BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014F16

Length=815
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006356286.1|  PREDICTED: serine carboxypeptidase-like 42-like    359   3e-118   Solanum tuberosum [potatoes]
gb|EYU17411.1|  hypothetical protein MIMGU_mgv1a005783mg                359   3e-118   Erythranthe guttata [common monkey flower]
ref|XP_007161488.1|  hypothetical protein PHAVU_001G0732000g            352   8e-118   Phaseolus vulgaris [French bean]
ref|XP_004237734.1|  PREDICTED: serine carboxypeptidase-like 42         357   1e-117   Solanum lycopersicum
ref|XP_009600050.1|  PREDICTED: serine carboxypeptidase-like 42         356   5e-117   Nicotiana tomentosiformis
ref|XP_009798650.1|  PREDICTED: serine carboxypeptidase-like 42 i...    356   5e-117   Nicotiana sylvestris
ref|XP_010244030.1|  PREDICTED: serine carboxypeptidase-like 42 i...    355   9e-117   Nelumbo nucifera [Indian lotus]
ref|XP_010244029.1|  PREDICTED: serine carboxypeptidase-like 42 i...    355   2e-116   
ref|XP_011074776.1|  PREDICTED: serine carboxypeptidase-like 42         352   2e-115   Sesamum indicum [beniseed]
ref|XP_011101717.1|  PREDICTED: serine carboxypeptidase-like 42         351   3e-115   Sesamum indicum [beniseed]
ref|XP_010062160.1|  PREDICTED: serine carboxypeptidase-like 42         350   2e-114   Eucalyptus grandis [rose gum]
ref|XP_006581614.1|  PREDICTED: serine carboxypeptidase-like 42-l...    346   7e-114   
ref|XP_004173353.1|  PREDICTED: serine carboxypeptidase-like 42-like    344   2e-113   
ref|XP_010664883.1|  PREDICTED: serine carboxypeptidase-like 42 i...    344   3e-113   Vitis vinifera
ref|XP_004290564.1|  PREDICTED: serine carboxypeptidase-like 42         346   4e-113   Fragaria vesca subsp. vesca
ref|XP_004490638.1|  PREDICTED: serine carboxypeptidase-like 42-l...    346   5e-113   Cicer arietinum [garbanzo]
ref|XP_010245825.1|  PREDICTED: serine carboxypeptidase-like 42         345   6e-113   Nelumbo nucifera [Indian lotus]
ref|XP_003615811.1|  Serine carboxypeptidase-like protein               344   2e-112   Medicago truncatula
ref|XP_003527966.2|  PREDICTED: serine carboxypeptidase-like 42-l...    344   2e-112   Glycine max [soybeans]
ref|XP_007019398.1|  Serine carboxypeptidase-like 42 isoform 2          343   2e-112   
ref|XP_002278193.1|  PREDICTED: serine carboxypeptidase-like 42 i...    343   7e-112   Vitis vinifera
ref|XP_004148827.1|  PREDICTED: serine carboxypeptidase-like 42-like    343   9e-112   Cucumis sativus [cucumbers]
ref|XP_006578942.1|  PREDICTED: serine carboxypeptidase-like 42-l...    342   1e-111   Glycine max [soybeans]
ref|XP_002300939.1|  serine carboxypeptidase S10 family protein         342   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_007019397.1|  Serine carboxypeptidase-like 42 isoform 1          342   1e-111   
ref|XP_008441654.1|  PREDICTED: serine carboxypeptidase-like 42         338   4e-111   
ref|XP_006596272.1|  PREDICTED: serine carboxypeptidase-like 42-l...    340   4e-111   Glycine max [soybeans]
ref|XP_003544740.2|  PREDICTED: serine carboxypeptidase-like 42-l...    340   1e-110   Glycine max [soybeans]
ref|XP_003522555.2|  PREDICTED: serine carboxypeptidase-like 42-l...    340   1e-110   Glycine max [soybeans]
ref|XP_011027377.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    339   2e-110   Populus euphratica
gb|KDP43043.1|  hypothetical protein JCGZ_25229                         339   3e-110   Jatropha curcas
gb|KHN05260.1|  Serine carboxypeptidase-like 42                         338   3e-110   Glycine soja [wild soybean]
ref|XP_009360732.1|  PREDICTED: serine carboxypeptidase-like 42         338   5e-110   Pyrus x bretschneideri [bai li]
ref|XP_008373913.1|  PREDICTED: serine carboxypeptidase-like 42         337   8e-110   
ref|XP_006280410.1|  hypothetical protein CARUB_v10026343mg             337   8e-110   Capsella rubella
ref|XP_010530237.1|  PREDICTED: serine carboxypeptidase-like 42         337   1e-109   Tarenaya hassleriana [spider flower]
ref|XP_008461496.1|  PREDICTED: serine carboxypeptidase-like 42 i...    335   2e-109   Cucumis melo [Oriental melon]
ref|XP_007137531.1|  hypothetical protein PHAVU_009G134900g             336   2e-109   Phaseolus vulgaris [French bean]
ref|XP_006434388.1|  hypothetical protein CICLE_v10000998mg             337   2e-109   Citrus clementina [clementine]
ref|XP_008461495.1|  PREDICTED: serine carboxypeptidase-like 42 i...    335   5e-109   Cucumis melo [Oriental melon]
ref|XP_009377699.1|  PREDICTED: serine carboxypeptidase-like 42         335   6e-109   Pyrus x bretschneideri [bai li]
ref|XP_004167283.1|  PREDICTED: serine carboxypeptidase-like 42-like    331   1e-108   
ref|XP_009377698.1|  PREDICTED: serine carboxypeptidase-like 42         334   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_008237677.1|  PREDICTED: serine carboxypeptidase-like 42         334   1e-108   Prunus mume [ume]
ref|XP_010679983.1|  PREDICTED: serine carboxypeptidase-like 42         334   2e-108   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010519388.1|  PREDICTED: serine carboxypeptidase-like 42         334   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_009377728.1|  PREDICTED: serine carboxypeptidase-like 42         334   2e-108   Pyrus x bretschneideri [bai li]
ref|XP_002865546.1|  hypothetical protein ARALYDRAFT_494806             333   3e-108   
ref|XP_008373914.1|  PREDICTED: serine carboxypeptidase-like 42         333   3e-108   
ref|XP_006472927.1|  PREDICTED: serine carboxypeptidase-like 42-like    332   9e-108   
ref|XP_010930631.1|  PREDICTED: serine carboxypeptidase-like 42         332   1e-107   Elaeis guineensis
gb|KJB59375.1|  hypothetical protein B456_009G252300                    326   6e-107   Gossypium raimondii
ref|XP_002526159.1|  serine carboxypeptidase, putative                  330   8e-107   
gb|KGN44500.1|  hypothetical protein Csa_7G319000                       329   1e-106   Cucumis sativus [cucumbers]
ref|NP_199039.1|  serine carboxypeptidase-like 42                       329   2e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490637.1|  PREDICTED: serine carboxypeptidase-like 42-l...    330   3e-106   
ref|XP_010442147.1|  PREDICTED: serine carboxypeptidase-like 42         327   6e-106   Camelina sativa [gold-of-pleasure]
emb|CDP12019.1|  unnamed protein product                                327   9e-106   Coffea canephora [robusta coffee]
gb|KHF97371.1|  Serine carboxypeptidase-like 42                         327   1e-105   Gossypium arboreum [tree cotton]
gb|KJB59377.1|  hypothetical protein B456_009G252300                    327   1e-105   Gossypium raimondii
gb|KJB59374.1|  hypothetical protein B456_009G252300                    326   3e-105   Gossypium raimondii
ref|XP_010482006.1|  PREDICTED: serine carboxypeptidase-like 42         325   4e-105   Camelina sativa [gold-of-pleasure]
dbj|BAJ87921.1|  predicted protein                                      320   4e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009414969.1|  PREDICTED: serine carboxypeptidase-like 42         320   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002268397.1|  PREDICTED: serine carboxypeptidase-like 42         318   2e-102   Vitis vinifera
ref|XP_008786550.1|  PREDICTED: serine carboxypeptidase-like 42         318   2e-102   
ref|XP_009136205.1|  PREDICTED: serine carboxypeptidase-like 42         317   1e-101   Brassica rapa
ref|XP_004977165.1|  PREDICTED: serine carboxypeptidase-like 42-l...    316   1e-101   
ref|XP_004139740.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    333   2e-101   
ref|XP_004977164.1|  PREDICTED: serine carboxypeptidase-like 42-l...    316   3e-101   Setaria italica
ref|NP_001067496.1|  Os11g0213600                                       315   5e-101   
gb|EEE51848.1|  hypothetical protein OsJ_33355                          315   5e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577714.1|  PREDICTED: serine carboxypeptidase-like 42         314   8e-101   Brachypodium distachyon [annual false brome]
emb|CDY66139.1|  BnaAnng21620D                                          314   2e-100   Brassica napus [oilseed rape]
ref|XP_009406489.1|  PREDICTED: serine carboxypeptidase-like 42         313   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY80352.1|  hypothetical protein OsI_35523                          315   3e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_009112251.1|  PREDICTED: serine carboxypeptidase-like 42         312   6e-100   Brassica rapa
ref|XP_006858474.1|  hypothetical protein AMTR_s00071p00113850          312   7e-100   Amborella trichopoda
ref|XP_009107654.1|  PREDICTED: serine carboxypeptidase-like 44 i...    309   1e-99    Brassica rapa
gb|KHN23425.1|  Serine carboxypeptidase-like 42                         311   1e-99    Glycine soja [wild soybean]
ref|XP_010493597.1|  PREDICTED: serine carboxypeptidase-like 42         310   2e-99    Camelina sativa [gold-of-pleasure]
gb|ACR37620.1|  unknown                                                 305   2e-99    Zea mays [maize]
ref|XP_009107653.1|  PREDICTED: serine carboxypeptidase-like 44 i...    309   4e-99    Brassica rapa
ref|XP_009107652.1|  PREDICTED: serine carboxypeptidase-like 44 i...    309   4e-99    
emb|CDX80725.1|  BnaC08g05590D                                          310   6e-99    
emb|CDY48945.1|  BnaA08g04690D                                          310   6e-99    Brassica napus [oilseed rape]
ref|XP_009107650.1|  PREDICTED: serine carboxypeptidase-like 44 i...    309   7e-99    Brassica rapa
ref|XP_006663298.1|  PREDICTED: serine carboxypeptidase-like 42-like    310   8e-99    
ref|XP_009107648.1|  PREDICTED: serine carboxypeptidase-like 44 i...    309   9e-99    Brassica rapa
gb|KFK24266.1|  hypothetical protein AALP_AAs40498U001000               308   2e-98    Arabis alpina [alpine rockcress]
gb|ACM17527.1|  putative serine carboxy peptidase                       307   5e-98    Oryza australiensis
ref|XP_009123167.1|  PREDICTED: serine carboxypeptidase-like 42         307   6e-98    Brassica rapa
ref|XP_002449388.1|  hypothetical protein SORBIDRAFT_05g009120          306   1e-97    Sorghum bicolor [broomcorn]
ref|NP_001183841.1|  hypothetical protein precursor                     306   2e-97    Zea mays [maize]
ref|XP_006351861.1|  PREDICTED: serine carboxypeptidase-like 42-like    305   4e-97    Solanum tuberosum [potatoes]
ref|XP_010468548.1|  PREDICTED: serine carboxypeptidase-like 43         304   6e-97    
gb|AFW60600.1|  serine carboxypeptidase F13S12.6                        304   9e-97    
ref|XP_006299245.1|  hypothetical protein CARUB_v10015394mg             303   9e-97    
ref|NP_001151858.1|  serine carboxypeptidase F13S12.6 precursor         304   1e-96    Zea mays [maize]
ref|XP_004979109.1|  PREDICTED: serine carboxypeptidase-like 42-like    304   1e-96    Setaria italica
gb|AAD28662.1|  putative serine carboxypeptidase II                     303   1e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279617.1|  hypothetical protein CARUB_v10026338mg             303   2e-96    Capsella rubella
ref|XP_006307408.1|  hypothetical protein CARUB_v10009034mg             302   3e-96    
ref|XP_010239229.1|  PREDICTED: serine carboxypeptidase-like 42         299   3e-96    
ref|XP_009586680.1|  PREDICTED: serine carboxypeptidase-like 42         302   4e-96    Nicotiana tomentosiformis
gb|EPS65711.1|  hypothetical protein M569_09067                         291   4e-96    Genlisea aurea
ref|XP_010463193.1|  PREDICTED: serine carboxypeptidase-like 44         300   7e-96    Camelina sativa [gold-of-pleasure]
emb|CDY23340.1|  BnaA08g12060D                                          301   8e-96    Brassica napus [oilseed rape]
ref|XP_003602149.1|  Serine carboxypeptidase-like protein               301   9e-96    Medicago truncatula
ref|XP_010479023.1|  PREDICTED: serine carboxypeptidase-like 44         301   9e-96    Camelina sativa [gold-of-pleasure]
gb|KEH35413.1|  serine carboxypeptidase-like protein                    301   1e-95    Medicago truncatula
ref|XP_010315077.1|  PREDICTED: serine carboxypeptidase-like 42 i...    301   1e-95    Solanum lycopersicum
ref|XP_006393769.1|  hypothetical protein EUTSA_v10011445mg             301   1e-95    Eutrema salsugineum [saltwater cress]
gb|EMS56738.1|  Serine carboxypeptidase-like 42                         299   2e-95    Triticum urartu
ref|XP_009767155.1|  PREDICTED: serine carboxypeptidase-like 42 i...    300   3e-95    Nicotiana sylvestris
ref|NP_175046.1|  serine carboxypeptidase-like 44                       300   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004230572.1|  PREDICTED: serine carboxypeptidase-like 42 i...    299   1e-94    Solanum lycopersicum
ref|XP_002863806.1|  hypothetical protein ARALYDRAFT_331179             298   1e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_004502581.1|  PREDICTED: serine carboxypeptidase-like 42-like    298   2e-94    Cicer arietinum [garbanzo]
ref|XP_002891272.1|  predicted protein                                  298   3e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_002862434.1|  hypothetical protein ARALYDRAFT_497456             296   4e-94    
gb|EMT33269.1|  Serine carboxypeptidase-like 42                         297   4e-94    
gb|ACR37535.1|  unknown                                                 287   5e-94    Zea mays [maize]
ref|XP_002865553.1|  hypothetical protein ARALYDRAFT_494807             297   6e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_010110480.1|  Serine carboxypeptidase-like 42                    290   1e-91    
gb|EMS54298.1|  Serine carboxypeptidase-like 42                         287   4e-91    Triticum urartu
ref|NP_199038.1|  serine carboxypeptidase-like 41                       288   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004515138.1|  PREDICTED: serine carboxypeptidase-like 42-like    285   2e-89    Cicer arietinum [garbanzo]
gb|AFK38452.1|  unknown                                                 272   1e-88    Lotus japonicus
ref|XP_007019399.1|  Serine carboxypeptidase-like 42 isoform 3          280   6e-88    
emb|CAN74668.1|  hypothetical protein VITISV_005686                     273   8e-85    Vitis vinifera
gb|KGN47484.1|  hypothetical protein Csa_6G338160                       281   2e-84    Cucumis sativus [cucumbers]
ref|XP_009767156.1|  PREDICTED: serine carboxypeptidase-like 42 i...    270   8e-84    Nicotiana sylvestris
emb|CDX93108.1|  BnaA03g38300D                                          268   3e-83    
emb|CDY70042.1|  BnaCnng66490D                                          266   2e-82    Brassica napus [oilseed rape]
gb|ABK25236.1|  unknown                                                 266   3e-82    Picea sitchensis
emb|CDX81435.1|  BnaC09g08460D                                          261   7e-81    
ref|NP_178937.2|  serine carboxypeptidase-like 43                       248   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|KDO83620.1|  hypothetical protein CISIN_1g0117641mg                  238   6e-75    Citrus sinensis [apfelsine]
ref|XP_002885858.1|  predicted protein                                  246   1e-74    
ref|NP_001031351.1|  serine carboxypeptidase-like 43                    244   9e-74    Arabidopsis thaliana [mouse-ear cress]
gb|KDO83619.1|  hypothetical protein CISIN_1g0117641mg                  236   7e-73    Citrus sinensis [apfelsine]
gb|KDO83617.1|  hypothetical protein CISIN_1g0117641mg                  236   1e-72    Citrus sinensis [apfelsine]
ref|XP_006434389.1|  hypothetical protein CICLE_v10000998mg             239   2e-72    
gb|KDO83614.1|  hypothetical protein CISIN_1g0117641mg                  235   9e-71    Citrus sinensis [apfelsine]
ref|XP_002990798.1|  serine carboxypeptidase-like enzyme                226   7e-67    
ref|XP_002974500.1|  serine carboxypeptidase-like enzyme                226   7e-67    
emb|CDY51660.1|  BnaC03g66990D                                          220   1e-64    Brassica napus [oilseed rape]
emb|CDY37202.1|  BnaA09g08230D                                          220   1e-64    Brassica napus [oilseed rape]
ref|XP_002967656.1|  serine carboxypeptidase-like enzyme                218   8e-64    Selaginella moellendorffii
ref|XP_002964377.1|  serine carboxypeptidase-like enzyme                216   1e-62    Selaginella moellendorffii
gb|KDO83616.1|  hypothetical protein CISIN_1g0117641mg                  202   3e-60    Citrus sinensis [apfelsine]
gb|KDO83613.1|  hypothetical protein CISIN_1g0117641mg                  206   6e-60    Citrus sinensis [apfelsine]
ref|XP_002961948.1|  serine carboxypeptidase-like enzyme                204   3e-58    
ref|XP_002971138.1|  serine carboxypeptidase-like enzyme                204   3e-58    
ref|XP_002972012.1|  serine carboxypeptidase-like enzyme                194   1e-54    Selaginella moellendorffii
ref|XP_008798399.1|  PREDICTED: serine carboxypeptidase-like 42         191   2e-54    
ref|XP_002972549.1|  serine carboxypeptidase-like enzyme                191   1e-53    
ref|XP_006830556.1|  hypothetical protein AMTR_s00117p00106310          190   7e-53    
gb|EMT31513.1|  Serine carboxypeptidase-like 42                         186   5e-52    
ref|XP_010413849.1|  PREDICTED: serine carboxypeptidase-like 46         182   6e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010469459.1|  PREDICTED: serine carboxypeptidase-like 46         180   3e-49    Camelina sativa [gold-of-pleasure]
ref|XP_009415855.1|  PREDICTED: serine carboxypeptidase-like 45         180   3e-49    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223032.1|  hypothetical protein PRUPE_ppa005360mg             179   5e-49    Prunus persica
ref|XP_008222371.1|  PREDICTED: serine carboxypeptidase-like 45 i...    179   7e-49    Prunus mume [ume]
gb|KJB31552.1|  hypothetical protein B456_005G196500                    174   3e-48    Gossypium raimondii
ref|XP_007223033.1|  hypothetical protein PRUPE_ppa005360mg             177   4e-48    Prunus persica
ref|XP_009378815.1|  PREDICTED: serine carboxypeptidase-like 45         177   4e-48    Pyrus x bretschneideri [bai li]
ref|XP_008222370.1|  PREDICTED: serine carboxypeptidase-like 45 i...    177   5e-48    Prunus mume [ume]
ref|XP_010509871.1|  PREDICTED: serine carboxypeptidase-like 46         177   5e-48    Camelina sativa [gold-of-pleasure]
ref|XP_009380118.1|  PREDICTED: serine carboxypeptidase-like 45 i...    176   6e-48    
ref|XP_002268172.1|  PREDICTED: serine carboxypeptidase-like 45         176   7e-48    Vitis vinifera
ref|XP_009359890.1|  PREDICTED: serine carboxypeptidase-like 45         176   8e-48    Pyrus x bretschneideri [bai li]
ref|XP_009380117.1|  PREDICTED: serine carboxypeptidase-like 45 i...    176   9e-48    
ref|XP_008390188.1|  PREDICTED: serine carboxypeptidase-like 45         176   1e-47    
ref|XP_010929656.1|  PREDICTED: serine carboxypeptidase-like 45         175   2e-47    Elaeis guineensis
ref|NP_850212.1|  serine carboxypeptidase-like 46                       175   2e-47    Arabidopsis thaliana [mouse-ear cress]
gb|KDP23272.1|  hypothetical protein JCGZ_23105                         175   2e-47    Jatropha curcas
ref|XP_002304645.2|  hypothetical protein POPTR_0003s16250g             172   3e-47    
ref|XP_008777393.1|  PREDICTED: serine carboxypeptidase-like 45 i...    174   4e-47    Phoenix dactylifera
ref|XP_006438865.1|  hypothetical protein CICLE_v10031451mg             169   4e-47    
ref|XP_009404114.1|  PREDICTED: serine carboxypeptidase-like 45         174   5e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007038110.1|  Serine carboxypeptidase-like 45 isoform 1          174   6e-47    
ref|XP_006294161.1|  hypothetical protein CARUB_v10023154mg             174   6e-47    Capsella rubella
ref|XP_008777392.1|  PREDICTED: serine carboxypeptidase-like 45 i...    174   7e-47    Phoenix dactylifera
ref|XP_002881286.1|  hypothetical protein ARALYDRAFT_482299             173   7e-47    
ref|XP_010682654.1|  PREDICTED: serine carboxypeptidase-like 45         174   8e-47    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006410496.1|  hypothetical protein EUTSA_v10016623mg             173   9e-47    Eutrema salsugineum [saltwater cress]
ref|XP_011073181.1|  PREDICTED: serine carboxypeptidase-like 45         173   9e-47    Sesamum indicum [beniseed]
gb|KJB31548.1|  hypothetical protein B456_005G196500                    173   1e-46    Gossypium raimondii
gb|AFK49319.1|  unknown                                                 167   1e-46    Lotus japonicus
ref|XP_007139316.1|  hypothetical protein PHAVU_008G019100g             173   1e-46    Phaseolus vulgaris [French bean]
ref|XP_011020860.1|  PREDICTED: serine carboxypeptidase-like 45         173   1e-46    Populus euphratica
ref|XP_002297872.2|  serine carboxypeptidase S10 family protein         172   1e-46    
ref|XP_010044871.1|  PREDICTED: serine carboxypeptidase-like 45         172   2e-46    
ref|XP_002318164.2|  hypothetical protein POPTR_0012s10730g             172   2e-46    Populus trichocarpa [western balsam poplar]
gb|AAB80670.1|  putative serine carboxypeptidase II                     172   3e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036160.1|  PREDICTED: serine carboxypeptidase-like 45 i...    172   3e-46    Populus euphratica
gb|EPS74304.1|  hypothetical protein M569_00447                         168   3e-46    Genlisea aurea
ref|XP_003520486.1|  PREDICTED: serine carboxypeptidase-like 45-l...    172   3e-46    Glycine max [soybeans]
ref|XP_010942380.1|  PREDICTED: serine carboxypeptidase-like 45         172   3e-46    Elaeis guineensis
ref|XP_011036159.1|  PREDICTED: serine carboxypeptidase-like 45 i...    171   4e-46    Populus euphratica
emb|CDY66771.1|  BnaC02g44710D                                          162   4e-46    Brassica napus [oilseed rape]
ref|XP_006438863.1|  hypothetical protein CICLE_v10031451mg             169   5e-46    
ref|XP_006844530.1|  hypothetical protein AMTR_s00016p00162700          171   5e-46    
ref|XP_008369640.1|  PREDICTED: serine carboxypeptidase-like 45         171   5e-46    Malus domestica [apple tree]
ref|XP_010250555.1|  PREDICTED: serine carboxypeptidase-like 45         171   6e-46    Nelumbo nucifera [Indian lotus]
gb|KHN31265.1|  Serine carboxypeptidase-like 45                         171   7e-46    Glycine soja [wild soybean]
gb|KHN08898.1|  Serine carboxypeptidase-like 45                         171   8e-46    Glycine soja [wild soybean]
emb|CBI32794.3|  unnamed protein product                                171   8e-46    Vitis vinifera
ref|XP_006578724.1|  PREDICTED: serine carboxypeptidase-like 45-like    171   8e-46    Glycine max [soybeans]
gb|KFK44681.1|  hypothetical protein AALP_AA1G289600                    164   9e-46    Arabis alpina [alpine rockcress]
ref|XP_010100042.1|  Serine carboxypeptidase-like 45                    170   9e-46    
ref|XP_011042948.1|  PREDICTED: serine carboxypeptidase-like 45         171   9e-46    Populus euphratica
gb|KHN30340.1|  Serine carboxypeptidase-like 45                         170   1e-45    Glycine soja [wild soybean]
ref|XP_010653629.1|  PREDICTED: serine carboxypeptidase-like 45         170   1e-45    Vitis vinifera
ref|XP_003554110.2|  PREDICTED: serine carboxypeptidase-like 45-like    170   1e-45    
ref|XP_003521119.1|  PREDICTED: serine carboxypeptidase-like 45-like    170   1e-45    Glycine max [soybeans]
ref|XP_008392759.1|  PREDICTED: serine carboxypeptidase-like 45         167   1e-45    
ref|XP_003577529.1|  PREDICTED: serine carboxypeptidase-like 45         170   1e-45    Brachypodium distachyon [annual false brome]
ref|XP_004298533.1|  PREDICTED: serine carboxypeptidase-like 45         170   1e-45    Fragaria vesca subsp. vesca
emb|CDY19500.1|  BnaC04g10990D                                          170   1e-45    Brassica napus [oilseed rape]
ref|XP_007159976.1|  hypothetical protein PHAVU_002G282700g             167   2e-45    Phaseolus vulgaris [French bean]
ref|XP_002512656.1|  serine carboxypeptidase, putative                  169   3e-45    
gb|AFK47012.1|  unknown                                                 166   3e-45    Lotus japonicus
ref|XP_010239839.1|  PREDICTED: serine carboxypeptidase-like 45         169   3e-45    Brachypodium distachyon [annual false brome]
ref|XP_003551804.1|  PREDICTED: serine carboxypeptidase-like 45-like    169   3e-45    Glycine max [soybeans]
