunit 5a                213   7e-63    
gb|KIY32538.1|  COP9 signalosome complex subunit 5                      213   7e-63    
ref|XP_007410237.1|  hypothetical protein MELLADRAFT_116525             213   7e-63    
gb|KHJ34882.1|  putative cop9 signalosome complex subunit 5             211   1e-62    
ref|XP_002791463.1|  COP9 signalosome complex subunit 5                 211   1e-62    
gb|EST07993.1|  hypothetical protein PSEUBRA_SCAF19g03258               212   1e-62    
ref|XP_003301972.1|  hypothetical protein PTT_13630                     211   2e-62    
gb|KGB79807.1|  COP9 signalosome complex subunit 5                      212   2e-62    



>emb|CBI37693.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   422 bits (1084),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 211/222 (95%), Positives = 217/222 (98%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  39   ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  98

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  99   EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  158

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSA
Sbjct  159  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSA  218

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRSRTE SGPEPM+ET
Sbjct  219  KITVEQVHGLMSQVIKDILFNSVRQSNRSRTEPSGPEPMIET  260



>ref|XP_002283561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Vitis vinifera]
Length=360

 Score =   424 bits (1089),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 211/222 (95%), Positives = 217/222 (98%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSA
Sbjct  259  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSA  318

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRSRTE SGPEPM+ET
Sbjct  319  KITVEQVHGLMSQVIKDILFNSVRQSNRSRTEPSGPEPMIET  360



>gb|KDP33444.1| hypothetical protein JCGZ_07015 [Jatropha curcas]
Length=366

 Score =   418 bits (1075),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 209/222 (94%), Positives = 216/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  145  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  204

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  205  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  264

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP+QRKKEEESQLAKIT DSA
Sbjct  265  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPSQRKKEEESQLAKITRDSA  324

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VR S+RSRTE SGPEPMVE+
Sbjct  325  KITVEQVHGLMSQVIKDILFNSVRPSSRSRTEGSGPEPMVES  366



>ref|XP_008445090.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Cucumis 
melo]
Length=365

 Score =   417 bits (1071),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/222 (94%), Positives = 215/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  144  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  203

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  204  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  263

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQ ENQL+HSRFGPLIAP+QRKKEE+SQLAKIT DSA
Sbjct  264  SSSPLLGNGDYVAGQISDLAEKLEQVENQLAHSRFGPLIAPSQRKKEEDSQLAKITRDSA  323

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSN+SR ESS PEPMVE+
Sbjct  324  KITVEQVHGLMSQVIKDILFNSVRQSNKSRPESSSPEPMVES  365



>ref|XP_002527960.1| jun activation domain binding protein, putative [Ricinus communis]
 gb|EEF34372.1| jun activation domain binding protein, putative [Ricinus communis]
Length=367

 Score =   417 bits (1071),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/222 (94%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP QRKKEEESQL KIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPPQRKKEEESQLTKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS+RSR E SGPEPMVET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVRQSSRSRAEGSGPEPMVET  367



>emb|CDP18325.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   412 bits (1058),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 206/222 (93%), Positives = 216/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  39   ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  98

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  99   EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  158

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+H+RFG ++AP QRKKEEESQLAKIT DSA
Sbjct  159  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHARFGHIMAPPQRKKEEESQLAKITRDSA  218

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFNTVRQSN+S+T+SSGP+PMVET
Sbjct  219  KITVEQVHGLMSQVIKDILFNTVRQSNKSQTKSSGPDPMVET  260



>ref|XP_010111938.1| COP9 signalosome complex subunit 5b [Morus notabilis]
 gb|EXC32056.1| COP9 signalosome complex subunit 5b [Morus notabilis]
Length=368

 Score =   415 bits (1067),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 208/222 (94%), Positives = 215/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  147  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  206

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  207  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  266

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP QRKK+EESQLAKIT DSA
Sbjct  267  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPPQRKKDEESQLAKITRDSA  326

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRS  E SGP+PM+E+
Sbjct  327  KITVEQVHGLMSQVIKDILFNSVRQSNRSHAEPSGPDPMIES  368



>ref|XP_009617619.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
tomentosiformis]
Length=367

 Score =   414 bits (1065),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/222 (93%), Positives = 215/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVTTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPL+AP QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLMAPPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS +S+TE SGPEPM+ET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVRQSGKSQTEPSGPEPMIET  367



>ref|XP_004138765.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 ref|XP_004160845.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cucumis 
sativus]
 gb|KGN62874.1| hypothetical protein Csa_2G378560 [Cucumis sativus]
Length=365

 Score =   414 bits (1064),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  144  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  203

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  204  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  263

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQ ENQL+HSRFGPLIAP+QRKKEE+SQLAKIT DSA
Sbjct  264  SSSPLLGNGDYVAGQISDLAEKLEQVENQLAHSRFGPLIAPSQRKKEEDSQLAKITRDSA  323

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQ N+SR ESS PEPMVE+
Sbjct  324  KITVEQVHGLMSQVIKDILFNSVRQPNKSRPESSSPEPMVES  365



>ref|XP_003522659.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=374

 Score =   414 bits (1063),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 215/222 (97%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  153  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  212

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  213  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  272

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP  RKKEEES LAKIT DSA
Sbjct  273  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSA  332

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+NR+RTE+SGPEPM+E+
Sbjct  333  KITVEQVHGLMSQVIKDILFNSVHQANRTRTEASGPEPMIES  374



>ref|XP_002324396.1| COP9 complex family protein [Populus trichocarpa]
 gb|EEF02961.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   413 bits (1061),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 214/222 (96%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQL+HSR GPL+AP QRKK+EESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEHAENQLAHSRLGPLMAP-QRKKDEESQLAKITRDSA  324

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRSR E+SGPEPMVET
Sbjct  325  KITVEQVHGLMSQVIKDILFNSVRQSNRSRAETSGPEPMVET  366



>ref|XP_007137114.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
 gb|ESW09108.1| hypothetical protein PHAVU_009G100700g [Phaseolus vulgaris]
Length=374

 Score =   412 bits (1059),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  153  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  212

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  213  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  272

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP  RKKEEES LAKIT DSA
Sbjct  273  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSA  332

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+NR+RTE SGPEPM+E+
Sbjct  333  KITVEQVHGLMSQVIKDILFNSVHQANRNRTEPSGPEPMIES  374



>ref|XP_003526451.1| PREDICTED: COP9 signalosome complex subunit 5a [Glycine max]
Length=375

 Score =   412 bits (1058),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/222 (93%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  154  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  213

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  214  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  273

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP  RKKEEES LAKIT DSA
Sbjct  274  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSA  333

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+NR+RTE SGPEPM+E+
Sbjct  334  KITVEQVHGLMSQVIKDILFNSVHQANRTRTEPSGPEPMIES  375



>gb|EYU29155.1| hypothetical protein MIMGU_mgv1a0088021mg, partial [Erythranthe 
guttata]
Length=226

 Score =   405 bits (1041),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/222 (92%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  5    ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  64

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTL
Sbjct  65   EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSGLDSHLLDLLWNKYWVNTL  124

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEK+EQAE+QLSHSRFG LI   QRKKEEESQL KIT DSA
Sbjct  125  SSSPLLGNGDYVAGQISDLAEKIEQAESQLSHSRFGSLITAPQRKKEEESQLTKITRDSA  184

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSN+S+ ESS PEPMVET
Sbjct  185  KITVEQVHGLMSQVIKDILFNSVRQSNKSQAESSSPEPMVET  226



>ref|XP_004291259.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=359

 Score =   410 bits (1054),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  138  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  197

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTL
Sbjct  198  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSCLDSHLLDLLWNKYWVNTL  257

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN LSHSRFGPL+ P QRKK+EESQLAKIT DSA
Sbjct  258  SSSPLLGNGDYVAGQISDLAEKLEQAENHLSHSRFGPLVTPTQRKKDEESQLAKITRDSA  317

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V+QSN+S TE SGPEPM+E+
Sbjct  318  KITVEQVHGLMSQVIKDILFNSVQQSNKSNTEPSGPEPMIES  359



>ref|XP_009786152.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nicotiana 
sylvestris]
Length=367

 Score =   410 bits (1054),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 205/222 (92%), Positives = 214/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVTTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPL+AP QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLMAPPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V QS +S+TE SGPEPM+ET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVCQSGKSQTEPSGPEPMIET  367



>ref|XP_011045010.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=366

 Score =   409 bits (1052),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/222 (93%), Positives = 213/222 (96%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQL+HSR GPL+AP QRKK+EESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEHAENQLAHSRLGPLMAP-QRKKDEESQLAKITRDSA  324

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRSR E+S PEPMVET
Sbjct  325  KITVEQVHGLMSQVIKDILFNSVRQSNRSRAETSDPEPMVET  366



>ref|XP_011031359.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Populus 
euphratica]
Length=365

 Score =   409 bits (1051),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/222 (93%), Positives = 213/222 (96%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  145  ENVIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  204

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  205  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  264

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQL+HSR GPL+ P QRKK+EESQLAKIT DSA
Sbjct  265  SSSPLLGNGDYVAGQISDLAEKLEHAENQLAHSRLGPLMTP-QRKKDEESQLAKITRDSA  323

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRS+TE SGPEPMVET
Sbjct  324  KITVEQVHGLMSQVIKDILFNSVRQSNRSQTEPSGPEPMVET  365



>ref|XP_004501247.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Cicer arietinum]
Length=356

 Score =   408 bits (1049),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/223 (92%), Positives = 215/223 (96%), Gaps = 1/223 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  134  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  194  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP  RKKEEES LAKIT DSA
Sbjct  254  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPTPRKKEEESPLAKITRDSA  313

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTE-SSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+N+SRT+ +SGPEPM+E+
Sbjct  314  KITVEQVHGLMSQVIKDILFNSVHQANKSRTDTTSGPEPMIES  356



>ref|XP_010259860.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Nelumbo 
nucifera]
Length=363

 Score =   407 bits (1046),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 206/225 (92%), Positives = 212/225 (94%), Gaps = 3/225 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGN DYVAGQISDLAEKLEQAENQL+HSRFG  I P+QRKKEEESQLAKIT DS+
Sbjct  259  SSSPLLGNRDYVAGQISDLAEKLEQAENQLAHSRFGAFIFPSQRKKEEESQLAKITRDSS  318

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSR---TESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRSR   TE S PEPMVET
Sbjct  319  KITVEQVHGLMSQVIKDILFNSVRQSNRSRVVATEQSSPEPMVET  363



>ref|XP_011076561.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Sesamum 
indicum]
Length=361

 Score =   407 bits (1045),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  140  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  200  DGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDY AGQISDLAEK+EQAENQLSHSRFG L+A  QRKKEEESQL KIT DSA
Sbjct  260  SSSPLLGNGDYFAGQISDLAEKIEQAENQLSHSRFGSLLAAPQRKKEEESQLTKITRDSA  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSN+S+ ESSGPEPMVET
Sbjct  320  KITVEQVHGLMSQVIKDILFNSVRQSNKSQAESSGPEPMVET  361



>ref|XP_003603531.1| COP9 signalosome complex subunit 5b [Medicago truncatula]
 gb|AES73782.1| COP9 signalosome complex subunit 5 [Medicago truncatula]
Length=357

 Score =   406 bits (1044),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  EGYKPADDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPL+AP  RKKEEES LAKIT DSA
Sbjct  256  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSA  315

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+N+SRTE+S PEPM+E+
Sbjct  316  KITVEQVHGLMSQVIKDILFNSVHQANKSRTETSDPEPMIES  357



>gb|ACJ84456.1| unknown [Medicago truncatula]
Length=357

 Score =   406 bits (1043),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/222 (91%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  EGYKPADDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPL+AP  RKKEEES LAKIT DSA
Sbjct  256  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSA  315

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+N+SRTE+S PEPM+E+
Sbjct  316  KITVEQVHGLMSQVIKDILFNSVHQANKSRTETSDPEPMIES  357



>ref|XP_011459046.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=360

 Score =   405 bits (1042),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 203/223 (91%), Positives = 213/223 (96%), Gaps = 1/223 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  138  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  197

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKS LDSHLLDLLWNKYWVNTL
Sbjct  198  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSCLDSHLLDLLWNKYWVNTL  257

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAEN LSHSRFGPL+ P QRKK+ EESQLAKIT DS
Sbjct  258  SSSPLLGNGDYVAGQISDLAEKLEQAENHLSHSRFGPLVTPTQRKKDQEESQLAKITRDS  317

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            AKITVEQVHGLMSQVIKDILFN+V+QSN+S TE SGPEPM+E+
Sbjct  318  AKITVEQVHGLMSQVIKDILFNSVQQSNKSNTEPSGPEPMIES  360



>ref|XP_006382165.1| COP9 complex family protein [Populus trichocarpa]
 gb|ERP59962.1| COP9 complex family protein [Populus trichocarpa]
Length=366

 Score =   405 bits (1042),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 206/222 (93%), Positives = 212/222 (95%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQL+HSR GPL+ P QRKK+EESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEHAENQLAHSRLGPLMTP-QRKKDEESQLAKITRDSA  324

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V QSNRS+TE SGPEPMVET
Sbjct  325  KITVEQVHGLMSQVIKDILFNSVHQSNRSQTEPSGPEPMVET  366



>ref|XP_007221779.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
 ref|XP_008219932.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Prunus mume]
 gb|EMJ22978.1| hypothetical protein PRUPE_ppa007500mg [Prunus persica]
Length=366

 Score =   405 bits (1040),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 207/227 (91%), Positives = 212/227 (93%), Gaps = 5/227 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  140  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  200  EGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN LSHSRFGPLI P QRKKEEESQLAKIT DSA
Sbjct  260  SSSPLLGNGDYVAGQISDLAEKLEQAENHLSHSRFGPLITPPQRKKEEESQLAKITRDSA  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNR-----SRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSN+     S TE S PEPMVE+
Sbjct  320  KITVEQVHGLMSQVIKDILFNSVRQSNKSLTQPSLTEPSDPEPMVES  366



>ref|XP_010048447.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Eucalyptus 
grandis]
 gb|KCW80696.1| hypothetical protein EUGRSUZ_C02093 [Eucalyptus grandis]
Length=375

 Score =   405 bits (1041),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 204/222 (92%), Positives = 213/222 (96%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  154  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  213

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+PVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  214  DGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  273

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+H+RFGPLIAP QRKKEE+SQL KIT DSA
Sbjct  274  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHTRFGPLIAPPQRKKEEDSQLTKITRDSA  333

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS +S +E S PEPMVET
Sbjct  334  KITVEQVHGLMSQVIKDILFNSVRQSQKSCSEPSEPEPMVET  375



>ref|XP_006351153.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   404 bits (1039),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 211/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLD+TYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL HSRFGPL+A  QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEQAENQLPHSRFGPLVAAPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V QS +S+TE S PEPM+ET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVCQSGKSQTEPSDPEPMIET  367



>gb|AAC26484.1| putative JUN kinase activation domain binding protein [Medicago 
sativa]
Length=357

 Score =   404 bits (1037),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  EGYKPADDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPL+AP  RKKEEES LAKIT DSA
Sbjct  256  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSA  315

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V Q+N+S TE+S PEPM+E+
Sbjct  316  KITVEQVHGLMSQVIKDILFNSVHQANKSHTETSDPEPMIES  357



>gb|KDO67280.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=360

 Score =   404 bits (1037),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 210/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENAVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR+GPLIAP  R+KEE+SQLAKIT DSA
Sbjct  259  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRYGPLIAPPPRRKEEDSQLAKITRDSA  318

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS ++  E S PEPM+E+
Sbjct  319  KITVEQVHGLMSQVIKDILFNSVRQSTKTHAEPSDPEPMIES  360



>ref|XP_004241422.1| PREDICTED: COP9 signalosome complex subunit 5b [Solanum lycopersicum]
Length=367

 Score =   402 bits (1032),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD  LLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCRLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQLS+SR+  L+AP QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEHAENQLSNSRYASLMAPPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V +S++S+TESSGPEPM+E+
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVGKSSKSQTESSGPEPMIES  367



>ref|XP_006450165.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483570.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Citrus sinensis]
 gb|ESR63405.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=360