ref|XP_007209121.1|  hypothetical protein PRUPE_ppa005457mg             169   3e-45    
ref|XP_008357674.1|  PREDICTED: serine carboxypeptidase-like 45         167   4e-45    
gb|KJB40056.1|  hypothetical protein B456_007G044700                    169   4e-45    Gossypium raimondii
ref|XP_010249188.1|  PREDICTED: serine carboxypeptidase-like 45         169   4e-45    Nelumbo nucifera [Indian lotus]
ref|XP_006576775.1|  PREDICTED: serine carboxypeptidase-like 45-l...    168   4e-45    
gb|KHG09716.1|  Serine carboxypeptidase-like 45                         169   5e-45    Gossypium arboreum [tree cotton]
ref|XP_006585840.1|  PREDICTED: serine carboxypeptidase-like 45-l...    168   5e-45    Glycine max [soybeans]
gb|KHN47533.1|  Serine carboxypeptidase-like 45                         168   5e-45    Glycine soja [wild soybean]
ref|XP_002280796.2|  PREDICTED: serine carboxypeptidase-like 45         168   6e-45    Vitis vinifera
ref|XP_002511104.1|  serine carboxypeptidase, putative                  168   6e-45    Ricinus communis
ref|XP_006438864.1|  hypothetical protein CICLE_v10031451mg             168   6e-45    Citrus clementina [clementine]
ref|XP_003531913.1|  PREDICTED: serine carboxypeptidase-like 45-l...    168   7e-45    Glycine max [soybeans]
ref|XP_008239549.1|  PREDICTED: serine carboxypeptidase-like 45         168   7e-45    Prunus mume [ume]
gb|EEC68261.1|  hypothetical protein OsI_36290                          168   7e-45    Oryza sativa Indica Group [Indian rice]
ref|NP_001176565.1|  Os11g0522900                                       168   8e-45    
gb|KHN09723.1|  Serine carboxypeptidase-like 45                         168   8e-45    Glycine soja [wild soybean]
ref|XP_004310134.1|  PREDICTED: serine carboxypeptidase-like 45         168   8e-45    Fragaria vesca subsp. vesca
ref|XP_010322561.1|  PREDICTED: serine carboxypeptidase-like 46 i...    166   9e-45    
ref|XP_009355269.1|  PREDICTED: serine carboxypeptidase-like 45         167   1e-44    Pyrus x bretschneideri [bai li]
ref|XP_007043816.1|  Serine carboxypeptidase-like 45 isoform 1          167   1e-44    Theobroma cacao [chocolate]
ref|XP_009337518.1|  PREDICTED: serine carboxypeptidase-like 45         167   1e-44    Pyrus x bretschneideri [bai li]
gb|KCW90016.1|  hypothetical protein EUGRSUZ_A02215                     167   1e-44    Eucalyptus grandis [rose gum]
ref|XP_003630573.1|  Serine carboxypeptidase                            167   1e-44    Medicago truncatula
ref|XP_003528093.2|  PREDICTED: serine carboxypeptidase-like 45-like    167   1e-44    Glycine max [soybeans]
ref|XP_009143848.1|  PREDICTED: serine carboxypeptidase-like 46         167   2e-44    Brassica rapa
ref|XP_010023719.1|  PREDICTED: serine carboxypeptidase-like 45         167   2e-44    
gb|AIC80774.1|  serine carboxypeptidase                                 166   2e-44    Cicer arietinum [garbanzo]
ref|XP_010322533.1|  PREDICTED: serine carboxypeptidase-like 45 i...    167   2e-44    
ref|XP_009334311.1|  PREDICTED: serine carboxypeptidase-like 45         167   2e-44    
ref|XP_006304410.1|  hypothetical protein CARUB_v10010972mg             167   2e-44    Capsella rubella
ref|XP_004492026.1|  PREDICTED: serine carboxypeptidase-like 45-like    167   2e-44    Cicer arietinum [garbanzo]
ref|XP_009599118.1|  PREDICTED: serine carboxypeptidase-like 45         167   2e-44    Nicotiana tomentosiformis
ref|XP_003520484.1|  PREDICTED: serine carboxypeptidase-like 45-like    167   2e-44    Glycine max [soybeans]
gb|KHN30341.1|  Serine carboxypeptidase-like 45                         166   3e-44    Glycine soja [wild soybean]
emb|CBI32800.3|  unnamed protein product                                164   3e-44    Vitis vinifera
gb|KDP37690.1|  hypothetical protein JCGZ_06347                         167   3e-44    Jatropha curcas
ref|XP_010678341.1|  PREDICTED: serine carboxypeptidase-like 45         167   3e-44    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN13827.1|  Serine carboxypeptidase-like 45                         166   3e-44    Glycine soja [wild soybean]
gb|AES77859.2|  serine carboxypeptidase-like protein                    166   3e-44    Medicago truncatula
ref|XP_007159977.1|  hypothetical protein PHAVU_002G282700g             166   4e-44    Phaseolus vulgaris [French bean]
ref|XP_010549305.1|  PREDICTED: serine carboxypeptidase-like 45 i...    166   4e-44    Tarenaya hassleriana [spider flower]
ref|XP_008791046.1|  PREDICTED: serine carboxypeptidase-like 45         166   4e-44    Phoenix dactylifera
gb|ABK25202.1|  unknown                                                 166   4e-44    Picea sitchensis
gb|KEH35690.1|  serine carboxypeptidase-like protein                    166   4e-44    Medicago truncatula
ref|XP_004501743.1|  PREDICTED: serine carboxypeptidase-like 45-like    166   5e-44    Cicer arietinum [garbanzo]
ref|XP_004228838.1|  PREDICTED: serine carboxypeptidase-like 45 i...    166   5e-44    
ref|XP_007145476.1|  hypothetical protein PHAVU_007G242200g             166   5e-44    Phaseolus vulgaris [French bean]
ref|XP_010549304.1|  PREDICTED: serine carboxypeptidase-like 45 i...    166   5e-44    Tarenaya hassleriana [spider flower]
ref|XP_007162065.1|  hypothetical protein PHAVU_001G120700g             166   5e-44    Phaseolus vulgaris [French bean]
ref|XP_003621641.1|  Serine carboxypeptidase-like protein               166   5e-44    
ref|XP_009778790.1|  PREDICTED: serine carboxypeptidase-like 45         166   5e-44    Nicotiana sylvestris
ref|XP_006662960.1|  PREDICTED: serine carboxypeptidase-like 45-like    166   5e-44    Oryza brachyantha
gb|AFK47648.1|  unknown                                                 157   5e-44    
ref|XP_007137891.1|  hypothetical protein PHAVU_009G164600g             166   6e-44    
gb|KDO83622.1|  hypothetical protein CISIN_1g0117641mg                  164   6e-44    
gb|KHN08897.1|  Serine carboxypeptidase-like 45                         165   8e-44    
gb|KDO83181.1|  hypothetical protein CISIN_1g012396mg                   165   9e-44    
ref|XP_007162064.1|  hypothetical protein PHAVU_001G120600g             165   9e-44    
ref|NP_564298.1|  serine carboxypeptidase-like 45                       165   9e-44    
gb|AAG51475.1|AC069471_6  serine carboxypeptidase II, putative          165   1e-43    
ref|XP_006483005.1|  PREDICTED: serine carboxypeptidase-like 45-like    165   1e-43    
ref|XP_007159975.1|  hypothetical protein PHAVU_002G282700g             162   2e-43    
ref|XP_003554111.1|  PREDICTED: serine carboxypeptidase-like 45-like    164   2e-43    
ref|XP_011075459.1|  PREDICTED: serine carboxypeptidase-like 45         164   2e-43    
ref|XP_009113703.1|  PREDICTED: serine carboxypeptidase-like 45         164   2e-43    
gb|EMT30771.1|  Serine carboxypeptidase-like 45                         164   2e-43    
ref|XP_009355265.1|  PREDICTED: serine carboxypeptidase-like 45         164   2e-43    
ref|XP_010055744.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   3e-43    
ref|XP_011040386.1|  PREDICTED: serine carboxypeptidase-like 45         160   3e-43    
ref|XP_010055754.1|  PREDICTED: serine carboxypeptidase-like 45         164   3e-43    
ref|XP_010271867.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   3e-43    
ref|XP_009355272.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   3e-43    
ref|XP_010460580.1|  PREDICTED: serine carboxypeptidase-like 45         164   3e-43    
ref|XP_010271868.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   4e-43    
ref|XP_002893504.1|  SCPL45                                             163   4e-43    
ref|XP_006415698.1|  hypothetical protein EUTSA_v10007573mg             163   4e-43    
ref|XP_004235841.1|  PREDICTED: serine carboxypeptidase-like 45 i...    163   4e-43    
ref|XP_010271865.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   4e-43    
ref|XP_010271866.1|  PREDICTED: serine carboxypeptidase-like 45 i...    164   4e-43    
ref|XP_002517289.1|  serine carboxypeptidase, putative                  163   5e-43    
ref|XP_008454133.1|  PREDICTED: serine carboxypeptidase-like 45         163   5e-43    
ref|XP_010478165.1|  PREDICTED: serine carboxypeptidase-like 45         164   5e-43    
ref|XP_002282978.2|  PREDICTED: serine carboxypeptidase-like 45         163   5e-43    
ref|XP_004152156.1|  PREDICTED: serine carboxypeptidase-like 45-like    163   6e-43    
ref|XP_002307963.1|  hypothetical protein POPTR_0006s03490g             163   6e-43    
ref|XP_006363923.1|  PREDICTED: serine carboxypeptidase-like 45-like    163   6e-43    
gb|ACF83470.1|  unknown                                                 160   6e-43    
gb|EMS58238.1|  Serine carboxypeptidase-like 45                         162   6e-43    
ref|XP_007021534.1|  Serine carboxypeptidase 44                         163   6e-43    
gb|ACF83745.1|  unknown                                                 159   7e-43    
ref|XP_004241645.1|  PREDICTED: serine carboxypeptidase-like 45         162   8e-43    
ref|XP_004503800.1|  PREDICTED: serine carboxypeptidase-like 45-like    162   8e-43    
ref|XP_010271870.1|  PREDICTED: serine carboxypeptidase-like 45 i...    162   8e-43    
ref|XP_008374178.1|  PREDICTED: serine carboxypeptidase-like 45         162   8e-43    
gb|ACF83756.1|  unknown                                                 159   1e-42    
emb|CDY61693.1|  BnaC05g51120D                                          162   1e-42    
ref|XP_007021444.1|  Serine carboxypeptidase 44 isoform 2               162   1e-42    
ref|XP_003532390.1|  PREDICTED: serine carboxypeptidase-like 45-l...    162   1e-42    
ref|XP_007021443.1|  Serine carboxypeptidase 44 isoform 1               162   1e-42    
emb|CBI32795.3|  unnamed protein product                                162   1e-42    
gb|KDO53634.1|  hypothetical protein CISIN_1g0128612mg                  160   1e-42    
ref|XP_010673054.1|  PREDICTED: serine carboxypeptidase-like 45         162   1e-42    
ref|XP_002277400.2|  PREDICTED: serine carboxypeptidase-like 45         162   2e-42    
ref|XP_007021532.1|  Serine carboxypeptidase 44                         162   2e-42    
ref|XP_002449560.1|  hypothetical protein SORBIDRAFT_05g019090          162   2e-42    
ref|XP_010271869.1|  PREDICTED: serine carboxypeptidase-like 45 i...    162   2e-42    
ref|XP_010499305.1|  PREDICTED: serine carboxypeptidase-like 45         162   2e-42    
gb|KFK44682.1|  hypothetical protein AALP_AA1G289900                    161   2e-42    
ref|XP_006341487.1|  PREDICTED: serine carboxypeptidase-like 45-like    161   2e-42    
ref|XP_011040748.1|  PREDICTED: serine carboxypeptidase-like 45 i...    161   2e-42    
ref|XP_007159978.1|  hypothetical protein PHAVU_002G282700g             161   2e-42    
ref|XP_009355268.1|  PREDICTED: serine carboxypeptidase-like 45 i...    161   3e-42    
ref|XP_011040747.1|  PREDICTED: serine carboxypeptidase-like 45 i...    161   3e-42    
gb|ABR16719.1|  unknown                                                 161   3e-42    
gb|EYU21824.1|  hypothetical protein MIMGU_mgv1a006099mg                160   4e-42    
ref|XP_011002097.1|  PREDICTED: serine carboxypeptidase-like 45         160   4e-42    
ref|XP_006482059.1|  PREDICTED: serine carboxypeptidase-like 45-like    160   5e-42    
ref|XP_006430527.1|  hypothetical protein CICLE_v10011695mg             160   5e-42    
tpg|DAA38063.1|  TPA: hypothetical protein ZEAMMB73_252249              156   6e-42    
ref|XP_007021681.1|  Serine carboxypeptidase 44                         160   6e-42    
emb|CAN72076.1|  hypothetical protein VITISV_041583                     160   7e-42    
ref|XP_010099600.1|  Serine carboxypeptidase-like 45                    160   7e-42    
gb|EYU18606.1|  hypothetical protein MIMGU_mgv1a004861mg                160   8e-42    
emb|CBI32802.3|  unnamed protein product                                162   8e-42    
ref|XP_009368797.1|  PREDICTED: serine carboxypeptidase-like 45         160   9e-42    
ref|XP_007021448.1|  Serine carboxypeptidase 44                         160   9e-42    
ref|XP_009355267.1|  PREDICTED: serine carboxypeptidase-like 45 i...    160   9e-42    
ref|NP_001140326.1|  hypothetical protein                               155   1e-41    
ref|XP_007224935.1|  hypothetical protein PRUPE_ppa021576mg             159   1e-41    
emb|CDO98312.1|  unnamed protein product                                159   1e-41    
ref|XP_011086871.1|  PREDICTED: serine carboxypeptidase-like 45         158   3e-41    
tpg|DAA42024.1|  TPA: hypothetical protein ZEAMMB73_711830              154   3e-41    
ref|XP_003633850.1|  PREDICTED: serine carboxypeptidase-like 46         159   3e-41    
ref|XP_008240683.1|  PREDICTED: serine carboxypeptidase-like 45         158   4e-41    
ref|NP_001151474.1|  LOC100285107 precursor                             158   4e-41    
ref|XP_004975453.1|  PREDICTED: serine carboxypeptidase-like 45-like    159   4e-41    
emb|CDX90124.1|  BnaA08g18600D                                          157   5e-41    
ref|XP_009109757.1|  PREDICTED: serine carboxypeptidase-like 45         157   5e-41    
gb|KEH33274.1|  serine carboxypeptidase-like protein                    157   6e-41    
ref|XP_006584695.1|  PREDICTED: serine carboxypeptidase-like 45-l...    157   6e-41    
ref|XP_004979352.1|  PREDICTED: serine carboxypeptidase-like 45-like    157   7e-41    
ref|XP_007203526.1|  hypothetical protein PRUPE_ppa026347mg             157   7e-41    
ref|XP_006589008.1|  PREDICTED: serine carboxypeptidase-like 45-like    157   9e-41    
gb|ACN31969.1|  unknown                                                 154   9e-41    
gb|KGN63441.1|  hypothetical protein Csa_1G000650                       154   1e-40    
ref|XP_007028219.1|  Serine carboxypeptidase-like 45                    158   1e-40    
ref|XP_009759845.1|  PREDICTED: serine carboxypeptidase-like 45         156   1e-40    
ref|XP_004513403.1|  PREDICTED: serine carboxypeptidase-like 45-like    156   2e-40    
ref|XP_002446348.1|  hypothetical protein SORBIDRAFT_06g014580          156   2e-40    
ref|XP_007021535.1|  Serine carboxypeptidase 44                         153   5e-40    
emb|CDY11750.1|  BnaC03g58280D                                          155   5e-40    
ref|XP_006838780.1|  hypothetical protein AMTR_s00002p00258640          155   6e-40    
ref|XP_008218862.1|  PREDICTED: serine carboxypeptidase-like 45         155   7e-40    
ref|XP_008667418.1|  PREDICTED: hypothetical protein isoform X2         155   7e-40    
ref|XP_009627244.1|  PREDICTED: serine carboxypeptidase-like 46         155   7e-40    
ref|XP_009615672.1|  PREDICTED: serine carboxypeptidase-like 45 i...    154   9e-40    
gb|KHN07932.1|  Serine carboxypeptidase-like 45                         154   1e-39    
ref|NP_001150027.1|  serine carboxypeptidase K10B2.2 precursor          154   1e-39    
tpg|DAA38059.1|  TPA: hypothetical protein ZEAMMB73_252249              154   2e-39    
gb|AFW60601.1|  hypothetical protein ZEAMMB73_172356                    152   2e-39    
gb|KCW64996.1|  hypothetical protein EUGRSUZ_G02538                     153   3e-39    
ref|XP_010068798.1|  PREDICTED: serine carboxypeptidase-like 45         153   3e-39    
ref|XP_008378883.1|  PREDICTED: serine carboxypeptidase-like 45         153   3e-39    
ref|XP_008670742.1|  PREDICTED: serine carboxypeptidase-like 45         153   3e-39    
ref|XP_009762845.1|  PREDICTED: serine carboxypeptidase-like 45         152   5e-39    
ref|XP_009355270.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   7e-39    
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         147   8e-39    
ref|XP_009355271.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   8e-39    
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    150   1e-38    
ref|XP_002277201.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   1e-38    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         151   1e-38    
ref|XP_010661029.1|  PREDICTED: serine carboxypeptidase-like 45 i...    152   1e-38    
gb|EAY93940.1|  hypothetical protein OsI_15713                          151   1e-38    
emb|CBI22166.3|  unnamed protein product                                152   1e-38    
ref|XP_002527614.1|  serine carboxypeptidase, putative                  150   2e-38    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    150   3e-38    
ref|NP_001052663.1|  Os04g0396800                                       150   3e-38    
gb|KJB63053.1|  hypothetical protein B456_009G451300                    150   3e-38    
ref|XP_008667417.1|  PREDICTED: hypothetical protein isoform X1         150   3e-38    
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    150   4e-38    
ref|XP_010068797.1|  PREDICTED: serine carboxypeptidase-like 46         150   4e-38    
gb|KJB11409.1|  hypothetical protein B456_001G257100                    149   4e-38    
ref|XP_006363922.1|  PREDICTED: serine carboxypeptidase-like 45-like    150   4e-38    
gb|EYU28449.1|  hypothetical protein MIMGU_mgv1a004999mg                150   4e-38    
ref|XP_011040753.1|  PREDICTED: serine carboxypeptidase-like 45         150   4e-38    
ref|XP_009615670.1|  PREDICTED: serine carboxypeptidase-like 45 i...    150   4e-38    
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    150   4e-38    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             150   5e-38    
ref|XP_002307961.1|  hypothetical protein POPTR_0006s03440g             150   5e-38    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    150   5e-38    
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    149   6e-38    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         149   7e-38    
ref|XP_007043818.1|  Serine carboxypeptidase-like 45 isoform 3          149   7e-38    
gb|KJB35835.1|  hypothetical protein B456_006G130200                    146   1e-37    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    148   1e-37    
ref|XP_006363924.1|  PREDICTED: serine carboxypeptidase-like 45-like    149   1e-37    
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    148   1e-37    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    148   1e-37    
ref|XP_007028221.1|  Serine carboxypeptidase 45                         148   2e-37    
gb|KJB62616.1|  hypothetical protein B456_009G4260002                   144   2e-37    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    148   2e-37    
ref|XP_001751694.1|  predicted protein                                  148   2e-37    
ref|XP_011041403.1|  PREDICTED: serine carboxypeptidase-like 45         148   2e-37    
ref|XP_006652227.1|  PREDICTED: serine carboxypeptidase-like 45-like    147   2e-37    
ref|XP_004228389.1|  PREDICTED: serine carboxypeptidase-like 45         148   3e-37    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         147   3e-37    
ref|XP_002322611.2|  hypothetical protein POPTR_0016s03390g             147   4e-37    
ref|XP_007046208.1|  Serine carboxypeptidase 46 isoform 1               147   4e-37    
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         147   4e-37    
ref|XP_006373742.1|  hypothetical protein POPTR_0016s04660g             145   4e-37    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    147   4e-37    
emb|CBI21207.3|  unnamed protein product                                147   4e-37    
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             145   5e-37    
gb|KJB13335.1|  hypothetical protein B456_002G069000                    147   5e-37    
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         147   5e-37    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             147   5e-37    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         147   7e-37    
gb|KJB35837.1|  hypothetical protein B456_006G130200                    146   7e-37    
ref|XP_006431096.1|  hypothetical protein CICLE_v10013839mg             146   7e-37    
gb|KDO72509.1|  hypothetical protein CISIN_1g037032mg                   146   8e-37    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         146   8e-37    
gb|KJB62986.1|  hypothetical protein B456_009G446600                    145   8e-37    
ref|XP_007021451.1|  Serine carboxypeptidase 44                         145   9e-37    
ref|XP_007021438.1|  Serine carboxypeptidase 44                         146   1e-36    
gb|KJB35838.1|  hypothetical protein B456_006G130200                    145   1e-36    
gb|KJB35831.1|  hypothetical protein B456_006G130200                    146   1e-36    
gb|KHG30064.1|  Serine carboxypeptidase-like 45                         145   1e-36    
gb|KJB61590.1|  hypothetical protein B456_009G368500                    145   1e-36    
ref|XP_004136792.1|  PREDICTED: serine carboxypeptidase-like 45-like    145   2e-36    
gb|AES62618.2|  serine carboxypeptidase-like protein                    145   2e-36    
gb|KHG07552.1|  Serine carboxypeptidase-like 45                         145   2e-36    
ref|XP_003592367.1|  Serine carboxypeptidase-like protein               145   2e-36    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         145   3e-36    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         144   3e-36    
gb|KDP37687.1|  hypothetical protein JCGZ_06344                         145   3e-36    
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    144   3e-36    
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    145   3e-36    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    144   4e-36    
emb|CDP02317.1|  unnamed protein product                                144   4e-36    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         144   4e-36    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             144   4e-36    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    144   4e-36    
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         144   6e-36    
ref|XP_008443351.1|  PREDICTED: serine carboxypeptidase-like 45         144   6e-36    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         144   6e-36    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    144   6e-36    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    144   7e-36    
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             140   8e-36    
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         143   1e-35    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         143   1e-35    
gb|KEH40983.1|  serine carboxypeptidase-like protein                    142   1e-35    
ref|XP_010068795.1|  PREDICTED: serine carboxypeptidase-like 45         143   2e-35    
gb|KEH37845.1|  serine carboxypeptidase-like protein                    142   2e-35    
gb|KCW64994.1|  hypothetical protein EUGRSUZ_G02536                     142   2e-35    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         142   2e-35    
emb|CDP10248.1|  unnamed protein product                                142   2e-35    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         142   2e-35    
gb|KDO72510.1|  hypothetical protein CISIN_1g039529mg                   142   2e-35    
gb|EMS60816.1|  Serine carboxypeptidase-like 45                         142   2e-35    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                142   3e-35    
gb|KJB07561.1|  hypothetical protein B456_001G032600                    141   3e-35    
gb|KJB07564.1|  hypothetical protein B456_001G032600                    142   3e-35    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    142   3e-35    
gb|KJB07559.1|  hypothetical protein B456_001G032600                    142   3e-35    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    142   3e-35    
ref|XP_007021530.1|  Serine carboxypeptidase 44                         141   3e-35    
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  140   4e-35    
ref|XP_002321745.2|  hypothetical protein POPTR_0015s11610g             142   4e-35    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       141   4e-35    
gb|AAM65698.1|  putative serine carboxypeptidase II                     141   4e-35    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         141   4e-35    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         141   5e-35    
emb|CDY43258.1|  BnaC05g48510D                                          141   5e-35    



>ref|XP_006356286.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=472

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKISVGVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  283  VILDVCYPSIVEQELRLKKMATKISVGVDVCMTYERRFYFNLPEVQKALHANRTNLPYTW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y++TDGNI+ILPLLKRII NHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  343  SMCSNILKYSDTDGNINILPLLKRIIENHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQP+RALHLFSSF+RGRRL
Sbjct  403  FKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPARALHLFSSFIRGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  463  PNNTRPSIDD  472



>gb|EYU17411.1| hypothetical protein MIMGU_mgv1a005783mg [Erythranthe guttata]
Length=471

 Score =   359 bits (921),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPY W
Sbjct  282  VILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYSW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YNETDGN+D+LPLLKRII+N IPVWIFSGDQDSVVPLLGSRTLVRELAH+M 
Sbjct  342  SMCSGVLNYNETDGNLDMLPLLKRIIQNRIPVWIFSGDQDSVVPLLGSRTLVRELAHEMQ  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  402  FKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  461

Query  210  PNMTRPSIDD  181
            PN TRP+IDD
Sbjct  462  PNNTRPAIDD  471



>ref|XP_007161488.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
 gb|ESW33482.1| hypothetical protein PHAVU_001G0732000g, partial [Phaseolus vulgaris]
Length=291

 Score =   352 bits (902),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+++ATKISVGVDVCMS ERRFYFNLPEVQKALHANRT LPY W
Sbjct  102  VILDVCYPSIVEQELRLKRMATKISVGVDVCMSLERRFYFNLPEVQKALHANRTNLPYSW  161

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNI+ILP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  162  SMCSHVLNYSDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  221

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  222  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  281

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  282  PNTTRPSIDD  291



>ref|XP_004237734.1| PREDICTED: serine carboxypeptidase-like 42 [Solanum lycopersicum]
Length=472

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKISVGVDVCMSYERRFYFNLPEVQKALHANRT LPY W
Sbjct  283  VILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERRFYFNLPEVQKALHANRTNLPYTW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y++TDGNI+ILPLLKRII  HIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  343  SMCSNVLKYSDTDGNINILPLLKRIIEKHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQP+RALHLFSSF+RGRRL
Sbjct  403  FKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPARALHLFSSFIRGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  463  PNNTRPSIDD  472



>ref|XP_009600050.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=472

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATK+SVGVDVCMSYERRFYFNLPEVQKALHANRT L Y W
Sbjct  283  VILDVCYPSIVEQELRLRKMATKMSVGVDVCMSYERRFYFNLPEVQKALHANRTNLAYSW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++ DGNI+ILPLLKRII+NHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  343  SMCSGILNYSDVDGNINILPLLKRIIQNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSF+RGR+L
Sbjct  403  FKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRKL  462

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  463  PNNTRPSIDD  472



>ref|XP_009798650.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009798651.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=472

 Score =   356 bits (913),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATK+SVGVDVCMSYERRFYFNLPEVQKA HANRT L Y W
Sbjct  283  VILDVCYPSIVEQELRLRKMATKMSVGVDVCMSYERRFYFNLPEVQKAFHANRTNLAYSW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++ DGNI+ILPLLKRII+NHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  343  SMCSGILNYSDVDGNINILPLLKRIIQNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSF+RGRRL
Sbjct  403  FKITVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  463  PNNTRPSIDD  472



>ref|XP_010244030.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nelumbo 
nucifera]
Length=469

 Score =   355 bits (911),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRKLATKIS+GVDVCMSYERRFYFNLP VQ+ALHANRT LPYGW
Sbjct  280  VILDVCYPSIVEQELRLRKLATKISIGVDVCMSYERRFYFNLPRVQQALHANRTNLPYGW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YNETDGNI ILPLLKRII++HIPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  340  SMCSNILNYNETDGNISILPLLKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+VTVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  400  FEVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  459

Query  210  PNMTRPSIDD  181
            PN TRPSI D
Sbjct  460  PNTTRPSIYD  469



>ref|XP_010244029.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nelumbo 
nucifera]
Length=505

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRKLATKIS+GVDVCMSYERRFYFNLP VQ+ALHANRT LPYGW
Sbjct  316  VILDVCYPSIVEQELRLRKLATKISIGVDVCMSYERRFYFNLPRVQQALHANRTNLPYGW  375

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YNETDGNI ILPLLKRII++HIPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  376  SMCSNILNYNETDGNISILPLLKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  435

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+VTVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  436  FEVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  495

Query  210  PNMTRPSIDD  181
            PN TRPSI D
Sbjct  496  PNTTRPSIYD  505



>ref|XP_011074776.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=475

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVG+DVCMSYERRFYFNLPEVQKALHANRT LPY W
Sbjct  286  VILDVCYPSIVEQELRLRKMATKISVGIDVCMSYERRFYFNLPEVQKALHANRTNLPYRW  345

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+ETDGNID+LPLLKRI++NHIPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  346  TMCSSVLNYSETDGNIDMLPLLKRIVQNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDLN  405

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  406  FKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  465

Query  210  PNMTRPSIDD  181
            PN T P I D
Sbjct  466  PNTTHPPIYD  475



>ref|XP_011101717.1| PREDICTED: serine carboxypeptidase-like 42 [Sesamum indicum]
Length=469

 Score =   351 bits (901),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVGVDVCMS ER FYFNLPEVQKALHANRT LPY W
Sbjct  280  VILDVCYPSIVEQELRLRKMATKISVGVDVCMSSERHFYFNLPEVQKALHANRTNLPYSW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YNETDGNI+ILPLLKRI++  IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  340  SMCSEVLNYNETDGNINILPLLKRIVQKRIPVWIFSGDQDSVVPLLGSRTLVRELAHDLQ  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG +LTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  400  FKITVPYGAWFHKGQVGGWATEYGNMLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  459

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  460  PNNTRPSIDD  469



>ref|XP_010062160.1| PREDICTED: serine carboxypeptidase-like 42 [Eucalyptus grandis]
 gb|KCW69227.1| hypothetical protein EUGRSUZ_F02740 [Eucalyptus grandis]
Length=472

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPSIVEQELRLRK ATK+SVGVDVCM+YERRFY NLPEVQKALHANRT LPY W
Sbjct  283  VILDMCYPSIVEQELRLRKTATKLSVGVDVCMTYERRFYLNLPEVQKALHANRTNLPYPW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y++TDGNID+LPLLKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  343  SMCSGVVNYSDTDGNIDMLPLLKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHNLN  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FKVTVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  403  FKVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  463  PNTTRPSIDD  472



>ref|XP_006581614.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=414

 Score =   346 bits (887),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            +  DVCYPSIVEQELRL+K+ATKIS+GVDVCM+YER FYFNLPEVQKALHANRT LPY W
Sbjct  225  VIFDVCYPSIVEQELRLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQW  284

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILP+LK+I++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  285  SMCSGVLNYSDTDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  344

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  345  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  404

Query  210  PNMTRPSIDD  181
            PN T PSIDD
Sbjct  405  PNTTSPSIDD  414



>ref|XP_004173353.1| PREDICTED: serine carboxypeptidase-like 42-like, partial [Cucumis 
sativus]
Length=393

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+KLATKIS+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  204  VLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEW  263

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L YN  D NI++LPLL+RI+RNHIP+WI+SGD+DSVVPLLGSRTLVRELAHD+ 
Sbjct  264  SMCSDTLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDSVVPLLGSRTLVRELAHDLK  323

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             KVTVPYGAWFH+ QVGGWA EYG  LTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL
Sbjct  324  LKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  383

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  384  PNSTRPSIDD  393



>ref|XP_010664883.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Vitis 
vinifera]
Length=400

 Score =   344 bits (882),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLR++ATK+SVG+DVCM+YER FYFNLPEVQKALHANRT L Y W
Sbjct  211  VILDVCYPAIVEQELRLRRMATKMSVGIDVCMTYERSFYFNLPEVQKALHANRTGLNYRW  270

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+ETDGNIDILPLLKRI++N IPVW+FSGDQDSVVPLLGSRTL+RELA +M 
Sbjct  271  TMCSGVLNYSETDGNIDILPLLKRIVQNSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMK  330

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVP+GAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  331  FKITVPFGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  390

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  391  PNTTRPSIDD  400



>ref|XP_004290564.1| PREDICTED: serine carboxypeptidase-like 42 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   346 bits (887),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK ATKISVGVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  278  VILDVCYPSIVEQELRLRKTATKISVGVDVCMTYERRFYFNLPEVQKALHANRTNLPYSW  337

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN+++LPLL RI++NHIP+W+FSGD+DSVVPLLGSRTL+RELAHD+ 
Sbjct  338  SMCSNVLNYSDTDGNLNMLPLLARIVKNHIPLWVFSGDEDSVVPLLGSRTLIRELAHDLK  397

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVR RRL
Sbjct  398  FKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRNRRL  457

Query  210  PNMTRPSIDD  181
            PN TRP ID+
Sbjct  458  PNTTRPPIDE  467



>ref|XP_004490638.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Cicer 
arietinum]
Length=476

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKIS+GVDVCMSYERRFYFNLPEVQKALHANRT LPY W
Sbjct  287  VILDVCYPSIVEQELRLKKMATKISIGVDVCMSYERRFYFNLPEVQKALHANRTNLPYPW  346

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI++LP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  347  SMCSGVLNYSDTDPNINMLPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  406

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  407  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRL  466

Query  210  PNMTRPSIDD  181
            PN TRPSID+
Sbjct  467  PNTTRPSIDE  476



>ref|XP_010245825.1| PREDICTED: serine carboxypeptidase-like 42 [Nelumbo nucifera]
Length=470