 Score =   401 bits (1030),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENAVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR+GPLIAP  R+KEE+SQLAKIT DSA
Sbjct  259  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRYGPLIAPPPRRKEEDSQLAKITRDSA  318

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS ++    S PEPM+E+
Sbjct  319  KITVEQVHGLMSQVIKDILFNSVRQSTKTHAGPSDPEPMIES  360



>ref|XP_009338826.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Pyrus x 
bretschneideri]
Length=367

 Score =   401 bits (1030),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 213/228 (93%), Gaps = 6/228 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  140  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTL
Sbjct  200  DGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN L+HSRFGPLI P QRK+EEESQLAKIT DSA
Sbjct  260  SSSPLLGNGDYVAGQISDLAEKLEQAENHLAHSRFGPLITPPQRKREEESQLAKITRDSA  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTE------SSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRS  +      SS PEPMVE+
Sbjct  320  KITVEQVHGLMSQVIKDILFNSVRQSNRSLLQPSLTEPSSDPEPMVES  367



>ref|XP_008378244.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=367

 Score =   400 bits (1029),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 213/228 (93%), Gaps = 6/228 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  140  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTL
Sbjct  200  DGYKPPDDPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN L+HSRFGPLI P QRK+EEESQLAKIT DSA
Sbjct  260  SSSPLLGNGDYVAGQISDLAEKLEQAENHLAHSRFGPLITPPQRKREEESQLAKITRDSA  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTE------SSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRS  +      SS PEPMVE+
Sbjct  320  KITVEQVHGLMSQVIKDILFNSVRQSNRSLLQPSLTEPSSDPEPMVES  367



>ref|XP_011082082.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X1 
[Sesamum indicum]
Length=357

 Score =   400 bits (1027),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 202/222 (91%), Positives = 207/222 (93%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  196  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEK+EQAENQL+HSRFG LI    RKKEEESQL KIT DSA
Sbjct  256  SSSPLLGNGDYVAGQISDLAEKIEQAENQLAHSRFGSLIGGPLRKKEEESQLTKITRDSA  315

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSN SR   SGPEPMVE 
Sbjct  316  KITVEQVHGLMSQVIKDILFNSVRQSNGSRANLSGPEPMVEA  357



>gb|KDO67279.1| hypothetical protein CISIN_1g018085mg [Citrus sinensis]
Length=361

 Score =   399 bits (1025),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/223 (90%), Positives = 210/223 (94%), Gaps = 1/223 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENAVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DS
Sbjct  259  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDS  318

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            AKITVEQVHGLMSQVIKDILFN+VRQS ++  E S PEPM+E+
Sbjct  319  AKITVEQVHGLMSQVIKDILFNSVRQSTKTHAEPSDPEPMIES  361



>ref|XP_006347307.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Solanum 
tuberosum]
Length=367

 Score =   399 bits (1025),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 212/222 (95%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLE AENQLS+SR+  L+AP QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEHAENQLSNSRYASLMAPPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V +S++S+TE SGPEPM+E+
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVGKSSKSQTEPSGPEPMIES  367



>ref|XP_008393958.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Malus domestica]
Length=376

 Score =   399 bits (1024),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 212/228 (93%), Gaps = 6/228 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  140  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GY PPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD+HLLDLLWNKYWVNTL
Sbjct  200  KGYIPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDTHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN L+HSRFGPLI P QRK+EEESQLAKIT DSA
Sbjct  260  SSSPLLGNGDYVAGQISDLAEKLEQAENHLAHSRFGPLITPPQRKREEESQLAKITHDSA  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTE------SSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQSNRS  +      SS PEPMVE+
Sbjct  320  KITVEQVHGLMSQVIKDILFNSVRQSNRSLLQPSLTEPSSDPEPMVES  367



>emb|CBL87025.1| CSN5 protein [Solanum lycopersicum]
Length=367

 Score =   398 bits (1023),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVTTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQ EN LSHSRFG L+A  QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLGNGDYVAGQISDLAEKLEQGENHLSHSRFGHLVAAPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V +S +S+TE S PEPMVET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVCKSGKSQTEPSDPEPMVET  367



>gb|KHG19604.1| COP9 signalosome complex subunit 5b -like protein [Gossypium 
arboreum]
 gb|KJB55191.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=352

 Score =   397 bits (1019),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 211/222 (95%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P ++K +EESQLAKIT DSA
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPL-GPPRKKLQEESQLAKITRDSA  310

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS+RS+ + SGPEPM+ET
Sbjct  311  KITVEQVHGLMSQVIKDILFNSVRQSSRSQNDQSGPEPMIET  352



>ref|XP_006450164.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 ref|XP_006483569.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Citrus sinensis]
 gb|ESR63404.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=361

 Score =   396 bits (1017),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/223 (90%), Positives = 209/223 (94%), Gaps = 1/223 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENAVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  199  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DS
Sbjct  259  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDS  318

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            AKITVEQVHGLMSQVIKDILFN+VRQS ++    S PEPM+E+
Sbjct  319  AKITVEQVHGLMSQVIKDILFNSVRQSTKTHAGPSDPEPMIES  361



>ref|NP_001234331.1| JAB [Solanum lycopersicum]
 gb|AAG43411.1| JAB [Solanum lycopersicum]
Length=367

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 209/222 (94%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  146  ENVVGWYHSHPGYGCWLSGIDVTTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  205

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  206  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  265

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLL NGDYVAGQISDLAEK+EQAEN LSHSRFG L+A  QRKKEEESQLAKIT DSA
Sbjct  266  SSSPLLENGDYVAGQISDLAEKMEQAENHLSHSRFGHLVAAPQRKKEEESQLAKITRDSA  325

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V +S +S+TE S PEPMVET
Sbjct  326  KITVEQVHGLMSQVIKDILFNSVCKSGKSQTEPSDPEPMVET  367



>gb|KJB55192.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=350

 Score =   395 bits (1014),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/222 (90%), Positives = 210/222 (95%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P   +K+EESQLAKIT DSA
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPLGPP---RKKEESQLAKITRDSA  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS+RS+ + SGPEPM+ET
Sbjct  309  KITVEQVHGLMSQVIKDILFNSVRQSSRSQNDQSGPEPMIET  350



>ref|XP_007011590.1| COP9-signalosome 5B [Theobroma cacao]
 gb|EOY29209.1| COP9-signalosome 5B [Theobroma cacao]
Length=351

 Score =   394 bits (1012),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 201/222 (91%), Positives = 208/222 (94%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLG+GDYVAGQISDLAEKLEQAENQL+HSR GPL  P  RKKEEESQLAKIT DSA
Sbjct  252  SSSPLLGSGDYVAGQISDLAEKLEQAENQLAHSRIGPLGPP--RKKEEESQLAKITRDSA  309

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQV GLMSQVIKDILFN+VRQSNR R + SGPEPMVE 
Sbjct  310  KITVEQVDGLMSQVIKDILFNSVRQSNRCRNDHSGPEPMVEA  351



>ref|XP_010551182.1| PREDICTED: COP9 signalosome complex subunit 5b [Tarenaya hassleriana]
Length=357

 Score =   391 bits (1005),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 200/221 (90%), Positives = 209/221 (95%), Gaps = 1/221 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR G ++ A  Q+KKE+E QLAKIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGGIVPATLQKKKEDEPQLAKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            AKITVEQVHGLMSQVIKDILFN+VRQSNRS  +SSG +PMV
Sbjct  315  AKITVEQVHGLMSQVIKDILFNSVRQSNRSGNDSSGSDPMV  355



>ref|XP_010669282.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 206/222 (93%), Gaps = 1/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  154  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  213

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+KP DEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  214  EGFKPADEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDCHLLDLLWNKYWVNTL  273

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQ++H+RFG +I P+QRKKEEE  LAKIT DS 
Sbjct  274  SSSPLLGNGDYVAGQISDLAEKLEQAENQMAHTRFGSIITPSQRKKEEEPALAKITRDST  333

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VR  +R + ESS PEPMVE 
Sbjct  334  KITVEQVHGLMSQVIKDILFNSVR-PDRCQAESSEPEPMVEA  374



>gb|ABK24758.1| unknown [Picea sitchensis]
Length=363

 Score =   387 bits (993),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 198/225 (88%), Positives = 207/225 (92%), Gaps = 3/225 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENVIGWYHSHPGYGCWLSGIDVNTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCK YY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  199  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKHYYALDITYFKSSLDSHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGN DYVAGQISDLAEKLEQAE+QL+HSR G  + P QRKKEEESQLAKIT DS+
Sbjct  259  SSSPLLGNRDYVAGQISDLAEKLEQAESQLAHSRVGSFLVPPQRKKEEESQLAKITKDSS  318

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+V QS +S     E SGPEPMVET
Sbjct  319  KITVEQVHGLMSQVIKDILFNSVHQSTKSGIAFGEGSGPEPMVET  363



>gb|KJB55195.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=346

 Score =   385 bits (989),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 206/222 (93%), Gaps = 7/222 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P  RKK     LAKIT DSA
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPLGPP--RKK-----LAKITRDSA  304

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KITVEQVHGLMSQVIKDILFN+VRQS+RS+ + SGPEPM+ET
Sbjct  305  KITVEQVHGLMSQVIKDILFNSVRQSSRSQNDQSGPEPMIET  346



>ref|XP_009420301.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 197/226 (87%), Positives = 210/226 (93%), Gaps = 4/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  143  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  202

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKS+LDSHLLDLLWNKYWVNTL
Sbjct  203  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSALDSHLLDLLWNKYWVNTL  262

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQISDLAEKLEQAENQL+H+R G  + P+QRKKE EESQLAKIT DS
Sbjct  263  SSSPLLGNRDYVAGQISDLAEKLEQAENQLAHTRLGSFLLPSQRKKEPEESQLAKITRDS  322

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSN---RSRTESSGPEPMVET  104
            +KITVEQVHGLMSQVIKDILFN+V  ++    S T+SSGPEPMVE+
Sbjct  323  SKITVEQVHGLMSQVIKDILFNSVHHTSCIPPSLTDSSGPEPMVES  368



>ref|XP_010929274.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Elaeis guineensis]
Length=360

 Score =   384 bits (987),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 194/226 (86%), Positives = 208/226 (92%), Gaps = 4/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  195  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN +YVAGQISDLAEKLE AENQL+H+R G  + P+QRKKE EESQLAK T DS
Sbjct  255  SSSPLLGNREYVAGQISDLAEKLEHAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSR---TESSGPEPMVET  104
            +KITVEQVHGLMSQVIKDILFN+VR S+ +R   ++SSGPEPM+E 
Sbjct  315  SKITVEQVHGLMSQVIKDILFNSVRHSSSARGSLSDSSGPEPMIEA  360



>ref|XP_008810007.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=360

 Score =   383 bits (983),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/226 (86%), Positives = 207/226 (92%), Gaps = 4/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  195  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQISDLAEKLE AENQL+H+R G  + P+QRKKE EESQLAK T DS
Sbjct  255  SSSPLLGNRDYVAGQISDLAEKLEHAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSR---TESSGPEPMVET  104
            ++ITVEQVHGLMSQVIKDILFN+VR S+ +R   ++S GPEPMVE 
Sbjct  315  SRITVEQVHGLMSQVIKDILFNSVRHSSSTRASLSDSFGPEPMVEA  360



>ref|XP_010477567.1| PREDICTED: COP9 signalosome complex subunit 5b [Camelina sativa]
Length=358

 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 208/222 (94%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRD  314

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQSN+  +E+S PEPM+
Sbjct  315  SAKITVEQVHGLMSQVIKDILFNSARQSNKPPSEASDPEPMI  356



>ref|XP_010914180.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Elaeis guineensis]
Length=360

 Score =   380 bits (977),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/226 (86%), Positives = 207/226 (92%), Gaps = 4/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP DEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  195  QGYKPLDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DY+AGQISDLAEKLE AENQL+H+R+G  + P+QRKKE EESQLAK T DS
Sbjct  255  SSSPLLGNRDYIAGQISDLAEKLEHAENQLAHTRWGSFLLPSQRKKENEESQLAKTTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNR---SRTESSGPEPMVET  104
            +KITVEQVHGLMSQVIKDILFNTVR S+    S ++SSGPEPMVE 
Sbjct  315  SKITVEQVHGLMSQVIKDILFNTVRHSSSTCPSLSDSSGPEPMVEA  360



>ref|XP_002887356.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63615.1| hypothetical protein ARALYDRAFT_894961 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   379 bits (972),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 193/221 (87%), Positives = 205/221 (93%), Gaps = 1/221 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAEN L+HSR G + +   RKKE+ESQL KIT DS+
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAENHLAHSRGGIVPSSLHRKKEDESQLTKITRDSS  314

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            KITVEQVHGLMSQVIKD+LFN++RQS N+S T+SS PEPM+
Sbjct  315  KITVEQVHGLMSQVIKDVLFNSIRQSNNKSSTDSSDPEPMI  355



>ref|XP_006305189.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
 gb|EOA38087.1| hypothetical protein CARUB_v10009554mg [Capsella rubella]
Length=357

 Score =   375 bits (964),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 207/222 (93%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QLSHS+FG L APA  QR+KE+ESQLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLSHSKFGSL-APAGFQRRKEDESQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQSN+  ++ S PEPM+
Sbjct  314  SAKITVEQVHGLMSQVIKDILFNSSRQSNKPSSDPSDPEPMI  355



>ref|XP_002893252.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69511.1| hypothetical protein ARALYDRAFT_472541 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/222 (88%), Positives = 206/222 (93%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL+HSRFG  IAPA  QR+KE+E QLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLTHSRFGG-IAPAGHQRRKEDEPQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEPM+
Sbjct  314  SAKITVEQVHGLMSQVIKDILFNSARQSKKSPNDSSDPEPMI  355



>gb|KFK41544.1| hypothetical protein AALP_AA2G143000 [Arabis alpina]
Length=357

 Score =   375 bits (962),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 190/221 (86%), Positives = 205/221 (93%), Gaps = 1/221 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVATQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA-QRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAE+ LSHSRFG   + +  RKKE+ESQL KIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESHLSHSRFGGSASSSLHRKKEDESQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFN+V +SN+S T+SS P+PM+
Sbjct  315  SKITVEQVHGLMSQVIKDVLFNSVHESNKSPTDSSDPQPMI  355



>gb|EAZ32248.1| hypothetical protein OsJ_16452 [Oryza sativa Japonica Group]
Length=288

 Score =   372 bits (954),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 207/226 (92%), Gaps = 5/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  64   ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  123

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  124  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  183

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS
Sbjct  184  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDS  242

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSGPEPMVE 
Sbjct  243  SKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA  288



>ref|XP_006845674.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
 gb|ERN07349.1| hypothetical protein AMTR_s00019p00231450 [Amborella trichopoda]
Length=364

 Score =   372 bits (956),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/225 (85%), Positives = 201/225 (89%), Gaps = 3/225 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQ+ NQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  140  ENAVGWYHSHPGYGCWLSGIDVSTQLTNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP DEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  200  EGYKPRDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLL N DYVAGQISDLAEKLEQAEN LSHSR G  + P  RKKE++SQLAKIT DS+
Sbjct  260  SSSPLLANRDYVAGQISDLAEKLEQAENHLSHSRMGSFLVPPLRKKEDDSQLAKITRDSS  319

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRS---RTESSGPEPMVET  104
            KITVEQVHGLMSQVIKD LFN+V Q++R     T+ S PEPMVET
Sbjct  320  KITVEQVHGLMSQVIKDTLFNSVHQASRMLPILTDLSDPEPMVET  364



>gb|AAM65053.1| putative JUN kinase activator protein [Arabidopsis thaliana]
Length=357

 Score =   372 bits (955),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 206/222 (93%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IAPA  QR+KE+E QLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEPM+
Sbjct  314  SAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMI  355



>ref|NP_001054112.1| Os04g0654700 [Oryza sativa Japonica Group]
 gb|AAC33765.1| jab1 protein [Oryza sativa Indica Group]
 dbj|BAB72093.1| JUN-activation-domain-binding protein homolog [Oryza sativa]
 dbj|BAC22747.1| JUN-activation-domain-binding protein 1 [Oryza sativa Japonica 
Group]
 emb|CAE01552.2| OSJNBb0022F16.7 [Oryza sativa Japonica Group]
 dbj|BAF16026.1| Os04g0654700 [Oryza sativa Japonica Group]
 emb|CAH66701.1| OSIGBa0147J19.5 [Oryza sativa Indica Group]
Length=360

 Score =   372 bits (955),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 207/226 (92%), Gaps = 5/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS
Sbjct  256  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSGPEPMVE 
Sbjct  315  SKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA  360



>gb|EEC78160.1| hypothetical protein OsI_17724 [Oryza sativa Indica Group]
Length=385

 Score =   373 bits (957),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 207/226 (92%), Gaps = 5/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  161  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  220

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  221  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  280

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS
Sbjct  281  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDS  339

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSGPEPMVE 
Sbjct  340  SKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA  385



>ref|NP_173705.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 sp|Q8LAZ7.2|CSN5B_ARATH RecName: Full=COP9 signalosome complex subunit 5b; Short=Signalosome 
subunit 5b; AltName: Full=Jun activation domain-binding 
homolog 1 [Arabidopsis thaliana]
 gb|AAL58105.1|AF395062_1 CSN complex subunit 5B [Arabidopsis thaliana]
 gb|AAB72159.1| unknown [Arabidopsis thaliana]
 gb|AAB96974.1| JAB1 [Arabidopsis thaliana]
 gb|ABL66743.1| At1g22920 [Arabidopsis thaliana]
 gb|AEE30309.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=357

 Score =   372 bits (954),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 206/222 (93%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IAPA  QR+KE+E QLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEPM+
Sbjct  314  SAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMI  355



>ref|XP_004960128.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Setaria 
italica]
Length=361

 Score =   372 bits (954),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 191/226 (85%), Positives = 206/226 (91%), Gaps = 4/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQF EPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFTEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSRFG ++ P+QRKKE +ES LAK+T DS
Sbjct  256  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRFGGMLMPSQRKKEQDESPLAKVTRDS  315

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  S+++ T   +SSGPEPMVE 
Sbjct  316  SKITAEQVHGLMSQVIKDILFNSVHPSSKASTSAPDSSGPEPMVEA  361



>emb|CAE03401.3| OSJNBa0071I13.2 [Oryza sativa Japonica Group]
Length=377

 Score =   372 bits (955),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 207/226 (92%), Gaps = 5/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  153  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  212

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  213  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  272

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS
Sbjct  273  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDS  331

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSGPEPMVE 
Sbjct  332  SKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSGPEPMVEA  377



>ref|XP_009115580.1| PREDICTED: COP9 signalosome complex subunit 5b [Brassica rapa]
 emb|CDY21400.1| BnaA09g30270D [Brassica napus]
 emb|CDY04768.1| BnaC05g18210D [Brassica napus]
Length=356

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 203/220 (92%), Gaps = 0/220 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL+HSRFG + A   RKKE+E  LAKIT DSA
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLAHSRFGGIPASLHRKKEDEPPLAKITRDSA  314

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            KITVEQVHGLMSQVIKDILFN+ RQS+++ ++ S PEPM+
Sbjct  315  KITVEQVHGLMSQVIKDILFNSARQSDKTPSDPSDPEPMI  354



>ref|XP_010498782.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Camelina 
sativa]
Length=360

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 208/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  137  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  196

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  197  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  256

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT D
Sbjct  257  SSSPLLGNGDYVAGQISDLAEKLEQAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRD  316

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            SAKITVEQVHGLMSQVIKDILFN+ RQSN+  +E S PEPM+ +
Sbjct  317  SAKITVEQVHGLMSQVIKDILFNSARQSNKPPSEPSDPEPMITS  360



>ref|XP_010415831.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=358

 Score =   370 bits (950),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 204/222 (92%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAE+ L+HSRFG ++ +   RKKE+E+QL KIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESHLNHSRFGGIVPSSLHRKKEDETQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFN+VRQS N+S  + S  EPM+
Sbjct  315  SKITVEQVHGLMSQVIKDVLFNSVRQSNNKSPNDLSDTEPMI  356



>ref|XP_010460061.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X1 
[Camelina sativa]
 ref|XP_010460063.1| PREDICTED: COP9 signalosome complex subunit 5b-like isoform X2 
[Camelina sativa]
Length=358

 Score =   370 bits (950),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/222 (89%), Positives = 207/222 (93%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QLSHSRFG  IAPA  QR+KE+ESQLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLSHSRFGGGIAPAGHQRRKEDESQLAKITRD  314

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQSN+  +E S PEPM+
Sbjct  315  SAKITVEQVHGLMSQVIKDILFNSARQSNKPPSEPSEPEPMI  356



>ref|XP_006652935.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Oryza brachyantha]
Length=362

 Score =   370 bits (950),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/226 (85%), Positives = 207/226 (92%), Gaps = 5/226 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  138  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFMAVVIDPTRTVSAGKVEIGAFRTYP  197

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  198  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTL  257

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS
Sbjct  258  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDS  316

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSGPEPMVE 
Sbjct  317  SKITAEQVHGLMSQVIKDILFNSVHPSNKAGTSAPDSSGPEPMVEA  362



>gb|AFK33507.1| unknown [Medicago truncatula]
Length=210

 Score =   363 bits (933),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/204 (91%), Positives = 196/204 (96%), Gaps = 0/204 (0%)
 Frame = -2

Query  715  GIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPL  536
            GID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKP D+P+SEYQTIPL
Sbjct  7    GIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPADDPISEYQTIPL  66

Query  535  NKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISD  356
            NKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISD
Sbjct  67   NKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISD  126

Query  355  LAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDI  176
            LAEKLEQAENQL+HSRFGPL+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDI
Sbjct  127  LAEKLEQAENQLAHSRFGPLVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDI  186

Query  175  LFNTVRQSNRSRTESSGPEPMVET  104
            LFN+V Q+N+SRTE+S PEPM+E+
Sbjct  187  LFNSVHQANKSRTETSDPEPMIES  210



>ref|XP_010471135.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X1 [Camelina 
sativa]
 ref|XP_010471136.1| PREDICTED: COP9 signalosome complex subunit 5a isoform X2 [Camelina 
sativa]
Length=358

 Score =   368 bits (945),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 204/222 (92%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLG+GDYVAGQISDLAEKLEQAE+ L+HSRFG ++ +   +KKE+ESQL KIT DS
Sbjct  255  SSSPLLGSGDYVAGQISDLAEKLEQAESHLNHSRFGGIVPSSLHKKKEDESQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFNTVRQS N+S  + S  EPM+
Sbjct  315  SKITVEQVHGLMSQVIKDVLFNTVRQSNNKSPNDLSDTEPMI  356



>ref|NP_001149650.1| COP9 signalosome complex subunit 5b [Zea mays]
 gb|ACF85802.1| unknown [Zea mays]
 gb|ACG36237.1| COP9 signalosome complex subunit 5b [Zea mays]
 tpg|DAA35638.1| TPA: COP9 signalosome complex subunit 5b [Zea mays]
Length=362

 Score =   368 bits (945),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/227 (84%), Positives = 204/227 (90%), Gaps = 5/227 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQF EPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFTEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCK YY+LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKSYYALDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSS LLGN DYVAGQI DLA+KLEQAE QL+HSRFG +I P+QRKKE EES LAK+T DS
Sbjct  256  SSSSLLGNRDYVAGQIFDLADKLEQAEGQLAHSRFGGMIMPSQRKKEQEESPLAKVTRDS  315

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT----ESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  S+++ T    +SSGPEPMVE 
Sbjct  316  SKITAEQVHGLMSQVIKDILFNSVHPSSKASTSAPPDSSGPEPMVEA  362



>gb|AAC36344.1| AJH1 [Arabidopsis thaliana]
Length=357

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/222 (86%), Positives = 205/222 (92%), Gaps = 3/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLL NKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLGNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IAPA  QR+KE+E QLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            SAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEPM+
Sbjct  314  SAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEPMI  355



>gb|KFK44380.1| hypothetical protein AALP_AA1G249900 [Arabis alpina]
Length=353

 Score =   366 bits (940),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 189/220 (86%), Positives = 202/220 (92%), Gaps = 2/220 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  134  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  194  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAE QLSHSR  P  +  QR+KE+ESQL KIT DS+
Sbjct  254  SSSPLLGNGDYVAGQISDLAEKLEQAEGQLSHSRQMP--STLQRRKEDESQLTKITRDSS  311

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            KITVEQVHGLMSQVIKDILFN+ RQSN+  +++S PEPM+
Sbjct  312  KITVEQVHGLMSQVIKDILFNSSRQSNKPPSDASDPEPMI  351



>ref|XP_006302454.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
 gb|EOA35352.1| hypothetical protein CARUB_v10020540mg [Capsella rubella]
Length=358

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/222 (86%), Positives = 204/222 (92%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAE+ L+HSRFG ++ +   RKKE+ESQL KIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESHLNHSRFGGIVPSSLHRKKEDESQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFN++ QS N+S  +SS  EPM+
Sbjct  315  SKITVEQVHGLMSQVIKDVLFNSLPQSNNKSPHDSSDTEPMI  356



>ref|XP_010427950.1| PREDICTED: COP9 signalosome complex subunit 5a-like [Camelina 
sativa]
Length=357

 Score =   365 bits (938),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/222 (85%), Positives = 202/222 (91%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRT SAGKVEIGAFRTY 
Sbjct  134  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTASAGKVEIGAFRTYS  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  194  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLG+ DYVAGQISDLAEKLEQAE+ L+HSRFG ++ +   RKKE+ESQL KIT DS
Sbjct  254  SSSPLLGSADYVAGQISDLAEKLEQAESHLNHSRFGGIVPSSLHRKKEDESQLTKITRDS  313

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFN+VRQS N+S  E S  EPM+
Sbjct  314  SKITVEQVHGLMSQVIKDVLFNSVRQSNNKSPNELSDTEPMI  355



>gb|AAC36343.1| AJH2 [Arabidopsis thaliana]
Length=358

 Score =   364 bits (935),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 203/222 (91%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQTLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD+TYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  KGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAE+ L  SRFG ++ +   +KKE+ESQL KIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            AKITVEQVHGLMSQVIKD LFN++RQS N+S T+SS P+PM+
Sbjct  315  AKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMI  356



>ref|NP_177279.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
 sp|Q9FVU9.1|CSN5A_ARATH RecName: Full=COP9 signalosome complex subunit 5a; Short=Signalosome 
subunit 5a; AltName: Full=Jun activation domain-binding 
homolog 2 [Arabidopsis thaliana]
 gb|AAG51882.1|AC016162_3 c-Jun coactivator-like protein (AJH2); 90304-88609 [Arabidopsis 
thaliana]
 gb|AAL06468.1|AF411778_1 At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AAL58104.1|AF395061_1 CSN complex subunit 5A [Arabidopsis thaliana]
 gb|AAM70525.1| At1g71230/F3I17_12 [Arabidopsis thaliana]
 gb|AEE35176.1| COP9 signalosome complex subunit 5b [Arabidopsis thaliana]
Length=358

 Score =   364 bits (935),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 189/222 (85%), Positives = 203/222 (91%), Gaps = 2/222 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD+TYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  KGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAE+ L  SRFG ++ +   +KKE+ESQL KIT DS
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEPMV  110
            AKITVEQVHGLMSQVIKD LFN++RQS N+S T+SS P+PM+
Sbjct  315  AKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMI  356



>ref|XP_001775449.1| predicted protein [Physcomitrella patens]
 gb|EDQ59778.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/233 (81%), Positives = 203/233 (87%), Gaps = 12/233 (5%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQ +QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEP SEYQTIPLNKIEDFGVH KQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  199  QGYKPPDEPPSEYQTIPLNKIEDFGVHYKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDS  233
            SSSPLLGN DYVAGQ++DLAEKLEQAE+QL+HS R G    P Q+KKEEESQLAKI+ DS
Sbjct  259  SSSPLLGNRDYVAGQVADLAEKLEQAESQLAHSGRMGGFFMPVQKKKEEESQLAKISRDS  318

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRS-----------RTESSGPEPMVE  107
            +KITVEQ+HGLMSQVIKD LFN+V  S+ +            T+SSGPEPMVE
Sbjct  319  SKITVEQLHGLMSQVIKDTLFNSVMSSSNAPVAMSAETSIVATDSSGPEPMVE  371



>ref|XP_006416142.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
 dbj|BAJ34114.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34495.1| hypothetical protein EUTSA_v10008042mg [Eutrema salsugineum]
Length=355

 Score =   363 bits (931),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 204/220 (93%), Gaps = 0/220 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  134  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  194  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL+HSRFG + A  QRKKE+ES LAKIT DSA
Sbjct  254  SSSPLLGNGDYVAGQISDLAEKLEQAESQLAHSRFGGIPATLQRKKEDESPLAKITRDSA  313

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            KITVEQVHGLMSQVIKDILFN+ R+SN+  +E S PEPM+
Sbjct  314  KITVEQVHGLMSQVIKDILFNSPRESNKPPSEPSDPEPMI  353



>ref|XP_010240543.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brachypodium 
distachyon]
Length=360

 Score =   359 bits (922),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 202/225 (90%), Gaps = 3/225 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQ +QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVIGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPD+P+SEYQTIPLNKIEDFGVHCKQYY LDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDDPISEYQTIPLNKIEDFGVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSRFG L++  ++K+ E+S LAK+T DS+
Sbjct  256  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRFGMLMSSQRKKEPEDSPLAKVTRDSS  315

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSGPEPMVET  104
            KIT EQVHGLMSQVIKDILFN+V  S+++ T   ES  PEPMVET
Sbjct  316  KITAEQVHGLMSQVIKDILFNSVHPSSKASTSAPESPVPEPMVET  360



>ref|XP_006450163.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
 gb|ESR63403.1| hypothetical protein CICLE_v10008736mg [Citrus clementina]
Length=337

 Score =   358 bits (919),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 177/223 (79%), Positives = 186/223 (83%), Gaps = 25/223 (11%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENAVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP+SEYQTIPLNKIEDFGVHCKQ                        YWVNTL
Sbjct  199  EGYKPPDEPISEYQTIPLNKIEDFGVHCKQ------------------------YWVNTL  234

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR+GPLIAP  R+KE E+SQLAKIT DS
Sbjct  235  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRYGPLIAPPPRRKEQEDSQLAKITRDS  294

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            AKITVEQVHGLMSQVIKDILFN+VRQS ++    S PEPM+E+
Sbjct  295  AKITVEQVHGLMSQVIKDILFNSVRQSTKTHAGPSDPEPMIES  337



>dbj|BAJ93853.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99562.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=364

 Score =   357 bits (917),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 203/230 (88%), Gaps = 9/230 (4%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSRFG ++ P+QRKKE EES LAK+T DS
Sbjct  256  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVR-------QSNRSRTESSGPEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V         ++ +  +S  PEPMVE 
Sbjct  315  SKITAEQVHGLMSQVIKDILFNSVHPSSKSKASASGAAPDSPVPEPMVEA  364



>ref|XP_001752249.1| predicted protein [Physcomitrella patens]
 gb|EDQ82982.1| predicted protein [Physcomitrella patens]
Length=372

 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/233 (80%), Positives = 201/233 (86%), Gaps = 12/233 (5%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQ +QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  139  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  198

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEP SEYQTIPLNKIEDFGVH KQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  199  QGYKPPDEPPSEYQTIPLNKIEDFGVHYKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  258

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDS  233
            SSSPLL N DYVAGQ++DLAEKLEQAE+QL+HS R G    P Q+KKEEESQLAKI+ DS
Sbjct  259  SSSPLLANRDYVAGQVADLAEKLEQAESQLAHSGRMGGFFMPVQKKKEEESQLAKISRDS  318

Query  232  AKITVEQVHGLMSQVIKDILFNTV-----------RQSNRSRTESSGPEPMVE  107
            +KITVEQ+HGLMSQVIK+ LFN V            ++  S T+SSGPEPMVE
Sbjct  319  SKITVEQLHGLMSQVIKNTLFNVVTSSASASAAASAETPTSATDSSGPEPMVE  371