 Score =   345 bits (886),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRKLATKIS+GVDVCMSYERRFYFNLP VQ+ALHANRTKLPY W
Sbjct  281  VILDVCYPSIVEQELRLRKLATKISIGVDVCMSYERRFYFNLPSVQQALHANRTKLPYSW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+ TDGNI+ILP+LKRII++HIPVW+FSGDQDSVVPLLGSRTLVRELA D+ 
Sbjct  341  TMCSDLLNYSGTDGNINILPILKRIIKHHIPVWVFSGDQDSVVPLLGSRTLVRELARDLN  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FKVTVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSF+RGRRL
Sbjct  401  FKVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRL  460

Query  210  PNMTRPSIDD  181
            PN T PSI D
Sbjct  461  PNTTHPSILD  470



>ref|XP_003615811.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES98769.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKISVGVDVCMSYER+FYFNLPEVQKALHANRT LPY W
Sbjct  281  VILDVCYPSIVEQELRLKKMATKISVGVDVCMSYERKFYFNLPEVQKALHANRTNLPYSW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI++LP+LKRI++NHIPVWIFSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  341  SMCSGVLNYSDTDPNINMLPILKRIVQNHIPVWIFSGDQDSVVPLLGSRTLIRELADDLK  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FKVTVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFS+FV GRRL
Sbjct  401  FKVTVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSNFVNGRRL  460

Query  210  PNMTRPSID  184
            PN TRPSI+
Sbjct  461  PNTTRPSIE  469



>ref|XP_003527966.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
Length=473

 Score =   344 bits (882),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            +  DVCYPSIVEQELRL+K+ATKIS+GVDVCM+YER FYFNLPEVQKALHANRT LPY W
Sbjct  284  VIFDVCYPSIVEQELRLKKIATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILP+LK+I++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  344  SMCSGVLNYSDTDPNIDILPILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  404  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  463

Query  210  PNMTRPSIDD  181
            PN T PSIDD
Sbjct  464  PNTTSPSIDD  473



>ref|XP_007019398.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
 gb|EOY16623.1| Serine carboxypeptidase-like 42 isoform 2 [Theobroma cacao]
Length=433

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKIS+GVDVCM+YERRFY NLPEVQ ALHANRTKLPY W
Sbjct  244  VLLDVCYPSIVEQELRLRKMATKISLGVDVCMTYERRFYLNLPEVQMALHANRTKLPYPW  303

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  + Y++TDGNIDILP+LK+II+N IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  304  SMCSGQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  363

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  364  FKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  423

Query  210  PNMTRPSIDD  181
            PN TRPS+++
Sbjct  424  PNNTRPSVNE  433



>ref|XP_002278193.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Vitis 
vinifera]
 emb|CBI19968.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLR++ATK+SVG+DVCM+YER FYFNLPEVQKALHANRT L Y W
Sbjct  278  VILDVCYPAIVEQELRLRRMATKMSVGIDVCMTYERSFYFNLPEVQKALHANRTGLNYRW  337

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+ETDGNIDILPLLKRI++N IPVW+FSGDQDSVVPLLGSRTL+RELA +M 
Sbjct  338  TMCSGVLNYSETDGNIDILPLLKRIVQNSIPVWVFSGDQDSVVPLLGSRTLIRELAQEMK  397

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVP+GAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  398  FKITVPFGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  457

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  458  PNTTRPSIDD  467



>ref|XP_004148827.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=480

 Score =   343 bits (879),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+KLATKIS+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  291  VLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEW  350

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L YN  D NI++LPLL+RI+RNHIP+WI+SGD+DSVVPLLGSRTLVRELAHD+ 
Sbjct  351  SMCSDTLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDSVVPLLGSRTLVRELAHDLK  410

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             KVTVPYGAWFH+ QVGGWA EYG  LTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL
Sbjct  411  LKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  470

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  471  PNSTRPSIDD  480



>ref|XP_006578942.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=454

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKIS+GVDVCM+YER FYFNLPEVQKALHANRT LPY W
Sbjct  265  VILDVCYPSIVEQELRLKKMATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQW  324

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILP+LK+I++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  325  SMCSGVLNYSDTDPNIDILPVLKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  384

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV  +RL
Sbjct  385  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVLRKRL  444

Query  210  PNMTRPSIDD  181
            PN T PSIDD
Sbjct  445  PNTTHPSIDD  454



>ref|XP_002300939.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE80212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=480

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK+ATKISVGVDVCM+YERRFYFNLPEVQKALHANRTKLPY W
Sbjct  291  VILDVCYPSIVNQELRLRKMATKISVGVDVCMTYERRFYFNLPEVQKALHANRTKLPYPW  350

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNIDILP+LK+II+NHIPVW+FSGDQDSVVPLLGSRTLV+ELA D+ 
Sbjct  351  SMCSDVLNYSDTDGNIDILPILKKIIQNHIPVWVFSGDQDSVVPLLGSRTLVKELAQDLN  410

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGWATEYG LLTFATVR A+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  411  FKITVPYGTWFHKGQVGGWATEYGNLLTFATVRSAAHMVPYAQPSRALHLFSSFVRGRRL  470

Query  210  PNMTRPSIDD  181
            PN T   +DD
Sbjct  471  PNTTDVRMDD  480



>ref|XP_007019397.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
 gb|EOY16622.1| Serine carboxypeptidase-like 42 isoform 1 [Theobroma cacao]
Length=473

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKIS+GVDVCM+YERRFY NLPEVQ ALHANRTKLPY W
Sbjct  284  VLLDVCYPSIVEQELRLRKMATKISLGVDVCMTYERRFYLNLPEVQMALHANRTKLPYPW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  + Y++TDGNIDILP+LK+II+N IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  344  SMCSGQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  404  FKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  463

Query  210  PNMTRPSIDD  181
            PN TRPS+++
Sbjct  464  PNNTRPSVNE  473



>ref|XP_008441654.1| PREDICTED: serine carboxypeptidase-like 42 [Cucumis melo]
Length=408

 Score =   338 bits (868),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+KLATKIS+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  219  VLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEW  278

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L YN  D NI++LPLL+RI++NHIP+WIFSGD+DSVVPLLGSRTLVRELA D+ 
Sbjct  279  SMCSDTLDYNYNDTNINMLPLLQRIVQNHIPLWIFSGDEDSVVPLLGSRTLVRELALDLK  338

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             KVTVPYGAWFH+ QVGGWA EYG  LTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL
Sbjct  339  LKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  398

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  399  PNSTRPSIDD  408



>ref|XP_006596272.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Glycine 
max]
Length=456

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCY SI+EQELRL+++ATKISV VDVCM+ ERRFYFNLPEVQKALHANRT LPY W
Sbjct  267  VILDVCYTSIMEQELRLKRMATKISVSVDVCMTLERRFYFNLPEVQKALHANRTNLPYSW  326

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y +TDGNI+ILP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  327  SMCSHVLNYRDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  386

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  387  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  446

Query  210  PNMTRPSIDD  181
            PN TRPSID+
Sbjct  447  PNTTRPSIDE  456



>ref|XP_003544740.2| PREDICTED: serine carboxypeptidase-like 42-like isoformX1 [Glycine 
max]
Length=487

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCY SI+EQELRL+++ATKISV VDVCM+ ERRFYFNLPEVQKALHANRT LPY W
Sbjct  298  VILDVCYTSIMEQELRLKRMATKISVSVDVCMTLERRFYFNLPEVQKALHANRTNLPYSW  357

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y +TDGNI+ILP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  358  SMCSHVLNYRDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  417

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  418  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  477

Query  210  PNMTRPSIDD  181
            PN TRPSID+
Sbjct  478  PNTTRPSIDE  487



>ref|XP_003522555.2| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Glycine 
max]
 gb|KHN44256.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=473

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKIS+GVDVCM+YER FYFNLPEVQKALHANRT LPY W
Sbjct  284  VILDVCYPSIVEQELRLKKMATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILP+LK+I++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  344  SMCSGVLNYSDTDPNIDILPVLKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV  +RL
Sbjct  404  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVLRKRL  463

Query  210  PNMTRPSIDD  181
            PN T PSIDD
Sbjct  464  PNTTHPSIDD  473



>ref|XP_011027377.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
42 [Populus euphratica]
Length=480

 Score =   339 bits (870),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK+AT+ISVGVDVCM+YERRFYFNLPEVQKALHANRTKLPY W
Sbjct  291  VILDVCYPSIVNQELRLRKMATRISVGVDVCMTYERRFYFNLPEVQKALHANRTKLPYPW  350

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++ DGNIDILP+LK+II+NHIPVW+FSGDQDSVVPLLGSRTLV+ELA D+ 
Sbjct  351  SMCSDVLNYSDIDGNIDILPILKKIIQNHIPVWVFSGDQDSVVPLLGSRTLVKELAQDLN  410

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGWATEYG LLTFATVR A+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  411  FKITVPYGTWFHKGQVGGWATEYGNLLTFATVRAAAHMVPYAQPSRALHLFSSFVRGRRL  470

Query  210  PNMTRPSIDD  181
            PN T   +DD
Sbjct  471  PNTTHVPMDD  480



>gb|KDP43043.1| hypothetical protein JCGZ_25229 [Jatropha curcas]
Length=491

 Score =   339 bits (870),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRLRKLATK+SVGVDVCM+YER FYFNLP VQKALHANRT LPY W
Sbjct  302  VILDVCYPSIVQQELRLRKLATKLSVGVDVCMTYERAFYFNLPAVQKALHANRTNLPYRW  361

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L Y++TDGN DILP+LK+II+N IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  362  TMCSSVLDYSDTDGNEDILPILKKIIQNDIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  421

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  422  FKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  481

Query  210  PNMTRPSIDD  181
            PN T  SIDD
Sbjct  482  PNRTHISIDD  491



>gb|KHN05260.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=474

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCY SI+EQELRL+++ATKISV VDVC++ ERRFYFNLPEVQKALHANRT LPY W
Sbjct  285  VILDVCYTSIMEQELRLKRMATKISVSVDVCITLERRFYFNLPEVQKALHANRTNLPYSW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y +TDGNI+ILP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  345  SMCSHVLNYRDTDGNINILPILKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELQ  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  405  FKITVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  464

Query  210  PNMTRPSIDD  181
            PN TRPSID+
Sbjct  465  PNTTRPSIDE  474



>ref|XP_009360732.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   338 bits (867),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVGVDVCM++ERRFY NLPEVQK LHANRT LPY W
Sbjct  284  VILDVCYPSIVEQELRLRKMATKISVGVDVCMTFERRFYLNLPEVQKVLHANRTNLPYPW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCSR L+Y++TDG+I+ILPLL RI++N IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  344  SMCSRVLNYSDTDGSINILPLLTRIVQNRIPVWVFSGDQDSVVPLLGSRTLVRELAHDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFS+FVRGRRL
Sbjct  404  FPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSAFVRGRRL  463

Query  210  PNMTRPSIDD  181
            PN   PSID+
Sbjct  464  PNTAHPSIDE  473



>ref|XP_008373913.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=473

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVGVDVCM+YER FY NLPEVQKALHANRT LPY W
Sbjct  284  VILDVCYPSIVEQELRLRKMATKISVGVDVCMTYERSFYLNLPEVQKALHANRTNLPYTW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILPLL RI++NHIPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  344  SMCSGVLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAXDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  404  FPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  463

Query  210  PNMTRPSIDD  181
            PN TRP ID+
Sbjct  464  PNTTRPPIDE  473



>ref|XP_006280410.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
 gb|EOA13308.1| hypothetical protein CARUB_v10026343mg [Capsella rubella]
Length=471

 Score =   337 bits (865),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QEL+L+K+ATK+S+GVDVCMSYERRFYFNLPEVQ ALHANRT LPY W
Sbjct  282  VLLDVCYPSIVQQELKLKKMATKMSLGVDVCMSYERRFYFNLPEVQIALHANRTHLPYDW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNID+LP+LKRII N IPVWIFSGDQDSVVP LGSRTLVRELA D+ 
Sbjct  342  SMCSSLLNYSDTDGNIDMLPILKRIIHNKIPVWIFSGDQDSVVPFLGSRTLVRELAQDLN  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+KQVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  402  FKTTVPYGAWFHKKQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVNGRRL  461

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  462  PNQTHSSTDE  471



>ref|XP_010530237.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=474

 Score =   337 bits (864),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 178/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQ ALHANRT+LPY W
Sbjct  285  VLLDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERRFYFNLPEVQAALHANRTRLPYPW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCSR L+Y++TDGN+++LP+LKRI++N I VWIFSGDQDSVVPLLGSRTLVRELAH++G
Sbjct  345  SMCSRHLNYSDTDGNLNMLPILKRILQNKIRVWIFSGDQDSVVPLLGSRTLVRELAHELG  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFHR QVGGWATEYG +LTFATVRGA+HMVP+AQPSRALHLFS+FV GRRL
Sbjct  405  FKITVPYGAWFHRGQVGGWATEYGNILTFATVRGAAHMVPYAQPSRALHLFSNFVSGRRL  464

Query  210  PNMTRPSID  184
            PN TR S+D
Sbjct  465  PNTTRHSVD  473



>ref|XP_008461496.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Cucumis 
melo]
Length=441

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+A+KIS+GVDVCM+ ER+FYFNLPEVQKALHANRTKLPY W
Sbjct  252  VILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLPEVQKALHANRTKLPYRW  311

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y++TDGNI+ILPLLKRII   IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  312  SMCSPVINYSDTDGNINILPLLKRIIELRIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  371

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  372  FKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRL  431

Query  210  PNMTRPSIDD  181
            PN TRPSI+D
Sbjct  432  PNSTRPSIED  441



>ref|XP_007137531.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
 gb|ESW09525.1| hypothetical protein PHAVU_009G134900g [Phaseolus vulgaris]
Length=472

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATKIS+GVDVCM+YE  FY NLPEVQKALHANRT LPY W
Sbjct  284  VILDVCYPSIVEQELRLKKMATKISIGVDVCMNYENGFYLNLPEVQKALHANRTNLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILP+LKRI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAH++ 
Sbjct  344  SMCSGVLNYSDTDPNIDILPVLKRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHELK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVPFAQPSRAL LFSSFVRG RL
Sbjct  404  FKITVPYGAWFHQGQVGGWVTEYGNLLTFATVRGAAHMVPFAQPSRALRLFSSFVRGMRL  463

Query  210  PNMTRPSID  184
            PN TRPSID
Sbjct  464  PNTTRPSID  472



>ref|XP_006434388.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47628.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=479

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+YER FY NLPEVQKALHANRT LPYGW
Sbjct  290  VILDVCYPAIVEQELRLRKMATKMSVGVDVCMTYERFFYLNLPEVQKALHANRTNLPYGW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCSR L+Y++ D NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  350  SMCSRVLNYSDADSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+VTVPYGAWFH++QVGGWATEYG +LTF TVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  410  FEVTVPYGAWFHKQQVGGWATEYGNILTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRL  469

Query  210  PNMTRPSIDD  181
            PN TRP+I D
Sbjct  470  PNNTRPAIQD  479



>ref|XP_008461495.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Cucumis 
melo]
Length=472

 Score =   335 bits (860),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+A+KIS+GVDVCM+ ER+FYFNLPEVQKALHANRTKLPY W
Sbjct  283  VILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLPEVQKALHANRTKLPYRW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y++TDGNI+ILPLLKRII   IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  343  SMCSPVINYSDTDGNINILPLLKRIIELRIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  403  FKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSI+D
Sbjct  463  PNSTRPSIED  472



>ref|XP_009377699.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=473

 Score =   335 bits (859),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK ATKISVGVDVCM+YER FYFNLPEVQKALHANRT LPY W
Sbjct  284  VILDVCYPSIVEQELRLRKKATKISVGVDVCMTYERSFYFNLPEVQKALHANRTNLPYTW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILPLL RI++NHIPVW+FSGDQDSVVP LGSRTL+RELAHD+ 
Sbjct  344  SMCSGVLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPFLGSRTLIRELAHDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QV GWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV G+RL
Sbjct  404  FPITVPYGAWFHKGQVAGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVLGQRL  463

Query  210  PNMTRPSID  184
            PN TRP ID
Sbjct  464  PNTTRPPID  472



>ref|XP_004167283.1| PREDICTED: serine carboxypeptidase-like 42-like [Cucumis sativus]
Length=377

 Score =   331 bits (849),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+A+KIS+GVDVCM+ ER+FYFNL EVQ+ALHANRTKLPY W
Sbjct  188  VILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLQEVQEALHANRTKLPYRW  247

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y++TDGNI+ILPL++RII   IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  248  SMCSSMINYSDTDGNINILPLIRRIIEFQIPVWVFSGDQDSVVPLLGSRTLVRELAHDLK  307

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  308  FKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRL  367

Query  210  PNMTRPSIDD  181
            PN TRPSI D
Sbjct  368  PNSTRPSIGD  377



>ref|XP_009377698.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=474

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQEL+LRK+ATKISVGVDVCM+YERRFY NLPEVQKALHANRT L Y W
Sbjct  285  VILDVCYPSIVEQELKLRKMATKISVGVDVCMTYERRFYLNLPEVQKALHANRTNLAYTW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILPLL RI++NHIPVW+FSGDQDSVVP LGSRTL+RELAHD+ 
Sbjct  345  SMCSGVLNYSDTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPFLGSRTLIRELAHDLK  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  405  FPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  464

Query  210  PNMTRPSI  187
            PN T PSI
Sbjct  465  PNTTLPSI  472



>ref|XP_008237677.1| PREDICTED: serine carboxypeptidase-like 42 [Prunus mume]
Length=471

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRLRK+ATK+S+GVDVCMS ERRFYFNLPEVQKALHANRT LPY W
Sbjct  284  VILDVCYPSIVQQELRLRKMATKMSLGVDVCMSSERRFYFNLPEVQKALHANRTNLPYSW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNI+ILPLL RI+ N IPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  344  SMCSNVLNYSDTDGNINILPLLARIVHNRIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F++TVPYG WFH+ Q GGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSF+RGRRL
Sbjct  404  FQITVPYGVWFHKGQAGGWATEYGDLLTFATVRGAAHMVPYAQPSRALHLFSSFIRGRRL  463

Query  210  PNMTRPSI  187
            PN T PSI
Sbjct  464  PNTTLPSI  471



>ref|XP_010679983.1| PREDICTED: serine carboxypeptidase-like 42 [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  288  VILDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEW  347

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++ DG++D+LPLLK+I+ +HIP+W+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  348  SMCSSILNYSDNDGSLDMLPLLKKILSHHIPIWVFSGDQDSVVPLLGSRTLVRELAHDLK  407

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+ QPSRALHLFSSF+RGRRL
Sbjct  408  FKATVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYTQPSRALHLFSSFIRGRRL  467

Query  210  PNMTRPSIDD  181
            P+ T+ S+ D
Sbjct  468  PSTTKSSMGD  477



>ref|XP_010519388.1| PREDICTED: serine carboxypeptidase-like 42 [Tarenaya hassleriana]
Length=471

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+K+ATK+S+GVDVCM+YER+FYFNLPEVQKALHANRT LPY W
Sbjct  282  VILDVCYPSIVEQELRLKKMATKMSLGVDVCMTYERQFYFNLPEVQKALHANRTLLPYQW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN+D+LP+LKRI++N I VWIFSGDQDSVVPLLGSRTLVRELA ++ 
Sbjct  342  SMCSSQLNYSDTDGNLDMLPILKRIVQNKIYVWIFSGDQDSVVPLLGSRTLVRELAQELD  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV G+RL
Sbjct  402  FKNTVPYGAWFHKGQVGGWVTEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGQRL  461

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  462  PNTTRPSIDD  471



>ref|XP_009377728.1| PREDICTED: serine carboxypeptidase-like 42 [Pyrus x bretschneideri]
Length=491