>gb|EMS48301.1| COP9 signalosome complex subunit 5b [Triticum urartu]
Length=335

 Score =   355 bits (912),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 206/230 (90%), Gaps = 9/230 (4%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEP+LAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  107  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPWLAVVIDPTRTVSAGKVDIGAFRTYP  166

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  167  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  226

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DYVAGQI DLA+KLEQAE QL+HSRFG ++ P+QRKKE EES LAK+T DS
Sbjct  227  SSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDS  285

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSG-------PEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  S++S+  +SG       PEPMVE 
Sbjct  286  SKITAEQVHGLMSQVIKDILFNSVHPSSKSKASASGTAPDSPVPEPMVEA  335



>gb|KJB65951.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=335

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 190/206 (92%), Gaps = 3/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYY+L+ITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPTDDPISEYQTIPLNKIEDFGVHCKQYYALNITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQ+SDLAEKLEQAEN L+HSR GPL      +K+EES L KIT DS+
Sbjct  252  SSSPLLGNGDYVAGQLSDLAEKLEQAENHLTHSRIGPL---GTSRKKEESHLGKITRDSS  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            KITVEQ HGLMSQVIKDILFN+VRQS
Sbjct  309  KITVEQAHGLMSQVIKDILFNSVRQS  334



>gb|EMT09486.1| hypothetical protein F775_29820 [Aegilops tauschii]
Length=364

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 206/230 (90%), Gaps = 9/230 (4%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEP+LAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPWLAVVIDPTRTVSAGKVDIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            + YKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  196  KDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN DY+AGQI DLA+KLEQAE QL+HSRFG ++ P+QRKKE EES LAK+T DS
Sbjct  256  SSSPLLGNRDYIAGQIFDLADKLEQAEGQLAHSRFG-MLMPSQRKKEQEESPLAKVTRDS  314

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSG-------PEPMVET  104
            +KIT EQVHGLMSQVIKDILFN+V  S++S+  +SG       PEPMVE 
Sbjct  315  SKITAEQVHGLMSQVIKDILFNSVHPSSKSKASASGTAPDSPVPEPMVEA  364



>ref|XP_002961002.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
 gb|EFJ38541.1| hypothetical protein SELMODRAFT_73440 [Selaginella moellendorffii]
Length=361

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 201/229 (88%), Gaps = 8/229 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQ+LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVTTQVLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEP SEYQTIPLNKIEDFGVHCKQYY LDITYFKSSLDSHLLDLLWNKYW+NTL
Sbjct  192  QGYKPPDEPASEYQTIPLNKIEDFGVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWLNTL  251

Query  409  SSSPLLGNGDYVAGQISDL------AEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLA  251
            SSSPLLG+ DYVAGQISDL      AEKLEQ E QL+HS R G    P+Q+KKEEESQLA
Sbjct  252  SSSPLLGSRDYVAGQISDLGNSTHAAEKLEQTETQLAHSGRMGGFFMPSQKKKEEESQLA  311

Query  250  KITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRT-ESSGPEPMVE  107
            KIT DS+KITVEQVHGLMSQVIKDILFN+V     + + +SSGPEPM E
Sbjct  312  KITKDSSKITVEQVHGLMSQVIKDILFNSVTPVATAPSFDSSGPEPMAE  360



>ref|XP_002967006.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
 gb|EFJ31605.1| hypothetical protein SELMODRAFT_168868 [Selaginella moellendorffii]
Length=373

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 200/229 (87%), Gaps = 8/229 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQ+LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  144  ENVVGWYHSHPGYGCWLSGIDVTTQVLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  203

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEP SEYQTIPLNKIEDFGVHCKQYY LDITYFKSSLDSHLLDLLWNKYW+NTL
Sbjct  204  QGYKPPDEPASEYQTIPLNKIEDFGVHCKQYYPLDITYFKSSLDSHLLDLLWNKYWLNTL  263

Query  409  SSSPLLGNGDYVAGQISDL------AEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLA  251
            SSSPLLG+ DYVAGQISDL      AEKLEQ E QL+HS R G    P+Q+KKEEESQLA
Sbjct  264  SSSPLLGSRDYVAGQISDLGNSTHAAEKLEQTETQLAHSGRMGGFFMPSQKKKEEESQLA  323

Query  250  KITCDSAKITVEQVHGLMSQVIKDILFNTVRQ-SNRSRTESSGPEPMVE  107
            KIT DS+KITVEQVHGLMSQVIKDILFN+V   +     +SSGPEPM E
Sbjct  324  KITKDSSKITVEQVHGLMSQVIKDILFNSVTPVATAPSFDSSGPEPMAE  372



>gb|KJB55194.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=333

 Score =   352 bits (903),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/204 (89%), Positives = 189/204 (93%), Gaps = 3/204 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P ++K +EESQLAKIT DSA
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPL-GPPRKKLQEESQLAKITRDSA  310

Query  229  KITVEQVHGLMSQVIKDILFNTVR  158
            KITVEQVHGLMSQV   +LF   R
Sbjct  311  KITVEQVHGLMSQVT--LLFQIFR  332



>gb|KHG22386.1| COP9 signalosome complex subunit 5a -like protein [Gossypium 
arboreum]
Length=335

 Score =   351 bits (900),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 189/206 (92%), Gaps = 3/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVS+GKV IGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSSGKVYIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYY+L+I+YFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPTDDPISEYQTIPLNKIEDFGVHCKQYYALNISYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQ+SDLAEKLEQAEN L+HSR GPL      +K+EES L KIT DS+
Sbjct  252  SSSPLLGNGDYVAGQLSDLAEKLEQAENHLTHSRIGPL---GTSRKKEESHLGKITRDSS  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            KITVEQ HGLMSQVIKDILFN+VRQS
Sbjct  309  KITVEQAHGLMSQVIKDILFNSVRQS  334



>ref|XP_006390791.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
 gb|ESQ28077.1| hypothetical protein EUTSA_v10018788mg [Eutrema salsugineum]
Length=352

 Score =   348 bits (894),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 187/221 (85%), Positives = 202/221 (91%), Gaps = 1/221 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQ LNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTY 
Sbjct  130  ENVVGWYHSHPGYGCWLSGIDVSTQRLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYS  189

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEP SEYQTIPLNKIEDFGVHCKQYYSLD+TYFKSSLDSHLLDLLW+KYWVNTL
Sbjct  190  EGYKPPDEPASEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWSKYWVNTL  249

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI-APAQRKKEEESQLAKITCDS  233
            SSSPLLGNGDYVAGQI DLAEKLEQAE+ L+HSRFG  + +   RKKE+ESQL KIT DS
Sbjct  250  SSSPLLGNGDYVAGQILDLAEKLEQAESHLAHSRFGGSVPSSLHRKKEDESQLTKITRDS  309

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMV  110
            +KITVEQVHGLMSQVIKD+LFN+V QS++S ++SS  EPMV
Sbjct  310  SKITVEQVHGLMSQVIKDVLFNSVSQSSKSPSDSSDLEPMV  350



>emb|CDY25761.1| BnaA07g10210D [Brassica napus]
Length=356

 Score =   347 bits (889),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 200/222 (90%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKL+QAE+QL  S FG   A   +KK++E  LAKIT DSA
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLDQAESQLVQSWFGGKKASLHKKKKDELPLAKITRDSA  314

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KIT+EQVHGLMSQVIKDILFN+ RQS+++ ++ + PEPM+ +
Sbjct  315  KITIEQVHGLMSQVIKDILFNSPRQSDKTPSDPTDPEPMITS  356



>ref|XP_009103210.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Brassica 
rapa]
Length=356

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 199/222 (90%), Gaps = 0/222 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKL+QAE+QL  S FG   A   +KK++E  LAKIT DSA
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLDQAESQLVQSWFGGKKASLHKKKKDELPLAKITRDSA  314

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
            KIT+EQVHGLMSQVIKDILF + RQS+++ ++ + PEPM+ +
Sbjct  315  KITIEQVHGLMSQVIKDILFISARQSDKTPSDPTDPEPMITS  356



>ref|XP_010929275.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Elaeis guineensis]
Length=339

 Score =   343 bits (880),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 183/197 (93%), Gaps = 1/197 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  195  QGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDS  233
            SSSPLLGN +YVAGQISDLAEKLE AENQL+H+R G  + P+QRKKE EESQLAK T DS
Sbjct  255  SSSPLLGNREYVAGQISDLAEKLEHAENQLAHTRLGSFLLPSQRKKEHEESQLAKTTRDS  314

Query  232  AKITVEQVHGLMSQVIK  182
            +KITVEQVHGLMSQ  +
Sbjct  315  SKITVEQVHGLMSQCTR  331



>gb|KJB55196.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=324

 Score =   337 bits (863),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 176/222 (79%), Positives = 185/222 (83%), Gaps = 29/222 (13%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P  RKK              
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPLGPP--RKK--------------  295

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
                         VIKDILFN+VRQS+RS+ + SGPEPM+ET
Sbjct  296  -------------VIKDILFNSVRQSSRSQNDQSGPEPMIET  324



>ref|NP_973890.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
 gb|AEE30310.1| COP9 signalosome complex subunit 5a [Arabidopsis thaliana]
Length=351

 Score =   335 bits (859),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 186/198 (94%), Gaps = 3/198 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  135  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL
Sbjct  195  EGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCD  236
            SSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IAPA  QR+KE+E QLAKIT D
Sbjct  255  SSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRD  313

Query  235  SAKITVEQVHGLMSQVIK  182
            SAKITVEQVHGLMSQV K
Sbjct  314  SAKITVEQVHGLMSQVSK  331



>ref|XP_008804896.1| PREDICTED: COP9 signalosome complex subunit 5b-like [Phoenix 
dactylifera]
Length=200

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 182/199 (91%), Gaps = 3/199 (2%)
 Frame = -2

Query  694  MLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFG  515
            MLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP+GYKP DEPVSEYQTIPLNKIEDFG
Sbjct  1    MLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPQGYKPLDEPVSEYQTIPLNKIEDFG  60

Query  514  VHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQ  335
            VHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTLSSSPLLGN DYVAGQISDLAEKLE 
Sbjct  61   VHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQISDLAEKLEH  120

Query  334  AENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQ  155
            AENQL+H+R G  + P+QRK+ EESQLAK T DS+KITVEQVHGLMSQVIKDILFNTVR 
Sbjct  121  AENQLAHTRLGSFLLPSQRKENEESQLAKTTRDSSKITVEQVHGLMSQVIKDILFNTVRH  180

Query  154  ---SNRSRTESSGPEPMVE  107
               ++ S ++SSGPEPMVE
Sbjct  181  SSSTSPSLSDSSGPEPMVE  199



>ref|XP_011082083.1| PREDICTED: COP9 signalosome complex subunit 5a-like isoform X2 
[Sesamum indicum]
Length=318

 Score =   313 bits (802),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQ+QEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  136  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  196  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITC  239
            SSSPLLGNGDYVAGQISDLAEK+EQAENQL+HSRFG LI    RKKE  S     TC
Sbjct  256  SSSPLLGNGDYVAGQISDLAEKIEQAENQLAHSRFGSLIGGPLRKKEAVSPFKNFTC  312



>ref|XP_004353437.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
 gb|ELR23909.1| signalosome complex protein [Acanthamoeba castellanii str. Neff]
Length=342

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 180/212 (85%), Gaps = 7/212 (3%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQMLNQQ+QEP+LAVVIDPTRT+SAGKVE+GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVGTQMLNQQYQEPWLAVVIDPTRTISAGKVELGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            E YK PDE  SEYQTIP++KIEDFGVHCKQYY L+++YFKSSLDS LLDLLWNKYWVNTL
Sbjct  189  EDYKAPDEAPSEYQTIPISKIEDFGVHCKQYYPLEVSYFKSSLDSQLLDLLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHS-RFGPLIAPAQRKKEEESQLAKITCDS  233
            SSSPLL N DY AG I DL+EKLEQAE QLSHS R G  +AP   KK+EESQLAK+T DS
Sbjct  249  SSSPLLANRDYFAGAIHDLSEKLEQAETQLSHSGRMGGYLAP--EKKKEESQLAKLTKDS  306

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRT  137
             K T+EQVHGLM+QV+KDILFN     N+S T
Sbjct  307  TKTTIEQVHGLMAQVMKDILFNI----NKSET  334



>gb|KJB55193.1| hypothetical protein B456_009G068200 [Gossypium raimondii]
Length=318

 Score =   303 bits (776),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 154/166 (93%), Positives = 158/166 (95%), Gaps = 2/166 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKK  272
            SSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSR GPL  P  RKK
Sbjct  252  SSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRIGPLGPP--RKK  295



>ref|XP_007248979.1| PREDICTED: COP9 signalosome complex subunit 5 [Astyanax mexicanus]
Length=336

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQAE QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQAEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN V  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQVNTS  334



>ref|XP_009491803.1| PREDICTED: COP9 signalosome complex subunit 5 [Pelecanus crispus]
Length=270

 Score =   299 bits (765),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>ref|XP_009866049.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Apaloderma 
vittatum]
 ref|XP_009916306.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Haliaeetus 
albicilla]
 ref|XP_010071814.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Pterocles 
gutturalis]
 gb|KFP47606.1| COP9 signalosome complex subunit 5, partial [Cathartes aura]
 gb|KFP87179.1| COP9 signalosome complex subunit 5, partial [Apaloderma vittatum]
 gb|KFP94092.1| COP9 signalosome complex subunit 5, partial [Haliaeetus albicilla]
 gb|KFV06934.1| COP9 signalosome complex subunit 5, partial [Pterocles gutturalis]
Length=208

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  5    ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  64

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  65   KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  124

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  125  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  182

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  183  KTTIEAIHGLMSQVIKDKLFNQI  205



>ref|NP_957019.1| COP9 signalosome complex subunit 5 [Danio rerio]
 sp|Q6PC30.1|CSN5_DANRE RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Danio rerio]
 gb|AAH59493.1| COP9 constitutive photomorphogenic homolog subunit 5 [Danio rerio]
Length=334

 Score =   301 bits (770),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQAE QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNADYTTGQVFDLSEKLEQAEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN V  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQVNTS  332



>gb|KFQ58471.1| COP9 signalosome complex subunit 5, partial [Pelecanus crispus]
Length=286

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  83   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  142

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  143  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  202

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  203  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  260

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  261  KTTIEAIHGLMSQVIKDKLFNQI  283



>ref|XP_009569185.1| PREDICTED: COP9 signalosome complex subunit 5 [Cuculus canorus]
Length=270

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQINTA  270



>ref|XP_005019397.1| PREDICTED: COP9 signalosome complex subunit 5 [Anas platyrhynchos]
 ref|XP_005240980.1| PREDICTED: COP9 signalosome complex subunit 5 [Falco peregrinus]
 ref|XP_005443255.1| PREDICTED: COP9 signalosome complex subunit 5 [Falco cherrug]
 ref|XP_005423092.1| PREDICTED: COP9 signalosome complex subunit 5 [Geospiza fortis]
 ref|XP_005506521.1| PREDICTED: COP9 signalosome complex subunit 5 [Columba livia]
 ref|XP_008499986.1| PREDICTED: COP9 signalosome complex subunit 5 [Calypte anna]
 ref|XP_008630179.1| PREDICTED: COP9 signalosome complex subunit 5 [Corvus brachyrhynchos]
 ref|XP_008930421.1| PREDICTED: COP9 signalosome complex subunit 5 [Manacus vitellinus]
 ref|XP_008936970.1| PREDICTED: COP9 signalosome complex subunit 5 [Merops nubicus]
 ref|XP_009469926.1| PREDICTED: COP9 signalosome complex subunit 5 [Nipponia nippon]
 ref|XP_009666687.1| PREDICTED: COP9 signalosome complex subunit 5 [Struthio camelus 
australis]
 ref|XP_009632806.1| PREDICTED: COP9 signalosome complex subunit 5 [Egretta garzetta]
 ref|XP_009694490.1| PREDICTED: COP9 signalosome complex subunit 5 [Cariama cristata]
 ref|XP_009902390.1| PREDICTED: COP9 signalosome complex subunit 5 [Picoides pubescens]
 ref|XP_009938798.1| PREDICTED: COP9 signalosome complex subunit 5 [Opisthocomus hoazin]
 ref|XP_010020192.1| PREDICTED: COP9 signalosome complex subunit 5 [Nestor notabilis]
 ref|XP_009978044.1| PREDICTED: COP9 signalosome complex subunit 5 [Tauraco erythrolophus]
 ref|XP_009993861.1| PREDICTED: COP9 signalosome complex subunit 5 [Chaetura pelagica]
 ref|XP_010166906.1| PREDICTED: COP9 signalosome complex subunit 5 [Caprimulgus carolinensis]
 ref|XP_010183940.1| PREDICTED: COP9 signalosome complex subunit 5 [Mesitornis unicolor]
 ref|XP_010208428.1| PREDICTED: COP9 signalosome complex subunit 5 [Colius striatus]
 ref|XP_010213773.1| PREDICTED: COP9 signalosome complex subunit 5 [Tinamus guttatus]
 ref|XP_010301016.1| PREDICTED: COP9 signalosome complex subunit 5 [Balearica regulorum 
gibbericeps]
 ref|XP_010403428.1| PREDICTED: COP9 signalosome complex subunit 5 [Corvus cornix 
cornix]
 ref|XP_003205144.2| PREDICTED: COP9 signalosome complex subunit 5 [Meleagris gallopavo]
Length=270