 Score =   334 bits (857),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVGVDVCM+YERRFY NLPEVQ+ALHANRT LPY W
Sbjct  302  VILDVCYPSIVEQELRLRKMATKISVGVDVCMTYERRFYLNLPEVQEALHANRTNLPYTW  361

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILPLL RI++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ 
Sbjct  362  SMCSGILNYSDTDWNINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLK  421

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRAL LFSSFV GRRL
Sbjct  422  FPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALRLFSSFVHGRRL  481

Query  210  PNMTRPSI  187
            PN T PSI
Sbjct  482  PNTTLPSI  489



>ref|XP_002865546.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41805.1| hypothetical protein ARALYDRAFT_494806 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  284  VLLDVCYPSIVQQELRLKKMATKLSLGVDVCMTYERRFYFNLPEVQKALHANRTHLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNID+LP+LKRII+N  PVWIFSGDQDSVVP +GSRTLVRELA+D+ 
Sbjct  344  SMCSGQLNYSDTDGNIDMLPILKRIIQNKTPVWIFSGDQDSVVPFVGSRTLVRELANDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+ TVPYGAWFH+ QVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  404  FETTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRL  463

Query  210  PNMTRPSIDD  181
            PN T  S DD
Sbjct  464  PNNTHSSTDD  473



>ref|XP_008373914.1| PREDICTED: serine carboxypeptidase-like 42 [Malus domestica]
Length=474

 Score =   333 bits (855),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKISVGVDVCM+YER FY NLPEVQKALHANRT LPY W
Sbjct  285  VILDVCYPSIVEQELRLRKMATKISVGVDVCMTYERSFYLNLPEVQKALHANRTNLPYTW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TD NI+ILPLL RI++NHIPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  345  SMCSXVLNYSNTDENINILPLLTRIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAXDLK  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPYGAWFH+ QVGGWATEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  405  FPITVPYGAWFHKGQVGGWATEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  464

Query  210  PNMTRPSI  187
            PN T PSI
Sbjct  465  PNTTLPSI  472



>ref|XP_006472927.1| PREDICTED: serine carboxypeptidase-like 42-like [Citrus sinensis]
Length=478

 Score =   332 bits (852),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGW
Sbjct  289  VILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGW  348

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  349  SMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  408

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+VTVPYGAWFH++QVGGW TEYG LLTF TVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  409  FEVTVPYGAWFHKQQVGGWGTEYGNLLTFVTVRGAAHMVPYAQPSRALHLFSSFVHGRRL  468

Query  210  PNMTRPSIDD  181
            PN TRP+I D
Sbjct  469  PNNTRPAIQD  478



>ref|XP_010930631.1| PREDICTED: serine carboxypeptidase-like 42 [Elaeis guineensis]
Length=476

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + +DVCYP+IVEQELRLRK ATKISVGVDVCM+YER FYFNLPEVQ ALHANRTKLPY W
Sbjct  283  VIIDVCYPAIVEQELRLRKYATKISVGVDVCMTYERHFYFNLPEVQHALHANRTKLPYSW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NIDILPLLKRII++HIPVWIFSGDQDSVVP LGSRTLVRELAHD+ 
Sbjct  343  SMCSGVLNYSDTDPNIDILPLLKRIIKHHIPVWIFSGDQDSVVPFLGSRTLVRELAHDLK  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F VTVPY AWF++ QVGGWATEYG LLTFATVRGA+HMVPFAQP+RAL LF SFV G+RL
Sbjct  403  FGVTVPYSAWFYKGQVGGWATEYGNLLTFATVRGAAHMVPFAQPARALRLFRSFVNGQRL  462

Query  210  PNMTRPSIDD  181
            PN T PSIDD
Sbjct  463  PNTTYPSIDD  472



>gb|KJB59375.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=344

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRLRK+ATKIS+G+DVCMS+ERRFY NLPEVQ AL+ANRTKLPY W
Sbjct  155  VLLDICYPSLVEQELRLRKMATKISIGIDVCMSFERRFYLNLPEVQMALYANRTKLPYDW  214

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+++DGNI+ILP+LK+II N IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  215  SMCSGRLSYSDSDGNINILPILKKIILNGIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  274

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH++QVGGW TEYG LLTFATVRGA+HMVP++QPSRALHLFSSFV GRRL
Sbjct  275  FKITVPYGAWFHKQQVGGWVTEYGNLLTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRL  334

Query  210  PNMTRPSIDD  181
            PN   P I +
Sbjct  335  PNNIHPPIHE  344



>ref|XP_002526159.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF36235.1| serine carboxypeptidase, putative [Ricinus communis]
Length=476

 Score =   330 bits (846),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QEL L+K+ TKISVGVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  287  VILDVCYPSIVQQELLLKKVVTKISVGVDVCMTMERSFYFNLPEVQKALHANRTSLPYRW  346

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN+DILP++K+II+NHIPVW+FSGDQDSVVPLLGSRTLVRELA D+ 
Sbjct  347  SMCSGVLNYSDTDGNMDILPIIKKIIQNHIPVWVFSGDQDSVVPLLGSRTLVRELADDLK  406

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTF TVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  407  FKITVPYGAWFHKGQVGGWATEYGDLLTFVTVRGAAHMVPYAQPSRALHLFSSFVRGRRL  466

Query  210  PNMTRPSIDD  181
            P+  R  IDD
Sbjct  467  PSTARTPIDD  476



>gb|KGN44500.1| hypothetical protein Csa_7G319000 [Cucumis sativus]
Length=472

 Score =   329 bits (844),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+A+KIS+GVDVCM+ ER+FYFNL EVQ+ALHANRTKLPY W
Sbjct  283  VILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLQEVQEALHANRTKLPYRW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y++TDGNI+ILPL++RII   IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  343  SMCSSMINYSDTDGNINILPLIRRIIEFQIPVWVFSGDQDSVVPLLGSRTLVRELAHDLK  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYG WFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  403  FKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRL  462

Query  210  PNMTRPSIDD  181
            PN TRPSI D
Sbjct  463  PNSTRPSIGD  472



>ref|NP_199039.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
 sp|Q9FH05.1|SCP42_ARATH RecName: Full=Serine carboxypeptidase-like 42; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK32772.1|AF361604_1 AT5g42240/K5J14_4 [Arabidopsis thaliana]
 dbj|BAB10197.1| serine carboxypeptidase II-like [Arabidopsis thaliana]
 gb|AAN28838.1| At5g42240/K5J14_4 [Arabidopsis thaliana]
 gb|AED94786.1| serine carboxypeptidase-like 42 [Arabidopsis thaliana]
Length=473

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  284  VLLDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHANRTHLPYSW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++ DGNID+LP+LKRII N  P+WIFSGDQDSVVP  GSRTLVRELA D+ 
Sbjct  344  SMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  404  FKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRL  463

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  464  PNNTHSSTDE  473



>ref|XP_004490637.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Cicer 
arietinum]
Length=509

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 178/223 (80%), Gaps = 33/223 (15%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKL---------------------------------ATKISVG  670
            + LDVCYPSIVEQELRL+K+                                 ATKIS+G
Sbjct  287  VILDVCYPSIVEQELRLKKMVLFASFISSVLVMIFLTFDEFINLINSVISLMQATKISIG  346

Query  669  VDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIR  490
            VDVCMSYERRFYFNLPEVQKALHANRT LPY WSMCS  L+Y++TD NI++LP+LKRI++
Sbjct  347  VDVCMSYERRFYFNLPEVQKALHANRTNLPYPWSMCSGVLNYSDTDPNINMLPILKRIVQ  406

Query  489  NHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLL  310
            NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW TEYG LL
Sbjct  407  NHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWVTEYGNLL  466

Query  309  TFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSIDD  181
            TFATVRGA+HMVP+AQPSRALHLFSSFV GRRLPN TRPSID+
Sbjct  467  TFATVRGAAHMVPYAQPSRALHLFSSFVNGRRLPNTTRPSIDE  509



>ref|XP_010442147.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442148.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010442149.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=465

 Score =   327 bits (839),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQ ALHANRT LPY W
Sbjct  276  VLLDVCYPSIVQQELRLKKMATKMSLGVDVCMTYERRFYFNLPEVQIALHANRTHLPYEW  335

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNID+LP+LKRII N IPVWIFSGDQDSVVP LGSRTLVRELA D+ 
Sbjct  336  SMCSSVLNYSGIDGNIDMLPVLKRIILNKIPVWIFSGDQDSVVPFLGSRTLVRELAQDLN  395

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH++QVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALH FSSFV GRRL
Sbjct  396  FATTVPYGAWFHKRQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHFFSSFVSGRRL  455

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  456  PNQTHSSTDE  465



>emb|CDP12019.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   327 bits (838),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+KLATKIS+GVDVCM+YERRFYFNLPEVQKALHANRT LP+ W
Sbjct  281  VILDVCYPSIVEQELRLKKLATKISLGVDVCMTYERRFYFNLPEVQKALHANRTNLPHVW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMC+  L+Y + DGN+D+LPLLK+I+++ IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  341  SMCNDDLNYTQADGNLDMLPLLKQILQSGIPVWVFSGDQDSVVPLLGSRTLVRELAHDLH  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             + TVPYGAWFH++QVGGW TEYG LLTFATVRGA+HMVPFAQPSRALHLFSSFVRG RL
Sbjct  401  LQTTVPYGAWFHKRQVGGWVTEYGNLLTFATVRGAAHMVPFAQPSRALHLFSSFVRGWRL  460

Query  210  PNMTRPSIDD  181
            PN T+  +DD
Sbjct  461  PNTTQTRMDD  470



>gb|KHF97371.1| Serine carboxypeptidase-like 42 [Gossypium arboreum]
Length=483

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRLRK+ATKIS+G+DVCMS+ERRFY NLPEVQ ALHANRTKLPY W
Sbjct  294  VLLDICYPSLVEQELRLRKMATKISIGIDVCMSFERRFYLNLPEVQMALHANRTKLPYDW  353

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+++DGNI+ILP+LK+II N IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  354  SMCSGRLSYSDSDGNINILPILKKIILNGIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  413

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPY AWFH++QVGGW TEYG LLTFATVRGA+HMVP++QPSRALHLFSSFV GRRL
Sbjct  414  FKITVPYRAWFHKQQVGGWVTEYGNLLTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRL  473

Query  210  PNMTRPSIDD  181
            PN T P I +
Sbjct  474  PNNTHPPIHE  483



>gb|KJB59377.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=468

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRLRK+ATKIS+G+DVCMS+ERRFY NLPEVQ AL+ANRTKLPY W
Sbjct  279  VLLDICYPSLVEQELRLRKMATKISIGIDVCMSFERRFYLNLPEVQMALYANRTKLPYDW  338

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+++DGNI+ILP+LK+II N IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  339  SMCSGRLSYSDSDGNINILPILKKIILNGIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  398

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH++QVGGW TEYG LLTFATVRGA+HMVP++QPSRALHLFSSFV GRRL
Sbjct  399  FKITVPYGAWFHKQQVGGWVTEYGNLLTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRL  458

Query  210  PNMTRPSIDD  181
            PN   P I +
Sbjct  459  PNNIHPPIHE  468



>gb|KJB59374.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59376.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
 gb|KJB59378.1| hypothetical protein B456_009G252300 [Gossypium raimondii]
Length=483

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRLRK+ATKIS+G+DVCMS+ERRFY NLPEVQ AL+ANRTKLPY W
Sbjct  294  VLLDICYPSLVEQELRLRKMATKISIGIDVCMSFERRFYLNLPEVQMALYANRTKLPYDW  353

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+++DGNI+ILP+LK+II N IPVWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  354  SMCSGRLSYSDSDGNINILPILKKIILNGIPVWIFSGDQDSVVPLLGSRTLVRELAHDLK  413

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH++QVGGW TEYG LLTFATVRGA+HMVP++QPSRALHLFSSFV GRRL
Sbjct  414  FKITVPYGAWFHKQQVGGWVTEYGNLLTFATVRGAAHMVPYSQPSRALHLFSSFVHGRRL  473

Query  210  PNMTRPSIDD  181
            PN   P I +
Sbjct  474  PNNIHPPIHE  483



>ref|XP_010482006.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=473

 Score =   325 bits (834),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQ ALHANRT LPY W
Sbjct  284  VLLDVCYPSIVQQELRLKKMATKMSLGVDVCMTYERRFYFNLPEVQIALHANRTHLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNID+LP+LKRII+N IPVWIFSGDQDSVVP LGSRT VRELA D  
Sbjct  344  SMCSSVLNYSGIDGNIDMLPVLKRIIQNKIPVWIFSGDQDSVVPFLGSRTPVRELAQDFN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+ TVPYGAWFH++QVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALHLFSSF+ GRRL
Sbjct  404  FETTVPYGAWFHKRQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFMSGRRL  463

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  464  PNQTHSSTDE  473



>dbj|BAJ87921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score =   320 bits (819),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKIS+GVDVCMSYER FYFNLPEVQ ALHANRT LPYGW
Sbjct  114  VILDVCYPSIVMQELRLRKYVTKISLGVDVCMSYERYFYFNLPEVQHALHANRTHLPYGW  173

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y + DGNI+ILPLL+RI+ + IPVWIFSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  174  SMCSDVLNYTDKDGNINILPLLQRIVEHKIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  233

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WF + QVGGWATEYG LLTFATVRGASHMVPFAQP RAL LF SFV G+RL
Sbjct  234  LPVTVPYRTWFRKGQVGGWATEYGNLLTFATVRGASHMVPFAQPDRALGLFRSFVLGQRL  293

Query  210  PNMTRPSIDD  181
            PN T P IDD
Sbjct  294  PNTTYPPIDD  303



>ref|XP_009414969.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414970.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414971.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009414972.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPS+VEQELRLRK  TK+SVGVDVCMSYERRFYFNLPEVQ +LHANRTKLPY W
Sbjct  282  VILDVCYPSLVEQELRLRKYVTKLSVGVDVCMSYERRFYFNLPEVQHSLHANRTKLPYPW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TDGNI+ILPLLKRI+++ IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  342  SMCSNVLNYSYTDGNINILPLLKRIVKHQIPVWVFSGDQDSVVPLLGSRTLVRELAHDLK  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +TVPY  WF++ QVGGW TEYG LLTFATVRGASHMVPFAQP RAL LF+SFV G+RL
Sbjct  402  FGITVPYSNWFYKGQVGGWVTEYGNLLTFATVRGASHMVPFAQPGRALRLFASFVHGQRL  461

Query  210  PNMTRPSID  184
            PN T P ID
Sbjct  462  PNSTYPPID  470



>ref|XP_002268397.1| PREDICTED: serine carboxypeptidase-like 42 [Vitis vinifera]
 emb|CBI20040.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRLRK+ TKIS+GVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  286  VILDVCYPSIVQQELRLRKVVTKISIGVDVCMTAERTFYFNLPEVQKALHANRTNLPYHW  345

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            + CS  L YNE D N+D+LPLLKRI+++ IPVWIFSGDQDSVVPL+GSRTLVRELA D+ 
Sbjct  346  TTCSNILFYNEGDSNLDMLPLLKRILQDKIPVWIFSGDQDSVVPLMGSRTLVRELAKDLN  405

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+ TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMV ++QPSRALHLF++F+ GRRL
Sbjct  406  FQHTVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVSYSQPSRALHLFATFIHGRRL  465

Query  210  PNMTRPSID  184
            PN TRPSID
Sbjct  466  PNNTRPSID  474



>ref|XP_008786550.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=475

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + +DVCYP+IVEQELRLRK AT+IS+GVDVCM+YER FYFNLPEVQ ALHANRTKLPY W
Sbjct  282  VLIDVCYPAIVEQELRLRKYATRISMGVDVCMTYERHFYFNLPEVQHALHANRTKLPYSW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TD NI+ILPLLKRII++ IPVWIFSGDQDSVVP LGSRTLVRELAHD+ 
Sbjct  342  SMCSDVLNYSGTDPNINILPLLKRIIKHQIPVWIFSGDQDSVVPFLGSRTLVRELAHDLK  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F VT+PYGAWF++ Q GGW+TEYG LLTFATVRGA+HMVP+AQP+RAL LF SFV G+RL
Sbjct  402  FGVTLPYGAWFYKGQAGGWSTEYGNLLTFATVRGAAHMVPYAQPARALRLFRSFVNGQRL  461

Query  210  PNMTRPSIDD  181
            PN T P IDD
Sbjct  462  PNTTYPPIDD  471



>ref|XP_009136205.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=466

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+++ATKIS+GVDVCM+YER+FYFNLPEVQ+ALHANRT+LPY W
Sbjct  277  VLLDVCYPSIVQQELRLKQMATKISMGVDVCMTYERKFYFNLPEVQQALHANRTRLPYQW  336

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y +TD +I +LP+LKRII+N  PVWIFSGDQD+VVPLLGSRTLVRELAH + 
Sbjct  337  SMCSSLVNYRDTDASISMLPILKRIIQNKTPVWIFSGDQDAVVPLLGSRTLVRELAHHLN  396

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK T+PY  WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQPSRALH+FSSFV GRRL
Sbjct  397  FKTTLPYRPWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRL  456

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  457  PNNTHYSPDE  466



>ref|XP_004977165.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X2 [Setaria 
italica]
Length=445

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKIS+GVD+CMSYER FYFNLPEVQ+ALHANRT+LPY W
Sbjct  257  VLLDVCYPSIVMQELRLRKYVTKISMGVDICMSYERFFYFNLPEVQQALHANRTRLPYKW  316

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNI+ILPLL+RII ++IPVW+FSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  317  SMCSAVLNYSDTDGNINILPLLQRIIEHNIPVWVFSGDQDSVVPLLGSRTLVRELAHDMG  376

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY AWFH  QV GW TEYGKLLTFATVRGA+HMVPFAQP RAL LF  FV G+RL
Sbjct  377  LDVTVPYRAWFHNDQVAGWVTEYGKLLTFATVRGAAHMVPFAQPDRALGLFRWFVDGQRL  436

Query  210  PNMTRPS  190
            PN T PS
Sbjct  437  PNTTNPS  443



>ref|XP_004139740.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g09040, mitochondrial-like [Cucumis sativus]
Length=1441

 Score =   333 bits (855),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  750   MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
             + LDVCYPSIVEQELRLRK+A+KIS+GVDVCM+ ER+FYFNL EVQ+ALHANRTKLPY W
Sbjct  1252  VILDVCYPSIVEQELRLRKMASKISLGVDVCMTMERKFYFNLQEVQEALHANRTKLPYRW  1311

Query  570   SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             SMCS  ++Y++TDGNI+ILPL++RII   IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  1312  SMCSSMINYSDTDGNINILPLIRRIIEFQIPVWVFSGDQDSVVPLLGSRTLVRELAHDLK  1371

Query  390   FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             FK+TVPYG WFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  1372  FKITVPYGTWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVGGRRL  1431

Query  210   PNMTRPSIDD  181
             PN TRPSI D
Sbjct  1432  PNSTRPSIGD  1441



>ref|XP_004977164.1| PREDICTED: serine carboxypeptidase-like 42-like isoform X1 [Setaria 
italica]
Length=476

 Score =   316 bits (809),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 164/187 (88%), Gaps = 0/187 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKIS+GVD+CMSYER FYFNLPEVQ+ALHANRT+LPY W
Sbjct  288  VLLDVCYPSIVMQELRLRKYVTKISMGVDICMSYERFFYFNLPEVQQALHANRTRLPYKW  347

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGNI+ILPLL+RII ++IPVW+FSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  348  SMCSAVLNYSDTDGNINILPLLQRIIEHNIPVWVFSGDQDSVVPLLGSRTLVRELAHDMG  407

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY AWFH  QV GW TEYGKLLTFATVRGA+HMVPFAQP RAL LF  FV G+RL
Sbjct  408  LDVTVPYRAWFHNDQVAGWVTEYGKLLTFATVRGAAHMVPFAQPDRALGLFRWFVDGQRL  467