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFW95881.1| COP9 signalosome complex subunit 5, partial [Phalacrocorax carbo]
Length=260

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  57   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  116

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  117  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  176

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  177  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  234

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  235  KTTIEAIHGLMSQVIKDKLFNQI  257



>ref|XP_007885057.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Callorhinchus 
milii]
Length=272

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>ref|XP_009512046.1| PREDICTED: COP9 signalosome complex subunit 5 [Phalacrocorax 
carbo]
Length=257

 Score =   297 bits (761),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  54   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  113

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  114  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  173

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  174  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  231

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  232  KTTIEAIHGLMSQVIKDKLFNQI  254



>ref|XP_009883867.1| PREDICTED: COP9 signalosome complex subunit 5 [Charadrius vociferus]
Length=270

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--ILGLETHDKKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFV70073.1| COP9 signalosome complex subunit 5, partial [Picoides pubescens]
Length=283

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  80   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  139

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  140  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  199

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  200  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  257

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  258  KTTIEAIHGLMSQVIKDKLFNQI  280



>ref|XP_004697588.1| PREDICTED: COP9 signalosome complex subunit 5 [Echinops telfairi]
 ref|XP_004814146.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Mustela 
putorius furo]
 ref|XP_005008312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Cavia 
porcellus]
 ref|XP_005008313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Cavia 
porcellus]
 ref|XP_005392182.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Chinchilla 
lanigera]
 ref|XP_005563539.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Macaca 
fascicularis]
 ref|XP_005563540.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Macaca 
fascicularis]
 ref|XP_005613142.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Equus 
caballus]
 ref|XP_005977668.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pantholops 
hodgsonii]
 ref|XP_008253842.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_008524910.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Equus 
przewalskii]
 ref|XP_008565070.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X4 [Galeopterus 
variegatus]
 ref|XP_008704974.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Ursus 
maritimus]
 ref|XP_008980989.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Callithrix 
jacchus]
 ref|XP_009211404.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009211405.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009211406.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Papio 
anubis]
 ref|XP_009453745.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pan 
troglodytes]
 ref|XP_009453746.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Pan 
troglodytes]
 ref|XP_010329035.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Saimiri 
boliviensis boliviensis]
 ref|XP_010810335.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Bos 
taurus]
 ref|XP_010987377.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Camelus 
dromedarius]
 ref|XP_011219514.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Ailuropoda 
melanoleuca]
 ref|XP_011289667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Felis 
catus]
 ref|XP_011362918.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pteropus 
vampyrus]
Length=270

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQINIS  270



>gb|KFR15387.1| COP9 signalosome complex subunit 5, partial [Opisthocomus hoazin]
Length=288

 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  85   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  144

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  145  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  204

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  205  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  262

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  263  KTTIEAIHGLMSQVIKDKLFNQI  285



>gb|KFO04966.1| COP9 signalosome complex subunit 5, partial [Balearica regulorum 
gibbericeps]
 gb|KFO53023.1| COP9 signalosome complex subunit 5, partial [Corvus brachyrhynchos]
 gb|KFP06973.1| COP9 signalosome complex subunit 5, partial [Calypte anna]
 gb|KFP28656.1| COP9 signalosome complex subunit 5, partial [Colius striatus]
 gb|KFP60727.1| COP9 signalosome complex subunit 5, partial [Cariama cristata]
 gb|KFQ18281.1| COP9 signalosome complex subunit 5, partial [Merops nubicus]
 gb|KFQ74801.1| COP9 signalosome complex subunit 5, partial [Phoenicopterus ruber 
ruber]
 gb|KGL77824.1| COP9 signalosome complex subunit 5, partial [Tinamus guttatus]
Length=286

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  83   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  142

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  143  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  202

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  203  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  260

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  261  KTTIEAIHGLMSQVIKDKLFNQI  283



>ref|XP_006006855.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Latimeria 
chalumnae]
Length=334

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNADYTTGQIFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E +HGLMSQVIKD LFN +  S+
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTSS  333



>ref|XP_008852995.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Nannospalax 
galili]
Length=270

 Score =   297 bits (761),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFR04453.1| COP9 signalosome complex subunit 5, partial [Nipponia nippon]
Length=291

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  88   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  147

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  148  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  207

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  208  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  265

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  266  KTTIEAIHGLMSQVIKDKLFNQI  288



>ref|XP_005392181.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Chinchilla 
lanigera]
Length=293

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  90   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  149

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  150  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  209

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  210  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  267

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  268  KTTIEAIHGLMSQVIKDKLFNQINIS  293



>gb|EOB01530.1| COP9 signalosome complex subunit 5, partial [Anas platyrhynchos]
Length=291

 Score =   298 bits (763),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  88   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  147

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  148  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  207

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  208  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  265

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  266  KTTIEAIHGLMSQVIKDKLFNQI  288



>ref|XP_008565069.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X3 [Galeopterus 
variegatus]
Length=307

 Score =   298 bits (764),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  104  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  163

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  164  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  223

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  224  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  281

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  282  KTTIEAIHGLMSQVIKDKLFNQINIS  307



>ref|XP_009453744.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pan 
troglodytes]
Length=288

 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  85   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  144

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  145  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  204

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  205  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  262

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  263  KTTIEAIHGLMSQVIKDKLFNQINIS  288



>gb|KFZ45477.1| COP9 signalosome complex subunit 5, partial [Caprimulgus carolinensis]
Length=292

 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  89   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  148

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  149  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  208

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  209  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  266

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  267  KTTIEAIHGLMSQVIKDKLFNQI  289



>ref|NP_989109.1| COP9 signalosome complex subunit 5 [Xenopus (Silurana) tropicalis]
 sp|Q6P635.1|CSN5_XENTR RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus (Silurana) tropicalis]
 gb|AAH62499.1| COP9 signalosome subunit 5 [Xenopus (Silurana) tropicalis]
 emb|CAJ82897.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Xenopus (Silurana) tropicalis]
Length=334

 Score =   299 bits (766),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F   +    RK E+  +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSED--KLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_006860136.1| PREDICTED: COP9 signalosome complex subunit 5 [Chrysochloris 
asiatica]
Length=307

 Score =   298 bits (764),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  104  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  163

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  164  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  223

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  224  SSSSLLTNADYTTGQIFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  281

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  282  KTTIEAIHGLMSQVIKDKLFNQINIS  307



>ref|XP_005042220.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Ficedula 
albicollis]
Length=291

 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  88   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  147

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  148  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  207

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  208  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  265

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  266  KTTIEAIHGLMSQVIKDKLFNQI  288



>gb|KFP12389.1| COP9 signalosome complex subunit 5, partial [Egretta garzetta]
 gb|KFQ23265.1| COP9 signalosome complex subunit 5, partial [Mesitornis unicolor]
 gb|KFQ43634.1| COP9 signalosome complex subunit 5, partial [Nestor notabilis]
 gb|KFV11049.1| COP9 signalosome complex subunit 5, partial [Tauraco erythrolophus]
Length=292

 Score =   298 bits (762),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  89   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  148

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  149  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  208

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  209  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  266

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  267  KTTIEAIHGLMSQVIKDKLFNQI  289



>ref|XP_010134433.1| PREDICTED: COP9 signalosome complex subunit 5 [Buceros rhinoceros 
silvestris]
Length=269

 Score =   297 bits (760),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            +N  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  66   QNAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  125

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  126  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  185

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  186  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  243

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  244  KTTIEAIHGLMSQVIKDKLFNQI  266



>gb|KGL93740.1| COP9 signalosome complex subunit 5, partial [Charadrius vociferus]
Length=286

 Score =   297 bits (761),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  83   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  142

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  143  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  202

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  203  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--ILGLETHDKKSEDKLAKATRDSC  260

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  261  KTTIEAIHGLMSQVIKDKLFNQI  283



>gb|KFV78011.1| COP9 signalosome complex subunit 5, partial [Struthio camelus 
australis]
Length=294

 Score =   298 bits (762),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  91   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  150

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  151  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  210

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  211  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  268

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  269  KTTIEAIHGLMSQVIKDKLFNQI  291



>ref|XP_009957073.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Leptosomus 
discolor]
Length=305

 Score =   298 bits (763),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  102  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  161

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  162  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  221

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  222  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  279

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  280  KTTIEAIHGLMSQVIKDKLFNQI  302



>gb|AAD03468.1| 38 kDa Mov34 homolog [Homo sapiens]
Length=334

 Score =   299 bits (765),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|XP_009333319.1| PREDICTED: COP9 signalosome complex subunit 5 [Pygoscelis adeliae]
Length=270

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  187  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQI  267



>gb|KFZ51066.1| COP9 signalosome complex subunit 5, partial [Podiceps cristatus]
Length=294

 Score =   297 bits (761),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  91   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  150

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  151  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  210

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  211  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  268

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  269  KTTIEAIHGLMSQVIKDKLFNQI  291



>gb|KFO71148.1| COP9 signalosome complex subunit 5, partial [Cuculus canorus]
Length=291

 Score =   297 bits (761),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  88   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  147

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  148  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  207

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  208  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  265

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  +
Sbjct  266  KTTIEAIHGLMSQVIKDKLFNQINTA  291



>ref|XP_006090662.1| PREDICTED: COP9 signalosome complex subunit 5 [Myotis lucifugus]
Length=336

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  133  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  192

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  193  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  252

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  253  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  310

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  311  KTTIEAIHGLMSQVIKDKLFNQINVS  336



>ref|XP_009575600.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Fulmarus 
glacialis]
Length=261

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  58   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  117

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  118  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  177

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  178  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  235

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  236  KTTIEAIHGLMSQVIKDKLFNQI  258



>gb|KFW04486.1| COP9 signalosome complex subunit 5, partial [Fulmarus glacialis]
Length=262

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  59   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  118

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  119  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  178

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  179  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  236

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  237  KTTIEAIHGLMSQVIKDKLFNQI  259



>gb|KFU88065.1| COP9 signalosome complex subunit 5, partial [Chaetura pelagica]
Length=292

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  89   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  148

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  149  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  208

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  209  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  266

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  267  KTTIEAIHGLMSQVIKDKLFNQI  289



>gb|AAX37104.1| COP9 constitutive photomorphogenic-like subunit 5 [synthetic 
construct]
Length=335

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E +HGLMSQVIKD LFN +  S+
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINISD  335



>gb|KFW88042.1| COP9 signalosome complex subunit 5, partial [Manacus vitellinus]
Length=310

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  107  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  166

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  167  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  226

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  227  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  284

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  285  KTTIEAIHGLMSQVIKDKLFNQI  307



>ref|XP_535093.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Canis 
lupus familiaris]
 ref|XP_004653361.1| PREDICTED: COP9 signalosome complex subunit 5 [Jaculus jaculus]
 ref|XP_005638087.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Canis 
lupus familiaris]
 ref|XP_007947907.1| PREDICTED: COP9 signalosome complex subunit 5 [Orycteropus afer 
afer]
Length=334

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINVS  334



>ref|XP_005517166.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005517167.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pseudopodoces 
humilis]
Length=339

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  196  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  256  SSSSLLTNADYTTGQIFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  313

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  314  KTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_009957065.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Leptosomus 
discolor]
Length=327

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  124  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  183

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  184  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  243

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  244  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  301

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  302  KTTIEAIHGLMSQVIKDKLFNQI  324



>ref|XP_009083868.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Serinus 
canaria]
Length=317

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  114  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  173

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  174  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  233

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  234  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  291

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  292  KTTIEAIHGLMSQVIKDKLFNQI  314



>ref|XP_005150844.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Melopsittacus 
undulatus]
Length=317

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  114  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  173

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  174  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  233

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  234  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  291

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  292  KTTIEAIHGLMSQVIKDKLFNQI  314



>ref|XP_010574205.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Haliaeetus 
leucocephalus]
Length=318

 Score =   298 bits (762),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  115  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  174

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  175  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  234

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  235  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  292

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  293  KTTIEAIHGLMSQVIKDKLFNQI  315



>gb|ELR58372.1| COP9 signalosome complex subunit 5, partial [Bos mutus]
Length=337

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQINIS  337



>ref|XP_001512862.1| PREDICTED: COP9 signalosome complex subunit 5 [Ornithorhynchus 
anatinus]
Length=334

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|XP_005866406.1| PREDICTED: COP9 signalosome complex subunit 5 [Myotis brandtii]
 gb|EPQ07861.1| COP9 signalosome complex subunit 5 [Myotis brandtii]
Length=334

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINVS  334



>ref|XP_004679877.1| PREDICTED: COP9 signalosome complex subunit 5 [Condylura cristata]
Length=334

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|NP_006828.2| COP9 signalosome complex subunit 5 [Homo sapiens]
 ref|NP_001247609.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 ref|XP_001162723.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pan 
troglodytes]
 ref|XP_002710500.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_002759014.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callithrix 
jacchus]
 ref|XP_002916425.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_003274847.1| PREDICTED: COP9 signalosome complex subunit 5 [Nomascus leucogenys]
 ref|XP_003480111.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cavia 
porcellus]
 ref|XP_002819198.2| PREDICTED: COP9 signalosome complex subunit 5 [Pongo abelii]
 ref|XP_003797297.1| PREDICTED: COP9 signalosome complex subunit 5 [Otolemur garnettii]
 ref|XP_003942946.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Saimiri 
boliviensis boliviensis]
 ref|XP_003999915.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Felis 
catus]
 ref|XP_004275000.1| PREDICTED: COP9 signalosome complex subunit 5 [Orcinus orca]
 ref|XP_004310611.1| PREDICTED: COP9 signalosome complex subunit 5 [Tursiops truncatus]
 ref|XP_004372600.1| PREDICTED: COP9 signalosome complex subunit 5 [Trichechus manatus 
latirostris]
 ref|XP_004402339.1| PREDICTED: COP9 signalosome complex subunit 5 [Odobenus rosmarus 
divergens]
 ref|XP_004436312.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004436313.1| PREDICTED: COP9 signalosome complex subunit 5 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004481161.1| PREDICTED: COP9 signalosome complex subunit 5 [Dasypus novemcinctus]
 ref|XP_004814145.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Mustela 
putorius furo]
 ref|XP_005322997.1| PREDICTED: COP9 signalosome complex subunit 5 [Ictidomys tridecemlineatus]
 ref|XP_005392180.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005563538.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Macaca 
fascicularis]
 ref|XP_006193800.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus ferus]
 ref|XP_006204770.1| PREDICTED: COP9 signalosome complex subunit 5 [Vicugna pacos]
 ref|XP_006150522.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Tupaia 
chinensis]
 ref|XP_006880503.1| PREDICTED: COP9 signalosome complex subunit 5 [Elephantulus edwardii]
 ref|XP_006924076.1| PREDICTED: COP9 signalosome complex subunit 5 [Pteropus alecto]
 ref|XP_007080736.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Panthera 
tigris altaica]
 ref|XP_007130932.1| PREDICTED: COP9 signalosome complex subunit 5 [Physeter catodon]
 ref|XP_007185082.1| PREDICTED: COP9 signalosome complex subunit 5 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448551.1| PREDICTED: COP9 signalosome complex subunit 5 [Lipotes vexillifer]
 ref|XP_007998988.1| PREDICTED: COP9 signalosome complex subunit 5 [Chlorocebus sabaeus]
 ref|XP_008565068.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Galeopterus 
variegatus]
 ref|XP_008704972.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Ursus 
maritimus]
 ref|XP_009211402.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_009211403.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Papio 
anubis]
 ref|XP_010369895.1| PREDICTED: COP9 signalosome complex subunit 5 [Rhinopithecus 
roxellana]
 ref|XP_010609774.1| PREDICTED: COP9 signalosome complex subunit 5 [Fukomys damarensis]
 ref|XP_010968931.1| PREDICTED: COP9 signalosome complex subunit 5 [Camelus bactrianus]
 ref|XP_010987306.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Camelus 
dromedarius]
 ref|XP_011362917.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pteropus 
vampyrus]
 sp|Q92905.4|CSN5_HUMAN RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1 [Homo sapiens]
 pdb|4D10|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D10|M Chain M, Crystal Structure Of The Cop9 Signalosome
 gb|AAH01187.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH01859.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 gb|AAH07272.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Homo sapiens]
 emb|CAG46479.1| COPS5 [Homo sapiens]
 gb|EAW86928.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86929.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 gb|EAW86931.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_a [Homo sapiens]
 dbj|BAG73052.1| COP9 constitutive photomorphogenic homolog subunit 5 [synthetic 
construct]
 gb|EFB14348.1| hypothetical protein PANDA_004498 [Ailuropoda melanoleuca]
 gb|ADZ15656.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[synthetic construct]
 gb|EHH28550.1| COP9 signalosome complex subunit 5 [Macaca mulatta]
 gb|EHH64214.1| COP9 signalosome complex subunit 5 [Macaca fascicularis]
 gb|AFV41219.1| c-Jun activation domain binding protein-1 [Sus scrofa]
 gb|ELK02355.1| COP9 signalosome complex subunit 5 [Pteropus alecto]
 gb|AIC50780.1| COPS5, partial [synthetic construct]
Length=334

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>gb|AAP36860.1| Homo sapiens COP9 constitutive photomorphogenic homolog subunit 
5 (Arabidopsis) [synthetic construct]
 gb|AAX29363.1| COP9 constitutive photomorphogenic-like subunit 5, partial [synthetic 
construct]
Length=335

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|XP_001494265.1| PREDICTED: COP9 signalosome complex subunit 5 isoformX1 [Equus 
caballus]
 ref|XP_008524909.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Equus 
przewalskii]
Length=334

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|NP_001179068.1| COP9 signalosome complex subunit 5 [Bos taurus]
 ref|XP_004011770.1| PREDICTED: COP9 signalosome complex subunit 5 [Ovis aries]
 ref|XP_005689095.1| PREDICTED: COP9 signalosome complex subunit 5 [Capra hircus]
 ref|XP_005892993.1| PREDICTED: COP9 signalosome complex subunit 5 [Bos mutus]
 ref|XP_005977667.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pantholops 
hodgsonii]
 ref|XP_010846758.1| PREDICTED: COP9 signalosome complex subunit 5 [Bison bison bison]
 tpg|DAA22731.1| TPA: COP9 signalosome subunit 5-like [Bos taurus]
Length=334

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|NP_001098770.1| COP9 signalosome complex subunit 5 [Sus scrofa]
 gb|ABR13016.1| COP9 constitutive photomorphogenic-like subunit 5 [Sus scrofa]
Length=334

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>gb|AAB16847.1| Jun activation domain binding protein [Homo sapiens]
Length=334

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|XP_001368118.1| PREDICTED: COP9 signalosome complex subunit 5 [Monodelphis domestica]
 ref|XP_003759773.1| PREDICTED: COP9 signalosome complex subunit 5 [Sarcophilus harrisii]
 ref|XP_004878903.1| PREDICTED: COP9 signalosome complex subunit 5 [Heterocephalus 
glaber]
 gb|EHA99341.1| COP9 signalosome complex subunit 5 [Heterocephalus glaber]
Length=334

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>gb|KFP96001.1| COP9 signalosome complex subunit 5, partial [Leptosomus discolor]
Length=337

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_007885051.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Callorhinchus 
milii]
Length=336

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>ref|NP_001034400.1| COP9 signalosome complex subunit 5 [Gallus gallus]
 emb|CAG31470.1| hypothetical protein RCJMB04_6l21 [Gallus gallus]
Length=338

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  195  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  255  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  312

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  313  KTTIEAIHGLMSQVIKDKLFNQI  335



>ref|XP_009083861.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Serinus 
canaria]
Length=339

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  196  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  256  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  313

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  314  KTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_005150843.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Melopsittacus 
undulatus]
 ref|XP_005479411.1| PREDICTED: COP9 signalosome complex subunit 5 [Zonotrichia albicollis]
 gb|ACH46430.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
Length=339

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  196  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  256  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  313

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  314  KTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_007527171.1| PREDICTED: COP9 signalosome complex subunit 5 [Erinaceus europaeus]
Length=334

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F   +    RK E+  +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSED--KLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>ref|NP_038743.1| COP9 signalosome complex subunit 5 isoform 1 [Mus musculus]
 ref|XP_005361944.1| PREDICTED: COP9 signalosome complex subunit 5 [Microtus ochrogaster]
 ref|XP_006974748.1| PREDICTED: COP9 signalosome complex subunit 5 [Peromyscus maniculatus 
bairdii]
 ref|XP_008852994.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Nannospalax 
galili]
 sp|O35864.3|CSN5_MOUSE RecName: Full=COP9 signalosome complex subunit 5; Short=SGN5; 
Short=Signalosome subunit 5; AltName: Full=Jun activation domain-binding 
protein 1; AltName: Full=Kip1 C-terminus-interacting 
protein 2 [Mus musculus]
 gb|AAF61318.1|AF068223_1 Kip1 C-terminus interacting protein-2 [Mus musculus]
 gb|AAD03470.1| 38 kDa Mov34 homolog [Mus musculus]
 gb|AAC17179.1| Jun coactivator Jab1 [Mus musculus]
 dbj|BAB28282.1| unnamed protein product [Mus musculus]
 gb|AAH46753.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Mus musculus]
 dbj|BAE30445.1| unnamed protein product [Mus musculus]
 dbj|BAE27030.1| unnamed protein product [Mus musculus]
 gb|EDL14298.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana), isoform CRA_a [Mus musculus]
Length=334

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>ref|XP_010574204.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Haliaeetus 
leucocephalus]
Length=340

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  137  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  196

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  197  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  256

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  257  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  314

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  315  KTTIEAIHGLMSQVIKDKLFNQI  337



>gb|KHN16463.1| COP9 signalosome complex subunit 5b [Glycine soja]
Length=191

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 163/172 (95%), Gaps = 2/172 (1%)
 Frame = -2

Query  613  IGAFR--TYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldl  440
            +G +R  TYPEGYKPPDEP+SEYQTIPLNKIEDFGVHCKQYY+LDITYFKSSLDSHLLDL
Sbjct  20   LGGWRMLTYPEGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYALDITYFKSSLDSHLLDL  79

Query  439  LWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEES  260
            LWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGPLIAP  RKKEEES
Sbjct  80   LWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGPLIAPTPRKKEEES  139

Query  259  QLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVET  104
             LAKIT DSAKITVEQVHGLMSQVIKDILFN+V Q+NR+RTE SGPEPM+E+
Sbjct  140  PLAKITRDSAKITVEQVHGLMSQVIKDILFNSVHQANRTRTEPSGPEPMIES  191



>gb|KFW63060.1| COP9 signalosome complex subunit 5, partial [Pygoscelis adeliae]
Length=286

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  83   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  142

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  143  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  202

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  203  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  260

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  261  KTTIEAIHGLMSQVIKDKLFNQI  283



>ref|NP_001264030.1| COP9 signalosome complex subunit 5 isoform 2 [Mus musculus]
Length=317

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  114  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  173

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  174  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  233

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  234  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  291

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  292  KTTIEAIHGLMSQVIKDKLFNQI  314



>ref|XP_006237820.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Rattus 
norvegicus]
Length=317

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  114  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  173

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  174  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  233

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  234  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  291

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  292  KTTIEAIHGLMSQVIKDKLFNQI  314



>ref|NP_001020866.1| COP9 signalosome complex subunit 5 [Rattus norvegicus]
 gb|AAH98736.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) 
[Rattus norvegicus]
 gb|EDM11550.1| COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis 
thaliana) [Rattus norvegicus]
Length=334

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>gb|KFO89731.1| COP9 signalosome complex subunit 5, partial [Buceros rhinoceros 
silvestris]
Length=291

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            +N  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  88   QNAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  147

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  148  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  207

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  208  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  265

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  266  KTTIEAIHGLMSQVIKDKLFNQI  288



>ref|XP_004602468.1| PREDICTED: COP9 signalosome complex subunit 5 [Sorex araneus]
Length=334

 Score =   298 bits (762),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>gb|EGW14995.1| COP9 signalosome complex subunit 5 [Cricetulus griseus]
Length=327

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  124  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  183

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  184  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  243

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F   +    RK E+  +LAK T DS 
Sbjct  244  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSED--KLAKATRDSC  301

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  302  KTTIEAIHGLMSQVIKDKLFNQI  324



>pdb|4D18|E Chain E, Crystal Structure Of The Cop9 Signalosome
 pdb|4D18|M Chain M, Crystal Structure Of The Cop9 Signalosome
Length=327

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  124  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  183

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  184  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  243

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  244  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  301

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  302  KTTIEAIHGLMSQVIKDKLFNQINIS  327



>ref|XP_006131546.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Pelodiscus 
sinensis]
Length=319

 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  116  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  175

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  176  KGFKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  235

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  236  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  293

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  294  KTTIEAIHGLMSQVIKDKLFNQI  316



>ref|XP_004814144.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Mustela 
putorius furo]
Length=340

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  137  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  196

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  197  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  256

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  257  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  314

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  315  KTTIEAIHGLMSQVIKDKLFNQINIS  340



>ref|XP_008173762.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Chrysemys 
picta bellii]
Length=319

 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  116  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  175

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  176  KGFKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  235

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  236  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  293

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  294  KTTIEAIHGLMSQVIKDKLFNQI  316



>ref|XP_007429682.1| PREDICTED: COP9 signalosome complex subunit 5 [Python bivittatus]
Length=337

 Score =   297 bits (761),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_008565067.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Galeopterus 
variegatus]
Length=335

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  132  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  192  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  252  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  309

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  310  KTTIEAIHGLMSQVIKDKLFNQINIS  335



>ref|XP_008106749.1| PREDICTED: COP9 signalosome complex subunit 5 [Anolis carolinensis]
Length=343

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  140  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  199

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  200  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  259

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  260  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSC  317

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  318  KTTIEAIHGLMSQVIKDKLFNQI  340



>ref|NP_001086291.1| COP9 signalosome complex subunit 5 [Xenopus laevis]
 sp|Q6GLM9.1|CSN5_XENLA RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Xenopus laevis]
 gb|AAH74434.1| MGC84682 protein [Xenopus laevis]
Length=332

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N +Y  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNAEYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLESHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQI  329



>ref|XP_006943314.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Felis 
catus]
Length=325

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  122  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  181

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  182  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  241

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  242  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  299

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  300  KTTIEAIHGLMSQVIKDKLFNQINIS  325



>ref|XP_008704973.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Ursus 
maritimus]
Length=325

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  122  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  181

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  182  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  241

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  242  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  299

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  300  KTTIEAIHGLMSQVIKDKLFNQINIS  325



>ref|XP_011219513.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Ailuropoda 
melanoleuca]
Length=325

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  122  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  181

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  182  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  241

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  242  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  299

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  300  KTTIEAIHGLMSQVIKDKLFNQINIS  325



>ref|XP_005311431.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Chrysemys 
picta bellii]
Length=337

 Score =   297 bits (760),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGFKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQI  334



>gb|KFM00893.1| COP9 signalosome complex subunit 5, partial [Aptenodytes forsteri]
Length=337

 Score =   297 bits (760),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_007080737.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Panthera 
tigris altaica]
Length=325

 Score =   296 bits (758),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  122  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  181

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  182  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  241

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  242  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  299

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  300  KTTIEAIHGLMSQVIKDKLFNQINIS  325



>ref|XP_006131545.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pelodiscus 
sinensis]
Length=337

 Score =   296 bits (759),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  194  KGFKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  254  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  312  KTTIEAIHGLMSQVIKDKLFNQI  334



>ref|XP_001636625.1| predicted protein [Nematostella vectensis]
 gb|EDO44562.1| predicted protein [Nematostella vectensis]
Length=333

 Score =   296 bits (759),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 171/203 (84%), Gaps = 3/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQM+NQQFQEPF+A+VIDPTRT+SAGKV +GAFRTYP
Sbjct  128  ENAIGWYHSHPGYGCWLSGIDVGTQMVNQQFQEPFVAIVIDPTRTISAGKVNLGAFRTYP  187

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYYSL+++YFKSSLD  LLD+LWNKYWVNTL
Sbjct  188  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSSLDRKLLDMLWNKYWVNTL  247

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY   QI+DL+EKLEQAE+Q+   R G  +A  + +K +E +LAK+T DS+
Sbjct  248  SSSSLLTNADYTNHQIADLSEKLEQAESQV--GRMGTFVAGMEERK-DEGKLAKVTRDSS  304

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K  +E VHGLMSQVIK+ LFN V
Sbjct  305  KSAIEAVHGLMSQVIKNRLFNQV  327



>ref|XP_005977666.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Pantholops 
hodgsonii]
Length=352

 Score =   297 bits (760),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  149  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  208

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  209  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  268

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  269  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  326

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  327  KTTIEAIHGLMSQVIKDKLFNQINIS  352



>ref|XP_009274936.1| PREDICTED: COP9 signalosome complex subunit 5 [Aptenodytes forsteri]
Length=339

 Score =   296 bits (759),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  196  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +L K T DS 
Sbjct  256  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLGKATRDSC  313

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  314  KTTIEAIHGLMSQVIKDKLFNQI  336



>gb|ELU08061.1| hypothetical protein CAPTEDRAFT_163387 [Capitella teleta]
Length=275

 Score =   294 bits (752),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 165/203 (81%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+VIDP RT+SAGKV IGAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVIDPVRTISAGKVNIGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQ+IPLNKIEDFGVHCKQYYSL+++YFKSS D  LL+ LWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQSIPLNKIEDFGVHCKQYYSLEVSYFKSSFDRRLLESLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DLA+KLEQ+E QL    F   + P ++K E+  +LAK T D  
Sbjct  187  SSSSLLTNADYTTGQVFDLADKLEQSEAQLGRGGFILGMDPHEKKSED--KLAKATKDGC  244

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN V
Sbjct  245  KNTIEAIHGLMSQVIKDKLFNQV  267



>ref|XP_007066265.1| PREDICTED: COP9 signalosome complex subunit 5 [Chelonia mydas]
 gb|EMP29804.1| COP9 signalosome complex subunit 5 [Chelonia mydas]
Length=338

 Score =   296 bits (757),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  195  KGFKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  255  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  312

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  313  KTTIEAIHGLMSQVIKDKLFNQI  335



>ref|NP_001232700.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
 gb|ACH44179.1| putative JUN activation binding protein variant 2 [Taeniopygia 
guttata]
Length=339

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 166/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAG V +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGXVNLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  196  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS 
Sbjct  256  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSC  313

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  314  KTTIEAIHGLMSQVIKDKLFNQI  336



>ref|XP_003831400.1| PREDICTED: COP9 signalosome complex subunit 5 [Pan paniscus]
Length=334

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G KPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGLKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>gb|AET43978.1| COP9 signalosome subunit 5, partial [Reishia clavigera]
Length=334

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+VIDP RT+SAGKV IGAFRTYP
Sbjct  125  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVIDPVRTISAGKVNIGAFRTYP  184

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQ+IPL+KIEDFGVHCK YYSL+I+YFKSS+D  LLD LWNKYWVNTL
Sbjct  185  KGYKPPDEAPSEYQSIPLSKIEDFGVHCKNYYSLEISYFKSSMDRRLLDSLWNKYWVNTL  244