Query  210  PNMTRPS  190
            PN T PS
Sbjct  468  PNTTNPS  474



>ref|NP_001067496.1| Os11g0213600 [Oryza sativa Japonica Group]
 gb|ABA92134.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27859.1| Os11g0213600 [Oryza sativa Japonica Group]
Length=465

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TK+SVGVDVCM+YER FYFNLPEVQ+ALHANRT LPYGW
Sbjct  277  VILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTYERYFYFNLPEVQQALHANRTHLPYGW  336

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNI+ILPLL+RI+ + IPVW+FSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  337  SMCSDVLNYSNKDGNINILPLLQRIVEHKIPVWVFSGDQDSVVPLLGSRTLVRELAHDMG  396

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY +WF R QVGGW TEYG +LTFATVRGASHMVPFAQP RAL LF SF  GRRL
Sbjct  397  LHVTVPYSSWFRRGQVGGWVTEYGNILTFATVRGASHMVPFAQPDRALGLFQSFALGRRL  456

Query  210  PNMTRPSID  184
            PN T P I+
Sbjct  457  PNTTHPPIN  465



>gb|EEE51848.1| hypothetical protein OsJ_33355 [Oryza sativa Japonica Group]
Length=474

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TK+SVGVDVCM+YER FYFNLPEVQ+ALHANRT LPYGW
Sbjct  286  VILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTYERYFYFNLPEVQQALHANRTHLPYGW  345

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNI+ILPLL+RI+ + IPVW+FSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  346  SMCSDVLNYSNKDGNINILPLLQRIVEHKIPVWVFSGDQDSVVPLLGSRTLVRELAHDMG  405

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY +WF R QVGGW TEYG +LTFATVRGASHMVPFAQP RAL LF SF  GRRL
Sbjct  406  LHVTVPYSSWFRRGQVGGWVTEYGNILTFATVRGASHMVPFAQPDRALGLFQSFALGRRL  465

Query  210  PNMTRPSID  184
            PN T P I+
Sbjct  466  PNTTHPPIN  474



>ref|XP_003577714.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=472

 Score =   314 bits (805),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKISVGVDVCM+YER FYFNLPEVQ ALHANRT LPYGW
Sbjct  284  VILDVCYPSIVMQELRLRKYVTKISVGVDVCMTYERFFYFNLPEVQHALHANRTHLPYGW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+  DGNI+ILPLL+RI+   IPVW+FSGDQDSVVPLLGSRTLVRELAH MG
Sbjct  344  SMCSDVLDYSGKDGNINILPLLQRIVEQKIPVWVFSGDQDSVVPLLGSRTLVRELAHTMG  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F VTVPY  WFH+ QVGGW TEYG +LTFATVRGASHMVPFAQP R+L LF SFV G+RL
Sbjct  404  FHVTVPYSTWFHKGQVGGWVTEYGNMLTFATVRGASHMVPFAQPDRSLGLFRSFVLGQRL  463

Query  210  PNMTRPSID  184
            PN T P ID
Sbjct  464  PNTTHPPID  472



>emb|CDY66139.1| BnaAnng21620D [Brassica napus]
Length=486

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+C+PSI+EQELRL+K+AT+IS+GVDVCM +ER+FYFNLPEVQ ALHANRT LPY W
Sbjct  290  VLLDLCFPSIIEQELRLKKMATQISMGVDVCMMHERQFYFNLPEVQHALHANRTHLPYQW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y+  DGNI++LP+LKRII+N   VWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  350  SMCSTLVNYSGIDGNINMLPILKRIIQNKTSVWIFSGDQDSVVPLLGSRTLVRELAHDLN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  T+PYG WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQPSRALHLFSSFVRGRRL
Sbjct  410  FSTTLPYGPWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVRGRRL  469

Query  210  PNMT  199
            PN T
Sbjct  470  PNNT  473



>ref|XP_009406489.1| PREDICTED: serine carboxypeptidase-like 42 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK  TK+SVGVDVCMS ER FYFNLP+VQ ALHANRTKLPY W
Sbjct  282  VILDVCYPSIVEQELRLRKYVTKMSVGVDVCMSVERYFYFNLPQVQLALHANRTKLPYSW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             MCS  L+Y+ TD +IDILPLLK+IIR+  PVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  342  GMCSGLLNYSSTDVDIDILPLLKKIIRHGTPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F+VTVPYG WF++ QVGGW TEYG LLTFATVRGASHMVP+AQP+RAL LF+SF+ G+RL
Sbjct  402  FRVTVPYGVWFYKGQVGGWVTEYGNLLTFATVRGASHMVPYAQPARALRLFTSFIHGQRL  461

Query  210  PNMTRPSI  187
            PN T PSI
Sbjct  462  PNSTHPSI  469



>gb|EAY80352.1| hypothetical protein OsI_35523 [Oryza sativa Indica Group]
Length=529

 Score =   315 bits (806),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TK+S+GVDVCM+YER FYFNLPEVQ+ALHANRT LPYGW
Sbjct  341  VILDVCYPSIVMQELRLRKYVTKMSIGVDVCMTYERYFYFNLPEVQQALHANRTHLPYGW  400

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNI+ILPLL+RI+ + IPVW+FSGDQDSVVPLLGSRTLVRELAHDMG
Sbjct  401  SMCSDVLNYSNKDGNINILPLLQRIVEHKIPVWVFSGDQDSVVPLLGSRTLVRELAHDMG  460

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY +WF R QVGGW TEYG +LTFATVRGASHMVPFAQP RAL LF SF  GRRL
Sbjct  461  LHVTVPYSSWFRRGQVGGWVTEYGNILTFATVRGASHMVPFAQPDRALGLFQSFALGRRL  520

Query  210  PNMTRPSID  184
            PN T P I+
Sbjct  521  PNTTHPPIN  529



>ref|XP_009112251.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   312 bits (799),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC+PSI+EQELRL+K+AT++S+GVDVCM +ER+ YFNLP VQ ALHANRT+LPY W
Sbjct  280  VLLDVCFPSIIEQELRLKKMATQMSMGVDVCMKHERQLYFNLPAVQHALHANRTRLPYQW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y+  DGNI++LP+LKRII+N   VWIFSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  340  SMCSTLVNYSGMDGNINMLPILKRIIQNKTSVWIFSGDQDSVVPLLGSRTLVRELAHDLN  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  T+PYG WFH+ QVGGW TEYGK+LTFATVRGA+HMVP+AQPSRALH+FSSFVRGRRL
Sbjct  400  FSTTLPYGPWFHKNQVGGWVTEYGKILTFATVRGAAHMVPYAQPSRALHIFSSFVRGRRL  459

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  460  PNSTHYSPDE  469



>ref|XP_006858474.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
 gb|ERN19941.1| hypothetical protein AMTR_s00071p00113850 [Amborella trichopoda]
Length=474

 Score =   312 bits (799),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 170/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRLRK ATKISVGVDVCM+YERRFY NLPEVQ ALHANRTKLPY W
Sbjct  286  VILDVCYPSIVQQELRLRKWATKISVGVDVCMTYERRFYLNLPEVQYALHANRTKLPYSW  345

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DG+I+++P+LK+II++ +P+W+FSGDQDSVVPL+GSRTLVREL+ DM 
Sbjct  346  SMCSDQLNYSNIDGSINMIPVLKKIIQHKVPIWVFSGDQDSVVPLMGSRTLVRELSDDMN  405

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F++TVPYGAWF++ QVGGWA EYG +LTFATVRGA+HMVP+AQP+RAL LF +FV G+RL
Sbjct  406  FEITVPYGAWFYKGQVGGWAAEYGNMLTFATVRGAAHMVPYAQPARALKLFHTFVSGQRL  465

Query  210  PNMTRPSID  184
            PN+T PSI+
Sbjct  466  PNITHPSIE  474



>ref|XP_009107654.1| PREDICTED: serine carboxypeptidase-like 44 isoform X5 [Brassica 
rapa]
Length=396

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  207  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  266

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  267  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  326

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  327  FHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  386

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  387  PNKSPPPLHD  396



>gb|KHN23425.1| Serine carboxypeptidase-like 42 [Glycine soja]
Length=457

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = -3

Query  690  ATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILP  511
            ATKIS+GVDVCM+YER FYFNLPEVQKALHANRT LPY WSMCS  L+Y++TD NIDILP
Sbjct  288  ATKISIGVDVCMTYERSFYFNLPEVQKALHANRTNLPYQWSMCSGVLNYSDTDPNIDILP  347

Query  510  LLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWA  331
            +LK+I++NHIPVW+FSGDQDSVVPLLGSRTL+RELAHD+ FK+TVPYGAWFH+ QVGGW 
Sbjct  348  ILKKIVQNHIPVWVFSGDQDSVVPLLGSRTLIRELAHDLKFKITVPYGAWFHKGQVGGWV  407

Query  330  TEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSIDD  181
            TEYG LLTFATVRGA+HMVP+AQPSRALHLFSSFV GRRLPN T PSIDD
Sbjct  408  TEYGNLLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTSPSIDD  457



>ref|XP_010493597.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493598.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
 ref|XP_010493599.1| PREDICTED: serine carboxypeptidase-like 42 [Camelina sativa]
Length=462

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ATK+S+GVDVCM+YERRFYFNLPEVQ ALHANRT LPY W
Sbjct  280  VLLDVCYPSIVQQELRLKKIATKMSLGVDVCMTYERRFYFNLPEVQIALHANRTHLPYEW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNID+LP+LKRI++N IPVWIFSGDQDSVVP LGSRTLVRELA D+ 
Sbjct  340  SMCSSVLNYSGIDGNIDMLPVLKRILQNKIPVWIFSGDQDSVVPFLGSRTLVRELAQDLN  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVR  223
            F+ TVPYGAWFH++QVGGWA EYGKLLTFATVRGA+HMVP+AQPSRALHLFSSF +
Sbjct  400  FETTVPYGAWFHKRQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFAQ  455



>gb|ACR37620.1| unknown [Zea mays]
Length=321

 Score =   305 bits (782),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLR+ ATKISVGVDVCMSYER FYFNLPEVQ+ALHANRT L Y W
Sbjct  133  VILDVCYPSIVMQELRLRQFATKISVGVDVCMSYERFFYFNLPEVQQALHANRTHLKYQW  192

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS FL+Y+ TDGNID+LP L+RI+   IP+W+FSGDQDSVVPLLGSR+LVRELAH MG
Sbjct  193  SMCSDFLNYSNTDGNIDMLPTLQRIVERKIPLWVFSGDQDSVVPLLGSRSLVRELAHTMG  252

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WF + QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S V GRRL
Sbjct  253  LHVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIVLGRRL  312

Query  210  PNMTRPSI  187
            PN T P I
Sbjct  313  PNATSPPI  320



>ref|XP_009107653.1| PREDICTED: serine carboxypeptidase-like 44 isoform X4 [Brassica 
rapa]
Length=449

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  260  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  319

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  320  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  379

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  380  FHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  439

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  440  PNKSPPPLHD  449



>ref|XP_009107652.1| PREDICTED: serine carboxypeptidase-like 44 isoform X3 [Brassica 
rapa]
Length=454

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  265  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  324

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  325  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  384

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  385  FHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  444

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  445  PNKSPPPLHD  454



>emb|CDX80725.1| BnaC08g05590D [Brassica napus]
Length=476

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  287  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  346

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  347  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  406

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  407  FNTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  466

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  467  PNKSPPPLHD  476



>emb|CDY48945.1| BnaA08g04690D [Brassica napus]
Length=477

 Score =   310 bits (793),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  288  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  347

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  348  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  407

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  408  FNTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  467

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  468  PNKSPPPLHD  477



>ref|XP_009107650.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
 ref|XP_009107651.1| PREDICTED: serine carboxypeptidase-like 44 isoform X2 [Brassica 
rapa]
Length=464

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  275  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  334

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  335  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  394

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  395  FHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  454

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  455  PNKSPPPLHD  464



>ref|XP_006663298.1| PREDICTED: serine carboxypeptidase-like 42-like [Oryza brachyantha]
Length=486

 Score =   310 bits (793),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPS+V QELRLRK  TKISVGVDVCM+YER FYFNLP+VQ+ALHANRT LPYGW
Sbjct  298  VILDVCYPSLVMQELRLRKYVTKISVGVDVCMTYERYFYFNLPDVQRALHANRTHLPYGW  357

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGNI+ILPLL+RI+ + IPVWIFSGDQDSVVPLLGSRTLVRELAH MG
Sbjct  358  SMCSDVLNYSNKDGNINILPLLQRIVEHKIPVWIFSGDQDSVVPLLGSRTLVRELAHTMG  417

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             +VTVPY +WF R QVGGW TEYG +LTFATVRGASHMVPFAQP RAL LF SF  GRRL
Sbjct  418  LQVTVPYSSWFRRGQVGGWVTEYGNMLTFATVRGASHMVPFAQPDRALGLFQSFALGRRL  477

Query  210  PNMTRPSID  184
            PN T   I+
Sbjct  478  PNTTNVPIN  486



>ref|XP_009107648.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
 ref|XP_009107649.1| PREDICTED: serine carboxypeptidase-like 44 isoform X1 [Brassica 
rapa]
Length=477

 Score =   309 bits (792),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYP++VEQELRL+K+ TKISVGVDVCMSYE + Y +LPEVQ+ALHANRT LPY W
Sbjct  288  VLLDICYPTLVEQELRLKKMGTKISVGVDVCMSYEEQLYLSLPEVQQALHANRTNLPYSW  347

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN++ILP+LKRI+   IP+W+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  348  SMCSGLLNYSDTDGNMNILPILKRILTRKIPIWVFSGDEDSVIPLLGSRTLVKELAEDLN  407

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG +LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  408  FHTTVPYGAWFHKGQVGGWVIEYGDILTFATVRGAAHMVPYAQPSRALHLFSSFVLGRRL  467

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  468  PNKSPPPLHD  477



>gb|KFK24266.1| hypothetical protein AALP_AAs40498U001000 [Arabis alpina]
Length=480

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPS+ EQELRL+K+ TK+SVGVDVC+SYE + Y  LPEVQKALHANRT+L Y W
Sbjct  290  VLLDVCYPSLFEQELRLKKMGTKMSVGVDVCISYEEQLYLTLPEVQKALHANRTQLTYPW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YN TDGN +ILP+LKRI+++ IPVW+FSGD+DSV+PLLGSRTL+RELA D+ 
Sbjct  350  SMCSGLLNYNNTDGNTNILPILKRIVKSKIPVWVFSGDEDSVIPLLGSRTLIRELADDLN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGWA EYG LLTFATVRGA+HMVP+AQPSRALHLF+SFV GRRL
Sbjct  410  FNTTVPYGAWFHKGQVGGWAIEYGNLLTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRL  469

Query  210  PNMTRP  193
            PN T P
Sbjct  470  PNKTPP  475



>gb|ACM17527.1| putative serine carboxy peptidase [Oryza australiensis]
Length=466

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 161/189 (85%), Gaps = 5/189 (3%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TK+SVGVDVCM+YER FYFNLPEVQ+ALHANRT LPYGW
Sbjct  283  VILDVCYPSIVMQELRLRKYVTKMSVGVDVCMTYERYFYFNLPEVQQALHANRTHLPYGW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS     + TDGNI+ILPLL+RI+ + IPVW+FSGDQDSVVPLLGSRTLVRELAH+MG
Sbjct  343  SMCS-----DNTDGNINILPLLQRIVEHKIPVWVFSGDQDSVVPLLGSRTLVRELAHNMG  397

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY +WF R QVGGW TEYG +LTFATVRGASHMVPFAQP RAL LF SF  GRRL
Sbjct  398  LHVTVPYSSWFCRGQVGGWVTEYGNILTFATVRGASHMVPFAQPDRALGLFQSFALGRRL  457

Query  210  PNMTRPSID  184
            PN T PSI+
Sbjct  458  PNTTHPSIN  466



>ref|XP_009123167.1| PREDICTED: serine carboxypeptidase-like 42 [Brassica rapa]
Length=469

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 162/187 (87%), Gaps = 0/187 (0%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            D+CYPSIV+QELRL+K+AT +S+GVDVCM+YER+FYFNLPEVQ ALHANRT+LPY WSMC
Sbjct  283  DLCYPSIVQQELRLKKMATHMSIGVDVCMTYERKFYFNLPEVQHALHANRTRLPYEWSMC  342

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
            S  ++Y+  D NI +LPLLKRII+N  PVWIFSGDQDS+VP LG+RT +RELAHD+ F  
Sbjct  343  STLVNYHGIDSNISMLPLLKRIIQNKTPVWIFSGDQDSIVPFLGTRTNIRELAHDLNFST  402

Query  381  TVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNM  202
            T+PYG WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQP+RALH+FS FVRGRRLPN 
Sbjct  403  TLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPYAQPARALHMFSCFVRGRRLPNN  462

Query  201  TRPSIDD  181
            T    D+
Sbjct  463  THYPHDE  469



>ref|XP_002449388.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
 gb|EES08376.1| hypothetical protein SORBIDRAFT_05g009120 [Sorghum bicolor]
Length=476

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 160/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLR+ ATKIS+GVDVCMSYER FYFNLPEVQ+ALHANRT L Y W
Sbjct  288  VILDVCYPSIVMQELRLRQYATKISIGVDVCMSYERYFYFNLPEVQQALHANRTHLKYNW  347

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TDGNI+ILP L+RI+ + IP+W+FSGDQDSVVPLLGSRTLVRELAH+MG
Sbjct  348  SMCSDILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDSVVPLLGSRTLVRELAHNMG  407

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             +VTVPY  WF R QVGGW T+YG  LTFATVRGASHMVPFAQP RAL LF S V G+RL
Sbjct  408  LQVTVPYSTWFRRGQVGGWVTQYGNFLTFATVRGASHMVPFAQPDRALRLFQSIVLGQRL  467

Query  210  PNMTRPSID  184
            PN T P I+
Sbjct  468  PNTTSPPIE  476



>ref|NP_001183841.1| hypothetical protein precursor [Zea mays]
 gb|ACR38507.1| unknown [Zea mays]
 tpg|DAA38901.1| TPA: hypothetical protein ZEAMMB73_424549 [Zea mays]
Length=473

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLR+ ATKISVGVDVCMSYER FYFNLPEVQ+ALHANRT L Y W
Sbjct  285  VILDVCYPSIVMQELRLRQFATKISVGVDVCMSYERFFYFNLPEVQQALHANRTHLKYQW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS FL+Y+ TDGNID+LP L+RI+   IP+W+FSGDQDSVVPLLGSR+LVRELAH MG
Sbjct  345  SMCSDFLNYSNTDGNIDMLPTLQRIVERKIPLWVFSGDQDSVVPLLGSRSLVRELAHTMG  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WF + QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S V GRRL
Sbjct  405  LHVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIVLGRRL  464

Query  210  PNMTRPSI  187
            PN T P I
Sbjct  465  PNATSPPI  472



>ref|XP_006351861.1| PREDICTED: serine carboxypeptidase-like 42-like [Solanum tuberosum]
Length=478

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL K  TK+SVGVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  283  VILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+++DG+ID+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA D+ 
Sbjct  343  SMCSDVLNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDSVVPLIGSRTLVRELARDLK  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGW  EYG+ LTFATVRGA+HMVP+AQPSRALHLF++FV GRRL
Sbjct  403  FKTTVPYGAWFHKGQVGGWQVEYGEKLTFATVRGAAHMVPYAQPSRALHLFTTFVHGRRL  462

Query  210  PNMTRPSID  184
            PN T   I+
Sbjct  463  PNTTHIPIN  471



>ref|XP_010468548.1| PREDICTED: serine carboxypeptidase-like 43 [Camelina sativa]
Length=462