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI+DLA+KLEQ+E+QL   R G ++    + K+ E +L+K T D  
Sbjct  245  SSSSLLTNADYTTGQINDLAQKLEQSESQL--GRGGFMLGMDTQDKKTEDKLSKATKDGC  302

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN V  S
Sbjct  303  KTTIEAIHGLMSQVIKDRLFNQVHCS  328



>ref|XP_008072512.1| PREDICTED: COP9 signalosome complex subunit 5 [Tarsius syrichta]
Length=390

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  187  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  246

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  247  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  306

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  307  SSSSLLTNADYTTGQIFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  364

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  365  KTTIEAIHGLMSQVIKDKLFNQINIS  390



>gb|EAW86930.1| COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis), 
isoform CRA_b [Homo sapiens]
Length=379

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  176  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  235

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  236  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  295

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  296  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  353

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  354  KTTIEAIHGLMSQVIKDKLFNQINIS  379



>ref|XP_638491.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 sp|Q54PF3.1|CSN5_DICDI RecName: Full=COP9 signalosome complex subunit 5; Short=Signalosome 
subunit 5 [Dictyostelium discoideum]
 gb|EAL65137.1| Mov34/MPN/PAD-1 family protein [Dictyostelium discoideum AX4]
 gb|ABC46697.1| COP9 signalosome complex subunit 5 [Dictyostelium discoideum]
Length=332

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 5/208 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQ +NQQ+ EP+L +VIDPTRTVSAGKVEIGAFRTYP
Sbjct  130  ENALGWYHSHPGYGCWLSGIDVGTQSVNQQYSEPWLGIVIDPTRTVSAGKVEIGAFRTYP  189

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQ+IPL+KIEDFGVHCKQYYSL+ITYFKSSLD  LLD LWNKYWVNTL
Sbjct  190  QGYKPPNEGPSEYQSIPLSKIEDFGVHCKQYYSLEITYFKSSLDQQLLDKLWNKYWVNTL  249

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSP+  N DY+ GQI+DL+EKLEQAE QLSHSR   L      KK+EES L+K++ DS+
Sbjct  250  SSSPIFSNRDYITGQINDLSEKLEQAETQLSHSRSSIL-----DKKKEESLLSKVSKDSS  304

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNR  146
            K+T+EQV G+MSQV K+ +FN  + + +
Sbjct  305  KVTIEQVQGIMSQVFKNSIFNECQTTKQ  332



>ref|XP_001179203.2| PREDICTED: COP9 signalosome complex subunit 5-like [Strongylocentrotus 
purpuratus]
Length=268

 Score =   292 bits (747),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQMLNQQFQEPF+A+V+DP RT+SAGKV IGAFRTYP
Sbjct  66   ENAIGWYHSHPGYGCWLSGIDVGTQMLNQQFQEPFVAIVVDPVRTISAGKVNIGAFRTYP  125

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+  SEYQTIPLNKIEDFGVHCKQYYSL+I+YFKS LD  LL+ LWNKYWVNTL
Sbjct  126  KGYKPPDDVASEYQTIPLNKIEDFGVHCKQYYSLEISYFKSVLDRKLLESLWNKYWVNTL  185

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+SDL+EKLE AE+QL     G  +     +K+ E +L K T DS 
Sbjct  186  SSSSLLTNADYTIGQVSDLSEKLENAESQLGR---GSFMLAVDHEKKAEDKLGKATRDSC  242

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIK+ LFN V
Sbjct  243  KSTIEVIHGLMSQVIKNKLFNQV  265



>ref|XP_006779523.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Myotis 
davidii]
Length=380

 Score =   296 bits (757),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  177  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  236

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCK YY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  237  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKXYYALEVSYFKSSLDRKLLELLWNKYWVNTL  296

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  297  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  354

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  355  KTTIEAIHGLMSQVIKDKLFNQINVS  380



>ref|XP_007651216.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Cricetulus 
griseus]
Length=389

 Score =   296 bits (758),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  186  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  245

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  246  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  305

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  306  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  363

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  364  KTTIEAIHGLMSQVIKDKLFNQI  386



>ref|XP_006069586.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Bubalus 
bubalis]
Length=404

 Score =   296 bits (758),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  201  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  260

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  261  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  320

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  321  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  378

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  379  KTTIEAIHGLMSQVIKDKLFNQINIS  404



>ref|XP_004637626.1| PREDICTED: COP9 signalosome complex subunit 5 [Octodon degus]
Length=232

 Score =   290 bits (743),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPG---YGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFR  599
            EN  GWYHSHPG   YGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFR
Sbjct  26   ENAIGWYHSHPGHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFR  85

Query  598  TYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWV  419
            TYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWV
Sbjct  86   TYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWV  145

Query  418  NTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITC  239
            NTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T 
Sbjct  146  NTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATR  203

Query  238  DSAKITVEQVHGLMSQVIKDILFNTV  161
            DS K T+E +HGLMSQVIKD LFN +
Sbjct  204  DSCKTTIEAIHGLMSQVIKDKLFNQI  229



>ref|XP_006752490.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome subunit 5 [Leptonychotes 
weddellii]
Length=334

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKY VNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYXVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQINIS  334



>ref|XP_011448116.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X1 [Crassostrea 
gigas]
 gb|EKC21935.1| COP9 signalosome complex subunit 5 [Crassostrea gigas]
Length=332

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+V+DP RT+SAGKV IGAFRTYP
Sbjct  128  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVVDPVRTISAGKVNIGAFRTYP  187

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQ+IPLNKIEDFGVHCK YYSLD++YFKS  D  LL+ LWNKYWVNTL
Sbjct  188  KGFKPPDEGPSEYQSIPLNKIEDFGVHCKHYYSLDMSYFKSVADRKLLESLWNKYWVNTL  247

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DLA+KLEQ+E QL   R G ++     +K+ E +LAK T D  
Sbjct  248  SSSSLLTNADYTTGQIFDLADKLEQSEVQL--CRGGFMLGMDTHEKKSEDKLAKATKDGC  305

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN V  +
Sbjct  306  KTTMEAIHGLMSQVIKDRLFNQVHTT  331



>ref|XP_007634273.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Cricetulus 
griseus]
Length=421

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 147/203 (72%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  218  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  277

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  278  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  337

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  338  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  395

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  396  KTTIEAIHGLMSQVIKDKLFNQI  418



>gb|ELW64697.1| COP9 signalosome complex subunit 5 [Tupaia chinensis]
Length=477

 Score =   298 bits (762),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  274  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  333

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  334  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  393

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  394  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  451

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  452  KTTIEAIHGLMSQVIKDKLFNQINIS  477



>gb|KJB65952.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
 gb|KJB65953.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=314

 Score =   292 bits (748),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYY+L+ITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPTDDPISEYQTIPLNKIEDFGVHCKQYYALNITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKK  272
            SSSPLLGNGDYVAGQ+SDLAEKLEQAEN L+HSR GPL     RKK
Sbjct  252  SSSPLLGNGDYVAGQLSDLAEKLEQAENHLTHSRIGPL--GTSRKK  295



>gb|KJB65950.1| hypothetical protein B456_010G123100 [Gossypium raimondii]
Length=303

 Score =   291 bits (746),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQQFQEPFLAVVIDPTRTVSAGKV+IGAFRTYP
Sbjct  132  ENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVDIGAFRTYP  191

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            EGYKP D+P+SEYQTIPLNKIEDFGVHCKQYY+L+ITYFKSSLD HLLDLLWNKYWVNTL
Sbjct  192  EGYKPTDDPISEYQTIPLNKIEDFGVHCKQYYALNITYFKSSLDCHLLDLLWNKYWVNTL  251

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKK  272
            SSSPLLGNGDYVAGQ+SDLAEKLEQAEN L+HSR GPL     RKK
Sbjct  252  SSSPLLGNGDYVAGQLSDLAEKLEQAENHLTHSRIGPL--GTSRKK  295



>ref|XP_003292126.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
 gb|EGC31350.1| Mov34/MPN/PAD-1 family protein [Dictyostelium purpureum]
Length=332

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 171/201 (85%), Gaps = 4/201 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQ++NQQ+ EP+L +VIDPTRTVSAGKVEIGAFRTYP
Sbjct  129  ENALGWYHSHPGYGCWLSGIDVGTQLVNQQYSEPWLGIVIDPTRTVSAGKVEIGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQ+IPL+KIEDFGVHCKQYYSL+I+YFKSSLD  LLD LWNKYWVNTL
Sbjct  189  QGYKPPNEGPSEYQSIPLSKIEDFGVHCKQYYSLEISYFKSSLDQQLLDKLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSSP+  N +Y+ GQI+DL+EKLEQAE QLS++R   L      KK+EES L+KI+ DS+
Sbjct  249  SSSPIFSNREYITGQINDLSEKLEQAETQLSNTRSAAL----SDKKKEESLLSKISKDSS  304

Query  229  KITVEQVHGLMSQVIKDILFN  167
            K+T+EQV G+MSQV K+ +FN
Sbjct  305  KVTIEQVQGIMSQVFKNSIFN  325



>ref|XP_006901120.1| PREDICTED: COP9 signalosome complex subunit 5-like [Elephantulus 
edwardii]
Length=245

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGY CWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV++GAFRTYP
Sbjct  42   ENAIGWYHSHPGYSCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVKLGAFRTYP  101

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQ++PLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYW+NTL
Sbjct  102  KGYKPPDEGPSEYQSVPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWMNTL  161

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLE++E QL    F  ++       + E +LAK T DS 
Sbjct  162  SSSSLLTNADYTTGQVFDLSEKLERSEAQLGRGSF--MLGLETHDLKSEDKLAKATRDSC  219

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  220  KTTIEAIHGLMSQVIKDKLFNQINIS  245



>ref|XP_011448117.1| PREDICTED: COP9 signalosome complex subunit 5 isoform X2 [Crassostrea 
gigas]
Length=361

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 164/206 (80%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+V+DP RT+SAGKV IGAFRTYP
Sbjct  157  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVVDPVRTISAGKVNIGAFRTYP  216

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +G+KPPDE  SEYQ+IPLNKIEDFGVHCK YYSLD++YFKS  D  LL+ LWNKYWVNTL
Sbjct  217  KGFKPPDEGPSEYQSIPLNKIEDFGVHCKHYYSLDMSYFKSVADRKLLESLWNKYWVNTL  276

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DLA+KLEQ+E QL   R G ++     +K+ E +LAK T D  
Sbjct  277  SSSSLLTNADYTTGQIFDLADKLEQSEVQL--CRGGFMLGMDTHEKKSEDKLAKATKDGC  334

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN V  +
Sbjct  335  KTTMEAIHGLMSQVIKDRLFNQVHTT  360



>ref|XP_008989617.1| PREDICTED: LOW QUALITY PROTEIN: COP9 signalosome complex subunit 
5-like [Callithrix jacchus]
Length=387

 Score =   293 bits (750),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  184  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  243

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LL NKYWVNTL
Sbjct  244  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLLNKYWVNTL  303

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  304  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  361

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  362  KTTIEAIHGLMSQVIKDKLFNQINIS  387



>ref|XP_001200311.2| PREDICTED: COP9 signalosome complex subunit 5-like, partial [Strongylocentrotus 
purpuratus]
Length=554

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 165/203 (81%), Gaps = 3/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID  TQMLNQQFQEPF+A+V+DP RT+SAGKV IGAFRTYP
Sbjct  352  ENAIGWYHSHPGYGCWLSGIDVGTQMLNQQFQEPFVAIVVDPVRTISAGKVNIGAFRTYP  411

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+  SEYQTIPLNKIEDFGVHCKQYYSL+I+YFKS LD  LL+ LWNKYWVNTL
Sbjct  412  KGYKPPDDVASEYQTIPLNKIEDFGVHCKQYYSLEISYFKSVLDRKLLESLWNKYWVNTL  471

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+SDL+EKLE AE+QL    F  ++A    KK E+ +L K T DS 
Sbjct  472  SSSSLLTNADYTIGQVSDLSEKLENAESQLGRGSF--MLAVDHEKKAED-KLGKATRDSC  528

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIK+ LFN V
Sbjct  529  KSTIEVIHGLMSQVIKNKLFNQV  551



>ref|XP_009045703.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
 gb|ESP03615.1| hypothetical protein LOTGIDRAFT_224262 [Lottia gigantea]
Length=333

 Score =   290 bits (741),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 163/203 (80%), Gaps = 1/203 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID +TQMLNQQFQEPF+A+VIDP RT+SAGKV IGAFRTYP
Sbjct  128  ENAIGWYHSHPGYGCWLSGIDVNTQMLNQQFQEPFVAIVIDPVRTISAGKVNIGAFRTYP  187

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQ+IPLNKIEDFGVHCKQYYSLDI+YFKS+LD  LL+ LWNKYWVNTL
Sbjct  188  KGYKPPDEGPSEYQSIPLNKIEDFGVHCKQYYSLDISYFKSALDCKLLESLWNKYWVNTL  247

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N +Y   QI DLA+KLEQ+E QL    F  +   +Q KK E+ +L K   D  
Sbjct  248  SSSSLLTNAEYTTHQIFDLADKLEQSEAQLGRGSFMVMGIDSQEKKSED-KLLKAKKDGC  306

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN V
Sbjct  307  KTTIEAIHGLMSQVIKDRLFNQV  329



>gb|ERE86124.1| COP9 signalosome complex subunit 5 [Cricetulus griseus]
Length=725

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 167/203 (82%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F   +    RK E+  +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSED--KLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQVIKD LFN +
Sbjct  309  KTTIEAIHGLMSQVIKDKLFNQI  331



>gb|KFP72154.1| COP9 signalosome complex subunit 5, partial [Acanthisitta chloris]
Length=196

 Score =   281 bits (720),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = -2

Query  745  SHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDE  566
            SHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP+GYKPPDE
Sbjct  1    SHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDE  60

Query  565  PVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGN  386
              SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N
Sbjct  61   GPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTN  120

Query  385  GDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVH  206
             DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS K T+E +H
Sbjct  121  ADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIH  178

Query  205  GLMSQVIKDILFNTV  161
            GLMSQVIKD LFN +
Sbjct  179  GLMSQVIKDKLFNQI  193



>gb|ETE60341.1| COP9 signalosome complex subunit 5, partial [Ophiophagus hannah]
Length=379

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 167/216 (77%), Gaps = 15/216 (7%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVV-------------IDPTRTVS  629
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVV             IDPTRT+S
Sbjct  163  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVECIVYVNSDYILQIDPTRTIS  222

Query  628  AGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshl  449
            AGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  L
Sbjct  223  AGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKL  282

Query  448  ldlLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKE  269
            L+LLWNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++
Sbjct  283  LELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLESHDRK  340

Query  268  EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV  161
             E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct  341  SEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI  376



>ref|XP_005099578.1| PREDICTED: COP9 signalosome complex subunit 5-like [Aplysia californica]
Length=334

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 161/203 (79%), Gaps = 3/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+VIDP RT+SAGKV IGAFRTYP
Sbjct  128  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVIDPVRTISAGKVNIGAFRTYP  187

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
             GYKPPDE  SEYQ+IPLNKIEDFGVHCK YY LDI+YFKSS+D  LL+ LWNKYWVNTL
Sbjct  188  RGYKPPDEYPSEYQSIPLNKIEDFGVHCKAYYPLDISYFKSSMDRRLLESLWNKYWVNTL  247

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  G I DL+EKLEQ+E+QL  S    LI+   + ++ E +L K T D  
Sbjct  248  SSSSLLTNADYTTGMIFDLSEKLEQSESQLGRS---GLISTDSQDRKTEDKLTKATKDGC  304

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            + T+E + GLMSQVIKD LFN V
Sbjct  305  RTTMEVLQGLMSQVIKDRLFNQV  327



>ref|XP_009074279.1| PREDICTED: COP9 signalosome complex subunit 5, partial [Acanthisitta 
chloris]
Length=195

 Score =   280 bits (715),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 160/194 (82%), Gaps = 2/194 (1%)
 Frame = -2