 Score =   304 bits (779),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPSIV+QELRL+K+ATK+++GVDVCM+YER FYFNLPEVQKALHANRT+LPY W
Sbjct  273  VLLDLCYPSIVQQELRLKKMATKMNMGVDVCMTYERSFYFNLPEVQKALHANRTRLPYEW  332

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+    NID+LP+LK+I+++  PVWIFSGDQDSV+PL  SRTLVRELA D+ 
Sbjct  333  TMCSNLLNYSGIYWNIDMLPILKKIVQSQTPVWIFSGDQDSVIPLQSSRTLVRELAQDLN  392

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH++Q+GGW TEYG LLTF TVRGA+HMVP+AQPSRAL +FSSFV GR+L
Sbjct  393  FKTTVPYGAWFHKEQIGGWFTEYGSLLTFVTVRGAAHMVPYAQPSRALLMFSSFVSGRKL  452

Query  210  PNMTRPSIDD  181
            PN    SIDD
Sbjct  453  PNKPHLSIDD  462



>gb|AFW60600.1| serine carboxypeptidase F13S12.6 [Zea mays]
Length=471

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLR+ ATKIS+GVDVCMSYER FYFNLPEVQ+ALHANRT L + W
Sbjct  283  VILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLPEVQQALHANRTHLKHHW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TDGNI+ILP L+RI+ + IP+W+FSGDQDSVVPLLG+RTLVRELAH MG
Sbjct  343  SMCSDILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDSVVPLLGTRTLVRELAHAMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WFH+ QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S V G+RL
Sbjct  403  LHVTVPYSTWFHKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIVLGQRL  462

Query  210  PNMTRPSID  184
            PN T P ID
Sbjct  463  PNTTNPHID  471



>ref|XP_006299245.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
 gb|EOA32143.1| hypothetical protein CARUB_v10015394mg [Capsella rubella]
Length=459

 Score =   303 bits (777),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 166/192 (86%), Gaps = 2/192 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPSIV+QELRL+K+ATK+S+GVDVC++YER  YFNLPEVQ+AL+ANRT+LPY W
Sbjct  268  VLLDICYPSIVQQELRLKKMATKMSMGVDVCITYERSLYFNLPEVQRALNANRTRLPYEW  327

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+  DG ID+LP+LKRII+N  PVWIFSGDQDSV+PL  SRTLVRELAHD+ 
Sbjct  328  TMCSNRLNYSGIDGYIDMLPILKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAHDLN  387

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPY AWF+++QVGGW TEYG +LTFATVRGA+HMV +AQPSR LH+FSSFVRG+RL
Sbjct  388  FKTTVPYAAWFYKEQVGGWVTEYGNILTFATVRGAAHMVSYAQPSRGLHMFSSFVRGQRL  447

Query  210  PNM--TRPSIDD  181
            PN      SIDD
Sbjct  448  PNKPHLNSSIDD  459



>ref|NP_001151858.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
 gb|ACG44640.1| serine carboxypeptidase F13S12.6 precursor [Zea mays]
Length=471

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 159/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLR+ ATKIS+GVDVCMSYER FYFNLPEVQ+ALHANRT L + W
Sbjct  283  VILDVCYPSIVMQELRLREYATKISIGVDVCMSYERFFYFNLPEVQQALHANRTHLKHHW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+ TDGNI+ILP L+RI+ + IP+W+FSGDQDSVVPLLG+RTLVRELAH MG
Sbjct  343  SMCSDILNYSNTDGNINILPTLQRIVEHKIPLWVFSGDQDSVVPLLGTRTLVRELAHAMG  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WFH+ QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S V G+RL
Sbjct  403  LHVTVPYSTWFHKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIVLGQRL  462

Query  210  PNMTRPSID  184
            PN T P ID
Sbjct  463  PNTTNPHID  471



>ref|XP_004979109.1| PREDICTED: serine carboxypeptidase-like 42-like [Setaria italica]
Length=473

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 158/189 (84%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK ATKISVGVDVCM+YER FYFNLPEVQ+ALHANRT L Y W
Sbjct  285  VILDVCYPSIVMQELRLRKYATKISVGVDVCMTYERFFYFNLPEVQQALHANRTHLKYQW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             MCS  L+Y+ TDGNI+ILP+L+RI+ + IP+W+FSGDQDSVVPLLGSRTLVRELAH MG
Sbjct  345  GMCSDVLNYSNTDGNINILPILQRIVEHKIPLWVFSGDQDSVVPLLGSRTLVRELAHTMG  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              VTVPY  WF + QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S + G+RL
Sbjct  405  LPVTVPYSTWFRKGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIILGQRL  464

Query  210  PNMTRPSID  184
            PN T P ID
Sbjct  465  PNTTNPPID  473



>gb|AAD28662.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=468

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 2/192 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+ TKIS+ VDVC++YER FYFNLP+VQ ALHANRT+LPY W
Sbjct  277  ILLDVCYPSIVQQELRLKKMVTKISMVVDVCITYERSFYFNLPKVQNALHANRTRLPYEW  336

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+  DG ID+LP LKRII+N  PVWIFSGDQDSV+PL  SRTLVRELA D+ 
Sbjct  337  TMCSNRLNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAEDLN  396

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK T+PYGAWFH++QVGGW TEYG LLTFATVRGA+HMVP+A+PSRALH+FSSF+ GRRL
Sbjct  397  FKTTIPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRL  456

Query  210  PNM--TRPSIDD  181
            PN    + S DD
Sbjct  457  PNKPDLKSSTDD  468



>ref|XP_006279617.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
 gb|EOA12515.1| hypothetical protein CARUB_v10026338mg [Capsella rubella]
Length=472

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD CYPSIV+QELRL+K+ATK+S+GVDVCM+YERR YFNLPEVQ ALHANRT LPY W
Sbjct  283  VLLDFCYPSIVQQELRLKKMATKMSMGVDVCMTYERRLYFNLPEVQIALHANRTHLPYEW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  DGN+D+LP+LKRII+N  PVWIFSGDQDSV+P  GSR+L+RELA D+ 
Sbjct  343  SMCSTQLNYSGIDGNMDMLPVLKRIIQNKTPVWIFSGDQDSVIPFTGSRSLIRELAQDLN  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F++TVPY  WFH++QVGGWA EYG LLTFATVRGA+HMVP+AQP+RAL LFSSFV G RL
Sbjct  403  FEITVPYRIWFHKRQVGGWAIEYGNLLTFATVRGAAHMVPYAQPARALQLFSSFVSGGRL  462

Query  210  PNMTRPSIDD  181
            PN    S DD
Sbjct  463  PNKPHSSTDD  472



>ref|XP_006307408.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
 gb|EOA40306.1| hypothetical protein CARUB_v10009034mg [Capsella rubella]
Length=473

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRL+K+ TK+S GVDVCMSYE + Y  LPEVQKALHANRT+LPY W
Sbjct  284  ILLDICYPSLVEQELRLKKMGTKMSNGVDVCMSYEEQIYLTLPEVQKALHANRTQLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            S+CS  ++YN  DG+ +ILP+LKRI+++ +PVW+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  344  SICSSLVNYNYNDGSTNILPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKELASDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLF+SFV GRRL
Sbjct  404  FNTTVPYGAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRL  463

Query  210  PNMTRPSIDD  181
            P+ + P++ D
Sbjct  464  PHKSPPALHD  473



>ref|XP_010239229.1| PREDICTED: serine carboxypeptidase-like 42 [Brachypodium distachyon]
Length=380

 Score =   299 bits (766),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKISVGVDVCM+YER FYFNLPEVQ ALHANRT LPYGW
Sbjct  191  VILDVCYPSIVMQELRLRKYVTKISVGVDVCMTYERFFYFNLPEVQHALHANRTHLPYGW  250

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L Y+  DGNI+ILPLL+RI+   IPVW+FS DQDSVVPLLGSRTLVRELAH MG
Sbjct  251  SMCSDVLDYSGKDGNINILPLLQRIVEQKIPVWVFSDDQDSVVPLLGSRTLVRELAHTMG  310

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRR-  214
            F  TVPY  WFH+ QVGGW T YG +LTFATVRGASHMVPFAQP RAL LF SFV G+  
Sbjct  311  FHCTVPYSTWFHKGQVGGWVTVYGNMLTFATVRGASHMVPFAQPDRALGLFRSFVLGQTI  370

Query  213  LPNMTRPSID  184
            +PN T P I+
Sbjct  371  IPNTTHPPIN  380



>ref|XP_009586680.1| PREDICTED: serine carboxypeptidase-like 42 [Nicotiana tomentosiformis]
Length=470

 Score =   302 bits (774),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL K  TK+SVGVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  282  VILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+++DG+ D+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA+D+ 
Sbjct  342  SMCSDVLNYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDSVVPLIGSRTLVRELANDLN  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K TV YGAWFH+ QVGGW  EYG  LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  402  LKTTVAYGAWFHKGQVGGWQVEYGHKLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  461

Query  210  PNMTRPSI  187
            PN TR  I
Sbjct  462  PNATRIPI  469



>gb|EPS65711.1| hypothetical protein M569_09067, partial [Genlisea aurea]
Length=167

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  690  ATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILP  511
            ATK+SVGVDVCM+YERRFY NLPEVQKALHANRTKLPY WSMCS  L+Y+  DGNIDILP
Sbjct  1    ATKLSVGVDVCMTYERRFYLNLPEVQKALHANRTKLPYRWSMCSSVLNYDYNDGNIDILP  60

Query  510  LLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWA  331
            +L+RI++N IPVWI+SGDQDSVVPLLGSRTLVRELAHDM   VTVPYGAWF + QVGG+A
Sbjct  61   ILRRILQNGIPVWIYSGDQDSVVPLLGSRTLVRELAHDMKLPVTVPYGAWFDKHQVGGFA  120

Query  330  TEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPS  190
            TEYG +LTFATVRGA+HMVP++QPSRALHLFSSFV GRRLPN T PS
Sbjct  121  TEYGNMLTFATVRGAAHMVPYSQPSRALHLFSSFVNGRRLPNDTNPS  167



>ref|XP_010463193.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=422

 Score =   300 bits (768),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRL+K+ TK+S GVDVCMSYE + Y  LPEVQKALHANRT+LPY W
Sbjct  233  ILLDICYPSLVEQELRLKKMGTKMSFGVDVCMSYEEQLYLILPEVQKALHANRTQLPYEW  292

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YN  DGN +ILP+LKRI+++ +PVW+FSGD+DSV+PLLGSRTLVRELA D+ 
Sbjct  293  SMCSSLLNYNYNDGNTNILPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVRELADDLY  352

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
               TVPY AWFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLF+SFV GRRL
Sbjct  353  LNTTVPYAAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRL  412

Query  210  PNMTRPSI  187
            P+ + P++
Sbjct  413  PHKSPPAL  420



>emb|CDY23340.1| BnaA08g12060D [Brassica napus]
Length=469

 Score =   301 bits (772),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            D+CYPSIV+QELRL+K+AT +S+G+DVCM+YER+FYFNLPEVQ ALHANRT+LPY WSMC
Sbjct  283  DLCYPSIVQQELRLKKMATHMSIGMDVCMTYERKFYFNLPEVQHALHANRTRLPYEWSMC  342

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
            S  ++Y   D NI +LPLLKRII+N  PVWIFSGDQDS+VP LG+RT +RELAHD+ F  
Sbjct  343  STLVNYRGIDSNISMLPLLKRIIQNKTPVWIFSGDQDSIVPFLGTRTNIRELAHDLNFST  402

Query  381  TVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNM  202
            T+PYG WFH+ QVGGW TEYGKLLTFATVRGA+H VP+AQP+RALH+FS FVRGRRLPN 
Sbjct  403  TLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHRVPYAQPARALHMFSCFVRGRRLPNN  462

Query  201  TRPSIDD  181
            T    D+
Sbjct  463  THYPHDE  469



>ref|XP_003602149.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES72400.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+I EQE+RL+K+ATKIS+ VDVC+ YE   Y NLPEVQKALHANRT LPY W
Sbjct  276  VILDVCYPAIAEQEIRLKKMATKISLSVDVCIDYESFNYLNLPEVQKALHANRTNLPYPW  335

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             MCS  L+Y+ TD ++D+LP+LKRI++NHIP+W++SGDQDSVVPLLGSRTL+RELAHDM 
Sbjct  336  GMCSDVLNYSNTDPDVDMLPILKRIVQNHIPIWVYSGDQDSVVPLLGSRTLIRELAHDMK  395

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+T  Y  WFH+ Q GGW TEY  LLTFATVRGA HMVP+ QPSRALHLFSSFV G+RL
Sbjct  396  FKITDSYRVWFHKGQAGGWVTEYENLLTFATVRGAGHMVPYGQPSRALHLFSSFVHGKRL  455

Query  210  PNMTRPSIDD  181
            PN T+PSI +
Sbjct  456  PNTTKPSIGE  465



>ref|XP_010479023.1| PREDICTED: serine carboxypeptidase-like 44 [Camelina sativa]
Length=479

 Score =   301 bits (772),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+VEQELRL+K+ TK+S GVDVCMSYE + Y  LPEVQKALHANRT+LPY W
Sbjct  290  ILLDICYPSLVEQELRLKKMGTKMSFGVDVCMSYEEQLYLTLPEVQKALHANRTQLPYEW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YN  DGN +ILP+LKRI+++ +PVW+FSGD+DSV+PLLGSRTLVRELA D+ 
Sbjct  350  SMCSSLLNYNYNDGNTNILPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVRELADDLY  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
               TVPY AWFH+ QVGGW  EYG LLTFATVRGA+HMVP+AQPSRALHLF+SFV GRRL
Sbjct  410  LNTTVPYAAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVPYAQPSRALHLFTSFVLGRRL  469

Query  210  PNMTRPSIDD  181
            P+ + P++ +
Sbjct  470  PHKSPPALHE  479



>gb|KEH35413.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=477

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSI EQELRL+++ATKIS+ VD+CM  E  FY NLPEVQKALHANRT LPY W
Sbjct  283  VILDVCYPSIAEQELRLKRMATKISLTVDICMDSEIYFYLNLPEVQKALHANRTNLPYPW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+YN+ D +I+ILP+LKRI++NHIPVW++SGDQDS+VPLLGSR  +RELAHD+ 
Sbjct  343  SMCSGVLNYNDADHDINILPVLKRIVQNHIPVWVYSGDQDSIVPLLGSRRHIRELAHDLN  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +T  Y  WFHR QVGGW TEYG LLTFATVRGA H+VP+AQPS+ALHLFSSFVRGRRL
Sbjct  403  FNITDSYRVWFHRDQVGGWVTEYGNLLTFATVRGAGHIVPYAQPSKALHLFSSFVRGRRL  462

Query  210  PNMTRPSIDD  181
            P  TRP I D
Sbjct  463  PKTTRPKIID  472



>ref|XP_010315077.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Solanum 
lycopersicum]
Length=478

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL K  TK+S+GVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  282  VILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             MCS  L+Y+++DG+ID+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA D+ 
Sbjct  342  RMCSDRLNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDSVVPLVGSRTLVRELARDLK  401

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGW  EYG+ LTFATVRGA+HMVP+AQPSRALHLF++FV G+RL
Sbjct  402  FKTTVPYGAWFHKGQVGGWQIEYGEKLTFATVRGAAHMVPYAQPSRALHLFTTFVHGKRL  461

Query  210  PNMTRPSID  184
            PN TR  I+
Sbjct  462  PNTTRIPIN  470



>ref|XP_006393769.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
 gb|ESQ31055.1| hypothetical protein EUTSA_v10011445mg [Eutrema salsugineum]
Length=479

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP++ EQELRL+K+ TK+SVGVDVCMSYE + Y  LPEVQKALHANRT LPY W
Sbjct  290  VLLDVCYPTLFEQELRLKKMGTKMSVGVDVCMSYEEQLYLTLPEVQKALHANRTHLPYSW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TDGN +ILP++KRI+++ IPVW+FSGD+DSV+PLLGSRTLVR LA ++ 
Sbjct  350  SMCSGLLNYDDTDGNRNILPIIKRIVKSKIPVWVFSGDEDSVIPLLGSRTLVRGLAEELN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWFH+ QVGGW  EYG LLTFATVRGA+HMV +AQPSRALHLF+SFV GRRL
Sbjct  410  FNTTVPYGAWFHKGQVGGWVIEYGNLLTFATVRGAAHMVSYAQPSRALHLFTSFVLGRRL  469

Query  210  PNMTRPSIDD  181
            PN + P + D
Sbjct  470  PNKSPPPLHD  479



>gb|EMS56738.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=433

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 161/222 (73%), Gaps = 32/222 (14%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKIS+GVDVCMSYER FYFNLPEVQ ALHANRT LPYGW
Sbjct  212  VILDVCYPSIVMQELRLRKYVTKISLGVDVCMSYERYFYFNLPEVQHALHANRTHLPYGW  271

Query  570  SMCS--------------------------------RFLHYNETDGNIDILPLLKRIIRN  487
             MCS                                  L+Y + DGNI+ILPLL+RI+ +
Sbjct  272  GMCSDNKYVKREESVRVNELLIFATQTHMDHLKSCPSVLNYTDKDGNINILPLLQRIVEH  331

Query  486  HIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLT  307
            +IPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY  WF + QVGGW TEYG LLT
Sbjct  332  NIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYSTWFRKGQVGGWTTEYGNLLT  391

Query  306  FATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSIDD  181
            FATVRGASHMVPFAQP RAL LF SFV G+RLPN T P I D
Sbjct  392  FATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPIGD  433



>ref|XP_009767155.1| PREDICTED: serine carboxypeptidase-like 42 isoform X1 [Nicotiana 
sylvestris]
Length=475

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL K  TK+SVGVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  287  VILDVCYPSIVQQELRLHKQVTKMSVGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEW  346

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+++DG+ D+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA+D+ 
Sbjct  347  TMCSDVLNYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDSVVPLIGSRTLVRELANDLK  406

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K TV YGAWFH+ QVGGW  EYG  LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRL
Sbjct  407  MKTTVAYGAWFHKGQVGGWQIEYGDKLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRL  466

Query  210  PNMTRPSI  187
            PN TR  I
Sbjct  467  PNTTRIPI  474



>ref|NP_175046.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
 sp|Q9MAR8.1|SCP44_ARATH RecName: Full=Serine carboxypeptidase-like 44; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF63101.1|AC006423_2 Putative serine carboxypeptidases [Arabidopsis thaliana]
 gb|AEE31996.1| serine carboxypeptidase-like 44 [Arabidopsis thaliana]
Length=479

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPS+ EQELRL+K+ T++S GVDVCMS+E + Y NLPEVQKALHANRTKLPY W
Sbjct  290  ILLDVCYPSLFEQELRLKKMGTRMSFGVDVCMSFEEQLYLNLPEVQKALHANRTKLPYEW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y  TDGN ++LP+LKRI+++ +PVW+FSGD+DSV+PLLGSRTLV+ELA D+ 
Sbjct  350  SMCSSLLNYKYTDGNANMLPILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKELADDLN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWF + QVGGW  EYG LLTFATVRGA+HMVP++QPSRALHLF+SFV GR+L
Sbjct  410  FNTTVPYGAWFDKGQVGGWVVEYGNLLTFATVRGAAHMVPYSQPSRALHLFTSFVLGRKL  469

Query  210  PNMTRPSIDD  181
            P+ + P++ D
Sbjct  470  PHKSPPALHD  479



>ref|XP_004230572.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Solanum 
lycopersicum]
Length=477

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL K  TK+S+GVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  282  VILDVCYPSIVQQELRLHKQVTKMSMGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEW  341

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
             MCS  L+Y+++DG+ID+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA D+ 
Sbjct  342  RMCSE-LNYSQSDGDIDMLPSLKNIIQHDVPLWIFSGDQDSVVPLVGSRTLVRELARDLK  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH+ QVGGW  EYG+ LTFATVRGA+HMVP+AQPSRALHLF++FV G+RL
Sbjct  401  FKTTVPYGAWFHKGQVGGWQIEYGEKLTFATVRGAAHMVPYAQPSRALHLFTTFVHGKRL  460