Query  742  HPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEP  563
            HPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP+GYKPPDE 
Sbjct  1    HPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEG  60

Query  562  VSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTLSSSPLLGNG  383
             SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTLSSS LL N 
Sbjct  61   PSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNA  120

Query  382  DYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHG  203
            DY  GQ+ DL+EKLEQ+E QL    F  ++      K+ E +LAK T DS K T+E +HG
Sbjct  121  DYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDKKSEDKLAKATRDSCKTTIEAIHG  178

Query  202  LMSQVIKDILFNTV  161
            LMSQVIKD LFN +
Sbjct  179  LMSQVIKDKLFNQI  192



>ref|XP_004638141.1| PREDICTED: COP9 signalosome complex subunit 5-like [Octodon degus]
Length=334

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 163/203 (80%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYG  LSGID  TQMLNQQFQEPF AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGGRLSGIDVCTQMLNQQFQEPFAAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDQKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLMSQ+IKD LFN +
Sbjct  309  KTTIEAIHGLMSQIIKDKLFNQI  331



>gb|KDR11248.1| COP9 signalosome complex subunit 5 [Zootermopsis nevadensis]
Length=343

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  136  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  195

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQTIPLNKIEDFGVHCKQYYSL++TYFKSSLD  LLD LWNKYWVNTL
Sbjct  196  KGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYSLEVTYFKSSLDRRLLDSLWNKYWVNTL  255

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDS  233
            SSS LL N DY  GQI DL++KLEQ+E  L   R G ++  A    K  E +L K T DS
Sbjct  256  SSSSLLTNADYTTGQIFDLSDKLEQSEAAL--GRGGFMLGGADPHDKRTEDKLLKATKDS  313

Query  232  AKITVEQVHGLMSQVIKDILFNTVR  158
             K T+E +HGLM+Q+IKD LFN ++
Sbjct  314  CKTTIEIIHGLMAQMIKDCLFNHIK  338



>dbj|BAN21083.1| jun activation domain binding protein [Riptortus pedestris]
Length=342

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 164/205 (80%), Gaps = 4/205 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQTIPLNKIEDFGVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTL
Sbjct  195  KGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR-FGPLIAPAQRKKEEESQLAKITCDS  233
            SS+ LL N DY  GQI DL++KLEQ+E+ L     FG      Q +K  E +L K T DS
Sbjct  255  SSASLLTNADYTTGQILDLSDKLEQSESALGRGHMFG---GADQHEKRTEDKLLKATKDS  311

Query  232  AKITVEQVHGLMSQVIKDILFNTVR  158
             K TVE +HGLM+Q+IKD LFN ++
Sbjct  312  CKTTVEIIHGLMAQMIKDRLFNQIK  336



>dbj|BAM18530.1| COP9 complex homolog subunit 5 [Papilio xuthus]
Length=348

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 173/222 (78%), Gaps = 9/222 (4%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP +E  SEYQTIPLNKIEDFGVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTL
Sbjct  195  KGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDS  233
            SSS L+ N DY  GQI DL++KLEQ+E  LS   F  L+A A   +K  E +L+K T D+
Sbjct  255  SSSSLITNADYTTGQIFDLSDKLEQSEVCLSRGVF--LVAGADPHEKRSEDKLSKATKDA  312

Query  232  AKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVE  107
             K T+E +HGLM+Q+IKD LFN V  S R     + P PM+E
Sbjct  313  CKTTIEVIHGLMAQMIKDRLFNGV--SGR----PAPPTPMIE  348



>gb|ADP30958.1| COP9 constitutive photomorphogenic-like protein subunit 5 [Penaeus 
monodon]
Length=351

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 169/212 (80%), Gaps = 3/212 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID STQMLNQ +QEPF+A+VIDP RT+S+GKV IGAFRTYP
Sbjct  141  ENVIGWYHSHPGYGCWLSGIDVSTQMLNQNYQEPFVAIVIDPIRTISSGKVNIGAFRTYP  200

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYYSLDI+YFKSSLD  LLD LWNKYWVNTL
Sbjct  201  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYSLDISYFKSSLDKKLLDSLWNKYWVNTL  260

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS L+ N +Y+  QI DL++KLE +E  L   R G      Q KK E+ +L+++T DS 
Sbjct  261  SSSSLITNAEYMTRQIFDLSDKLENSETAL--GRAGLFGLDPQEKKTED-KLSRVTRDSC  317

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTE  134
            K T+E +HGLM+QV+KD LFN + Q+ +   E
Sbjct  318  KTTMEALHGLMAQVVKDRLFNQIPQAQQKGQE  349



>ref|XP_008548790.1| PREDICTED: COP9 signalosome complex subunit 5-like [Microplitis 
demolitor]
Length=342

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 160/203 (79%), Gaps = 2/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  134  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  193

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP +E  SEYQTIPLNKIEDFGVHCKQYYSL++TYFKSSLD  LLD LWNKYWVNTL
Sbjct  194  KGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSLEVTYFKSSLDRRLLDSLWNKYWVNTL  253

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQI DL++KLEQ+E  L   R G +       +  E +L K T DS 
Sbjct  254  SSSSLLTNADYTTGQIFDLSDKLEQSEVAL--GRGGFMSGADSHDRRTEDKLVKATRDSC  311

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLM+Q+IKD LFN V
Sbjct  312  KTTIEVIHGLMAQIIKDKLFNQV  334



>ref|NP_001138802.1| JAB-MPN domain protein [Bombyx mori]
 gb|ACM24339.1| JAB-MPN domain protein [Bombyx mori]
Length=348

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 172/224 (77%), Gaps = 13/224 (6%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP +E  SEYQTIPLNKIEDFGVHCKQYYS++++YFKSSLD  LLD LWNKYWVNTL
Sbjct  195  KGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSMEVSYFKSSLDRRLLDSLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQ-RKKEEESQLAKITCDS  233
            SSS L+ N DY  GQI DL++KLEQ+E  L    F  ++A A   +K  E +L K T D+
Sbjct  255  SSSSLITNADYTTGQIFDLSDKLEQSEVCLGRGAF--VVAGADPHEKRTEDKLGKATKDA  312

Query  232  AKITVEQVHGLMSQVIKDILFNTV--RQSNRSRTESSGPEPMVE  107
             K T+E +HGLM+Q+IKD LFN+V  RQ        + P PM+E
Sbjct  313  CKTTIEVIHGLMAQMIKDRLFNSVCGRQ--------AAPTPMIE  348



>gb|AEE62710.1| unknown [Dendroctonus ponderosae]
 gb|ENN70355.1| hypothetical protein YQE_12863, partial [Dendroctonus ponderosae]
 gb|ERL94202.1| hypothetical protein D910_11483 [Dendroctonus ponderosae]
Length=351

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 164/203 (81%), Gaps = 1/203 (0%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  138  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  197

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQTIPLNKIEDFGVHCKQYYSL+++YFKS+LD  LLD LWNKYWVNTL
Sbjct  198  KGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSTLDRRLLDSLWNKYWVNTL  257

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS L+ N DY  GQI DL+EKLEQ+E  +  + F    A    K+ E+ +L K T DS 
Sbjct  258  SSSSLITNADYTTGQIFDLSEKLEQSEAAIGRAGFLAGSADPTEKRTED-KLLKATKDSC  316

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            K T+E +HGLM+Q+IKD LFN++
Sbjct  317  KTTIEIIHGLMAQMIKDRLFNSI  339



>gb|EPB91337.1| COP9 signalosome complex subunit 5a [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=334

 Score =   281 bits (720),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 168/204 (82%), Gaps = 3/204 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            ENV GWYHSHPGYGCWLSGID +TQMLNQQ+QEPF+AVVIDP RT+SAGKVEIGAFRT+P
Sbjct  129  ENVLGWYHSHPGYGCWLSGIDVNTQMLNQQYQEPFVAVVIDPNRTMSAGKVEIGAFRTFP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
             GYK PDE  SEYQTIPLNKIEDFGVH K YYSL++++FKS+LD+ LL++LW+KYWVNTL
Sbjct  189  AGYKAPDEGPSEYQTIPLNKIEDFGVHAKSYYSLEVSHFKSTLDNQLLEVLWHKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            S SPLL N DY   Q+SDLA+KL +    ++ SR G       RKK +ESQL K+T DS+
Sbjct  249  SQSPLLTNRDYATRQMSDLAQKLNKTNESMT-SRMGGYY--GDRKKNDESQLNKVTKDSS  305

Query  229  KITVEQVHGLMSQVIKDILFNTVR  158
            KITVE VHGL+SQV+KD +FN+ R
Sbjct  306  KITVEAVHGLLSQVLKDQVFNSPR  329



>ref|XP_010732391.1| PREDICTED: COP9 signalosome complex subunit 5 [Larimichthys crocea]
Length=333

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E +HGLMSQVIKD LFN +  SN
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTSN  333



>ref|XP_009029035.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
 gb|ESN92732.1| hypothetical protein HELRODRAFT_185158 [Helobdella robusta]
Length=335

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 163/206 (79%), Gaps = 5/206 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAIVIDPIRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPD+  SEYQ+IPLNKIEDFGVHCKQYY LD++YFKSSLD  LL++LW+KYWVNTL
Sbjct  189  KGYKPPDDGPSEYQSIPLNKIEDFGVHCKQYYPLDVSYFKSSLDRRLLEMLWDKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRF--GPLIAPAQRKKEEESQLAKITCD  236
            SS  LL N DY  GQI DL +KLEQ+E+ L    F  GP    A R    E +L K T D
Sbjct  249  SSCNLLTNADYTTGQIYDLTDKLEQSESFLGRGPFVGGPEQVAADRA---EDKLTKATKD  305

Query  235  SAKITVEQVHGLMSQVIKDILFNTVR  158
            S K T+E +HGLM+QVIKD LFN ++
Sbjct  306  SCKNTIESIHGLMTQVIKDKLFNKIK  331



>gb|EHJ73122.1| JAB-MPN domain protein [Danaus plexippus]
Length=397

 Score =   283 bits (724),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 171/221 (77%), Gaps = 8/221 (4%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  117  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  176

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP +E  SEYQTIPLNKIEDFGVHCKQYYSL+++YFKSSLD  LLD LWNKYWVNTL
Sbjct  177  KGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSSLDRRLLDSLWNKYWVNTL  236

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS L+ N DY  GQI DL++KLEQ+E  L   R G LI     +K  E +L K T D+ 
Sbjct  237  SSSSLITNADYTTGQIFDLSDKLEQSEVCL--GRGGFLIGTDPHEKRTEDKLGKATKDAC  294

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEPMVE  107
            K T+E +HGLM+Q+IKD LFN+V  S R     S P PM++
Sbjct  295  KTTIEVIHGLMAQMIKDRLFNSV--SGR----PSPPTPMLD  329



>ref|XP_004524030.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Ceratitis capitata]
Length=331

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 163/203 (80%), Gaps = 3/203 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ +QEPF+A+VIDP RTVSAGKV +GAFRTYP
Sbjct  128  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNYQEPFVAIVIDPVRTVSAGKVCLGAFRTYP  187

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPP+E  SEYQTIPLNKI+DFGVHCKQYY L++TYFKS+LD  LLD LWNKYWVNTL
Sbjct  188  KGYKPPNEEPSEYQTIPLNKIDDFGVHCKQYYPLEVTYFKSALDRKLLDSLWNKYWVNTL  247

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
             SS LL N DY  GQI DL+EKLEQ+E+ L     GP IA  + +K  E +L+K T D +
Sbjct  248  GSSGLLTNTDYTTGQIFDLSEKLEQSESSLVR---GPFIATGKIEKRTEDKLSKATRDCS  304

Query  229  KITVEQVHGLMSQVIKDILFNTV  161
            + ++E +HGLM+Q+ KD LFN V
Sbjct  305  RASIELIHGLMAQIAKDKLFNKV  327



>ref|XP_005722652.1| PREDICTED: COP9 signalosome complex subunit 5-like isoform X2 
[Pundamilia nyererei]
Length=272

 Score =   278 bits (710),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  67   ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  126

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  127  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  186

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  187  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGCF--MLGLDTHDRKSEDKLAKATRDSC  244

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  245  KTTIEAIHGLMSQVIKDKLFNQINTS  270



>ref|XP_008185322.1| PREDICTED: COP9 complex homolog subunit 5 isoform X1 [Acyrthosiphon 
pisum]
Length=339

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQ FQEPF+A+VIDP RT+SAGKV +GAFRTYP
Sbjct  135  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTISAGKVCLGAFRTYP  194

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKP +E  SEYQTIPLNKIEDFGVHCKQYYSL++ YFKSSLD  LLD LWNKYWVNTL
Sbjct  195  KGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSLEVNYFKSSLDRRLLDSLWNKYWVNTL  254

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS L+ N DY+ GQI+DL++KLEQA+  LS + F P+      + + E++L K T DS 
Sbjct  255  SSSSLITNADYLTGQINDLSDKLEQADTSLSRTFFEPV-----DRTKTENKLVKATKDSN  309

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E + GLMSQ IK+ LFN+    N
Sbjct  310  KATIEILCGLMSQTIKEALFNSCTPKN  336



>ref|XP_005797898.1| PREDICTED: COP9 signalosome complex subunit 5-like [Xiphophorus 
maculatus]
Length=334

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>emb|CBN81931.1| COP9 signalosome complex subunit 5 [Dicentrarchus labrax]
Length=334

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>ref|XP_008305996.1| PREDICTED: COP9 signalosome complex subunit 5 [Cynoglossus semilaevis]
Length=334

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>ref|XP_005066755.1| PREDICTED: COP9 signalosome complex subunit 5 [Mesocricetus auratus]
Length=400

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 158/192 (82%), Gaps = 2/192 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  131  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  190

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFKSSLD  LL+LLWNKYWVNTL
Sbjct  191  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL  250

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  251  SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSC  308

Query  229  KITVEQVHGLMS  194
            K T+E +HGLMS
Sbjct  309  KTTIEAIHGLMS  320



>ref|XP_004081080.1| PREDICTED: COP9 signalosome complex subunit 5 [Oryzias latipes]
 ref|XP_008304802.1| PREDICTED: COP9 signalosome complex subunit 5 [Stegastes partitus]
Length=334

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>ref|XP_007554550.1| PREDICTED: COP9 signalosome complex subunit 5 [Poecilia formosa]
Length=334

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E +HGLMSQVIKD LFN +  S+
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTSS  333



>gb|ACO09632.1| COP9 signalosome complex subunit 5 [Osmerus mordax]
Length=334

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>ref|XP_003967989.1| PREDICTED: COP9 signalosome complex subunit 5-like [Takifugu 
rubripes]
Length=334

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTS  332



>emb|CAG00664.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=333

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  130  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  189

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  190  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  249

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  250  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  307

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  308  KTTIEAIHGLMSQVIKDKLFNQINTS  333



>ref|XP_008394459.1| PREDICTED: COP9 signalosome complex subunit 5 [Poecilia reticulata]
Length=336

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 169/207 (82%), Gaps = 2/207 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQSN  149
            K T+E +HGLMSQVIKD LFN +  S+
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINTSS  333



>ref|XP_006634059.1| PREDICTED: COP9 signalosome complex subunit 5-like [Lepisosteus 
oculatus]
Length=334

 Score =   278 bits (711),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 168/206 (82%), Gaps = 2/206 (1%)
 Frame = -2

Query  769  ENVXGWYHSHPGYGCWLSGIDGSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP  590
            EN  GWYHSHPGYGCWLSGID STQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP
Sbjct  129  ENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYP  188

Query  589  EGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKssldshlldlLWNKYWVNTL  410
            +GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFKSSLD  LL+LLWNKYWVNTL
Sbjct  189  KGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFKSSLDRKLLELLWNKYWVNTL  248

Query  409  SSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSA  230
            SSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++      ++ E +LAK T DS 
Sbjct  249  SSSSLLTNSDYTTGQVFDLSEKLEQSEAQLGRGSF--MLGLDTHDRKSEDKLAKATRDSC  306

Query  229  KITVEQVHGLMSQVIKDILFNTVRQS  152
            K T+E +HGLMSQVIKD LFN +  S
Sbjct  307  KTTIEAIHGLMSQVIKDKLFNQINIS  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100