Query  210  PNMTRPSID  184
            PN TR  I+
Sbjct  461  PNTTRIPIN  469



>ref|XP_002863806.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40065.1| hypothetical protein ARALYDRAFT_331179 [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPSIV QELRL+++ATK+S+GVDVCM+YER+FYFNLPEVQ ALHANRT LPY W
Sbjct  283  VLLDICYPSIVLQELRLKQMATKMSMGVDVCMTYERQFYFNLPEVQMALHANRTHLPYEW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            S+CS  L+Y+  D N ++LP LKRII+N IPVWIFSGDQDSVVP LG+RT+V+ELA D+ 
Sbjct  343  SLCSNLLNYSGIDINTNMLPTLKRIIQNKIPVWIFSGDQDSVVPFLGTRTVVQELADDLN  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYG WFH++QVGGWA EYG LLTFATVRGA+H+V + QPSRALHLFS+FVRG+RL
Sbjct  403  FKTTVPYGVWFHKRQVGGWAIEYGNLLTFATVRGAAHVVAYKQPSRALHLFSAFVRGQRL  462

Query  210  PNMTRPSIDD  181
            PN T     D
Sbjct  463  PNKTDIGFHD  472



>ref|XP_004502581.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=468

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 157/189 (83%), Gaps = 0/189 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+I EQELRL+K  TK S+ VDVCM YE   Y NLPEVQKALHANRT LPY W
Sbjct  280  VLLDVCYPAIAEQELRLKKTLTKRSLSVDVCMDYELFSYLNLPEVQKALHANRTILPYPW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            S CS  L+Y+ TD +I+ILP+LKRII NHIPVWI+SGD DSVVPLLGSRTL RELAHD+ 
Sbjct  340  SECSNILNYSSTDPDINILPILKRIIENHIPVWIYSGDADSVVPLLGSRTLTRELAHDLK  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +T  Y  WFH+ QVGGW TEYG LLTFATVRGA HMVPFAQPSR+LHLFSSFV+G+RL
Sbjct  400  FGITDSYRVWFHKGQVGGWVTEYGNLLTFATVRGAGHMVPFAQPSRSLHLFSSFVQGKRL  459

Query  210  PNMTRPSID  184
            PN T+PSID
Sbjct  460  PNTTKPSID  468



>ref|XP_002891272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=479

 Score =   298 bits (762),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD+CYPS+ EQELRL+K+ TK+S GVDVCMSYE + Y  LPEVQKALHANRT+LPY W
Sbjct  290  ILLDICYPSLFEQELRLKKMGTKMSFGVDVCMSYEEQLYLTLPEVQKALHANRTQLPYQW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L YN TDGN ++LP+LKRI+++ + VW+FSGDQDSV+PLLGSRTLV+ELA D+ 
Sbjct  350  SMCSSLLKYNYTDGNTNMLPILKRIVKSKVHVWVFSGDQDSVIPLLGSRTLVKELADDLN  409

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  TVPYGAWF + QVGGW  EYG L+TFATVRGA+HMVP++QPSRALHLF+SFV GRRL
Sbjct  410  FNTTVPYGAWFDKGQVGGWVIEYGNLVTFATVRGAAHMVPYSQPSRALHLFTSFVLGRRL  469

Query  210  PNMTRPSIDD  181
            P+ + P++ D
Sbjct  470  PHKSPPALHD  479



>ref|XP_002862434.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38692.1| hypothetical protein ARALYDRAFT_497456 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 161/189 (85%), Gaps = 0/189 (0%)
 Frame = -3

Query  747  FLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWS  568
             LD+CYPSIV +ELRL+++ATK+S+GVDVCM+YER+ YFNLPEVQ ALHANRT LPY WS
Sbjct  264  LLDICYPSIVLKELRLKQMATKMSMGVDVCMTYERQLYFNLPEVQMALHANRTHLPYSWS  323

Query  567  MCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGF  388
            MCS  L+Y+  D NI++LP LKR+I+N IPVWIFSGDQDSVVP LG+RT+VRELA+D+ F
Sbjct  324  MCSNLLNYSGIDANINMLPTLKRVIQNKIPVWIFSGDQDSVVPFLGTRTVVRELANDLNF  383

Query  387  KVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
            K TVPYG WFH++QVGGWA +YG +LTFATVRGA+H V   QPSRALHLFS+F+RG RLP
Sbjct  384  KTTVPYGVWFHKRQVGGWAIDYGNILTFATVRGAAHAVANTQPSRALHLFSTFLRGHRLP  443

Query  207  NMTRPSIDD  181
            N T  ++ D
Sbjct  444  NKTDIAMHD  452



>gb|EMT33269.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=487

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 160/222 (72%), Gaps = 32/222 (14%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV QELRLRK  TKIS+GVDVCMSYER FYFNLPEVQ ALHANRT LPYGW
Sbjct  266  VILDVCYPSIVMQELRLRKYVTKISLGVDVCMSYERYFYFNLPEVQHALHANRTHLPYGW  325

Query  570  SMCS--------------------------------RFLHYNETDGNIDILPLLKRIIRN  487
             MCS                                  L+Y + DGNI+ILPLL+RI+ +
Sbjct  326  GMCSDNKYVKREESVRVNELLIFATQTHMDHLKSCPSVLNYTDKDGNINILPLLRRIVEH  385

Query  486  HIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLT  307
             IP+WIFSGDQDSVVPLLGSRTLVRELAHDMG  VTVPY  WF + QVGGW TEYG LLT
Sbjct  386  KIPLWIFSGDQDSVVPLLGSRTLVRELAHDMGLPVTVPYSTWFRKGQVGGWTTEYGNLLT  445

Query  306  FATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSIDD  181
            FATVRGASHMVPFAQP RAL LF SFV G+RLPN T P I D
Sbjct  446  FATVRGASHMVPFAQPDRALGLFRSFVLGQRLPNTTYPPIGD  487



>gb|ACR37535.1| unknown [Zea mays]
Length=178

 Score =   287 bits (734),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 147/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  714  QELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNET  535
            QELRLR+ ATKISVGVDVCMSYER FYFNLPEVQ+ALHANRT L Y WSMCS FL+Y+ T
Sbjct  2    QELRLRQFATKISVGVDVCMSYERFFYFNLPEVQQALHANRTHLKYQWSMCSDFLNYSNT  61

Query  534  DGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFH  355
            DGNID+LP L+RI+   IP+W+FSGDQDSVVPLLGSR+LVRELAH MG  VTVPY  WF 
Sbjct  62   DGNIDMLPTLQRIVERKIPLWVFSGDQDSVVPLLGSRSLVRELAHTMGLHVTVPYSTWFR  121

Query  354  RKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSI  187
            + QVGGW TEYG  LTFATVRGASHMVPFAQP RAL LF S V GRRLPN T P I
Sbjct  122  KGQVGGWVTEYGNFLTFATVRGASHMVPFAQPDRALGLFRSIVLGRRLPNATSPPI  177



>ref|XP_002865553.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41812.1| hypothetical protein ARALYDRAFT_494807 [Arabidopsis lyrata subsp. 
lyrata]
Length=473

 Score =   297 bits (760),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
              LD+CYPSIV +ELRL+++ATK+S+GVDVCM+YER+ YFNLPEVQ ALHANRT LPY W
Sbjct  284  FLLDICYPSIVLKELRLKQMATKMSMGVDVCMTYERQLYFNLPEVQMALHANRTHLPYSW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  D NI++LP LKR+I+N IPVWIFSGDQDSVVP LG+RT+VRELA+D+ 
Sbjct  344  SMCSNLLNYSGIDANINMLPTLKRVIQNKIPVWIFSGDQDSVVPFLGTRTVVRELANDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYG WFH++QVGGWA EYG +LTFATVRGA+H V   QPS+ALHLFS+F+RG RL
Sbjct  404  FKTTVPYGVWFHKRQVGGWAIEYGNILTFATVRGAAHAVANTQPSQALHLFSTFLRGHRL  463

Query  210  PNMTRPSIDD  181
            PN T  ++ D
Sbjct  464  PNKTDIAMHD  473



>ref|XP_010110480.1| Serine carboxypeptidase-like 42 [Morus notabilis]
 gb|EXC26581.1| Serine carboxypeptidase-like 42 [Morus notabilis]
Length=442

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 151/190 (79%), Gaps = 31/190 (16%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRKLATKIS+GVDVCMSYERRFYFNLPEVQ ALHANRTKLPY W
Sbjct  284  VILDVCYPSIVEQELRLRKLATKISLGVDVCMSYERRFYFNLPEVQHALHANRTKLPYPW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCSR                               GDQDSVVPLLGSRTL+RELAH++ 
Sbjct  344  SMCSR-------------------------------GDQDSVVPLLGSRTLIRELAHELK  372

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK+TVPYGAWFH+ QVGGWATEYG LLTFATVRGASHMVPFAQPSRALHLFSSFV GRRL
Sbjct  373  FKITVPYGAWFHKGQVGGWATEYGNLLTFATVRGASHMVPFAQPSRALHLFSSFVHGRRL  432

Query  210  PNMTRPSIDD  181
            PN TRPSIDD
Sbjct  433  PNNTRPSIDD  442



>gb|EMS54298.1| Serine carboxypeptidase-like 42 [Triticum urartu]
Length=402

 Score =   287 bits (735),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            DVCYPSIV QELRLRK  TKIS+GVDVCMSYE  FYFNLPEVQ ALHANRT LPY WSMC
Sbjct  217  DVCYPSIVMQELRLRKYVTKISLGVDVCMSYEGNFYFNLPEVQHALHANRTHLPYSWSMC  276

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
            S  L++   D   +ILPLL+RI+   IPVW+FSGDQDSVVPLL +RTLVRELAH MG  V
Sbjct  277  SDVLNFTGKDVYTNILPLLQRIVEQKIPVWVFSGDQDSVVPLLRTRTLVRELAHAMGLPV  336

Query  381  TVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNM  202
            TVPY +WF + QVGGWATEYG +LTFATVRGASHMVPF+QP RAL LF SFV G+RLPN 
Sbjct  337  TVPYSSWFRKGQVGGWATEYGNMLTFATVRGASHMVPFSQPDRALGLFRSFVLGQRLPNT  396

Query  201  TRPSID  184
            T   ID
Sbjct  397  THRPID  402



>ref|NP_199038.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
 sp|Q9FH06.1|SCP41_ARATH RecName: Full=Serine carboxypeptidase-like 41; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10196.1| serine carboxypeptidase-II like [Arabidopsis thaliana]
 gb|AAO22761.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AAO42380.1| putative serine carboxypeptidase-II [Arabidopsis thaliana]
 gb|AED94783.1| serine carboxypeptidase-like 41 [Arabidopsis thaliana]
Length=469

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            D+CYPSI  QELRL+++ATK+S+GVDVCM+YER+FY N+PEVQ ALHANRT LPY WS+C
Sbjct  283  DLCYPSIALQELRLKQMATKMSMGVDVCMNYERQFYLNIPEVQMALHANRTNLPYSWSLC  342

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
            S  L+Y+  D N ++LP LKRII+N IPV IFSGDQDSVVP LG+RT+V ELA+D+ FK 
Sbjct  343  SNLLNYSAIDVNTNMLPTLKRIIQNKIPVRIFSGDQDSVVPFLGTRTIVGELANDLNFKT  402

Query  381  TVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNM  202
            TVPYG WFH++QVGGWA EYG LLTFATVRGA+H V + QPSRALHLFS+F+RG+RLPN 
Sbjct  403  TVPYGVWFHKRQVGGWAIEYGNLLTFATVRGAAHAVAYTQPSRALHLFSTFLRGQRLPNK  462

Query  201  TRPSIDD  181
            T  ++ D
Sbjct  463  TDIAMHD  469



>ref|XP_004515138.1| PREDICTED: serine carboxypeptidase-like 42-like [Cicer arietinum]
Length=470

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSI EQEL+L+K+A+KIS+ VD+CM  E  FY NL EVQK LHANRTKL Y W
Sbjct  281  VILDVCYPSIAEQELKLKKMASKISLSVDICMDSEIYFYLNLQEVQKCLHANRTKLSYPW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y  TD +I +LP+LKRI++NHIP+ I+SGDQDSVVPL+GSR+LVR+LA D+ 
Sbjct  341  SMCSDVLNYKNTDHDISMLPVLKRIVQNHIPILIYSGDQDSVVPLIGSRSLVRQLARDLK  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F +T PY  WFH+ Q GGW TEYG LLTFATVRGA HMVP+AQPSRALHLFSSFV G+RL
Sbjct  401  FNITDPYRVWFHKGQAGGWVTEYGNLLTFATVRGAGHMVPYAQPSRALHLFSSFVGGKRL  460

Query  210  PNMTRPSIDD  181
            PN TR S+ +
Sbjct  461  PNTTRLSVGE  470



>gb|AFK38452.1| unknown [Lotus japonicus]
Length=160

 Score =   272 bits (696),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  657  MSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIP  478
            MS+ER  YFNLPEVQKALHANRT LPY WSMCS  L+Y+ETD  I+ILP+LKRI++NHIP
Sbjct  1    MSFERSLYFNLPEVQKALHANRTNLPYKWSMCSPVLNYSETDPKINILPILKRIVKNHIP  60

Query  477  VWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFAT  298
            VW+ SGDQDSVVPLLGSRTL+RELAH++ +KVTVPYGAWFH+ QVGGW TEYG LLTFAT
Sbjct  61   VWVLSGDQDSVVPLLGSRTLIRELAHELQYKVTVPYGAWFHKGQVGGWVTEYGNLLTFAT  120

Query  297  VRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSI  187
            VRGA+HMVP+AQPSRAL LFS+FVRG RLPN TRPS+
Sbjct  121  VRGAAHMVPYAQPSRALGLFSAFVRGSRLPNTTRPSL  157



>ref|XP_007019399.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
 gb|EOY16624.1| Serine carboxypeptidase-like 42 isoform 3, partial [Theobroma 
cacao]
Length=439

 Score =   280 bits (716),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRLRK+ATKIS+GVDVCM+YERRFY NLPEVQ ALHANRTKLPY W
Sbjct  284  VLLDVCYPSIVEQELRLRKMATKISLGVDVCMTYERRFYLNLPEVQMALHANRTKLPYPW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  + Y++TDGNIDILP+LK+II+N IPVW+FSGDQDSVVPLLGSRTLVRELAHD+ 
Sbjct  344  SMCSGQIKYSDTDGNIDILPILKKIIQNGIPVWVFSGDQDSVVPLLGSRTLVRELAHDLN  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGAS  283
            FK+TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+
Sbjct  404  FKITVPYGAWFHKHQVGGWVTEYGNLLTFATVRGAA  439



>emb|CAN74668.1| hypothetical protein VITISV_005686 [Vitis vinifera]
Length=480

 Score =   273 bits (699),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 158/199 (79%), Gaps = 10/199 (5%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRLRK+ TKIS+GVDVCM+ ER FYFNLPEVQKALHANRT LPY W
Sbjct  260  VILDVCYPSIVQQELRLRKVVTKISIGVDVCMTAERTFYFNLPEVQKALHANRTNLPYRW  319

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            + CS  L YNE D N+D+LPLLKRI+++ IPVWIFSGDQDSVVPL+GSRTLVRELA D+ 
Sbjct  320  TTCSNILFYNEGDSNLDMLPLLKRILQDKIPVWIFSGDQDSVVPLMGSRTLVRELAKDLN  379

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQ--PSRALHLFSSFVR-G  220
            F+ TVPYGAWFH+ QVGGW TEYG LLTFATVRGA+HMV  A   P   L+  S+  R G
Sbjct  380  FQHTVPYGAWFHKGQVGGWQTEYGNLLTFATVRGAAHMVTVASTGPRPILNQTSTDPRPG  439

Query  219  R-------RLPNMTRPSID  184
            R       ++ N++RP +D
Sbjct  440  REGYWDREKVFNLSRPVLD  458



>gb|KGN47484.1| hypothetical protein Csa_6G338160 [Cucumis sativus]
Length=806

 Score =   281 bits (718),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIVEQELRL+KLATKIS+GVDVCM+YERRFYFNLPEVQKALHANRT LPY W
Sbjct  285  VLLDVCYPSIVEQELRLKKLATKISMGVDVCMTYERRFYFNLPEVQKALHANRTNLPYEW  344

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L YN  D NI++LPLL+RI+RNHIP+WI+SGD+DSVVPLLGSRTLVRELAHD+ 
Sbjct  345  SMCSDTLDYNYDDTNINMLPLLQRIVRNHIPLWIYSGDEDSVVPLLGSRTLVRELAHDLK  404

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHM  277
             KVTVPYGAWFH+ QVGGWA EYG  LTFATVRGASHM
Sbjct  405  LKVTVPYGAWFHKGQVGGWAIEYGNTLTFATVRGASHM  442



>ref|XP_009767156.1| PREDICTED: serine carboxypeptidase-like 42 isoform X2 [Nicotiana 
sylvestris]
Length=445

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -3

Query  729  PSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFL  550
            P    Q +      TK+SVGVDVCM+ ER FYFNLPEVQKALHANRT LPY W+MCS  L
Sbjct  264  PISCNQAIDEAYKVTKMSVGVDVCMTSERYFYFNLPEVQKALHANRTNLPYEWTMCSDVL  323

Query  549  HYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPY  370
            +Y+++DG+ D+LP LK II++ +P+WIFSGDQDSVVPL+GSRTLVRELA+D+  K TV Y
Sbjct  324  NYSQSDGDTDMLPSLKNIIQHDVPLWIFSGDQDSVVPLIGSRTLVRELANDLKMKTTVAY  383

Query  369  GAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPS  190
            GAWFH+ QVGGW  EYG  LTFATVRGA+HMVP+AQPSRALHLFSSFV GRRLPN TR  
Sbjct  384  GAWFHKGQVGGWQIEYGDKLTFATVRGAAHMVPYAQPSRALHLFSSFVHGRRLPNTTRIP  443

Query  189  I  187
            I
Sbjct  444  I  444



>emb|CDX93108.1| BnaA03g38300D [Brassica napus]
Length=449

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 151/190 (79%), Gaps = 17/190 (9%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+++ATKIS+GV                 Q+ALHANRT+LPY W
Sbjct  277  VLLDVCYPSIVQQELRLKQMATKISMGV-----------------QQALHANRTRLPYQW  319

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y +TD +I +LP+LKRII+N  PVWIFSGDQD+VVPLLGSRTLVRELAH + 
Sbjct  320  SMCSSLVNYRDTDASISMLPILKRIIQNKTPVWIFSGDQDAVVPLLGSRTLVRELAHHLN  379

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            F  T+PY  WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQPSRALH+FSSFV GRRL
Sbjct  380  FTTTLPYRPWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRL  439

Query  210  PNMTRPSIDD  181
            PN T  S D+
Sbjct  440  PNNTHYSPDE  449



>emb|CDY70042.1| BnaCnng66490D [Brassica napus]
Length=449

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 152/190 (80%), Gaps = 17/190 (9%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QEL+L+++ATKIS+GV                 Q+ALHANRT+LPY W
Sbjct  277  VLLDVCYPSIVQQELKLKQMATKISMGV-----------------QQALHANRTRLPYQW  319

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  ++Y +TD +I++LP+LKRII+N  PVWIFSGDQD+VVPLLGSRTLVRELAH + 
Sbjct  320  SMCSSLVNYRDTDASINMLPILKRIIQNKTPVWIFSGDQDAVVPLLGSRTLVRELAHHLN  379

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK T+PY  WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQPSRALH+FSSFV GRRL
Sbjct  380  FKTTLPYRPWFHKNQVGGWVTEYGKLLTFATVRGAAHMVPYAQPSRALHMFSSFVHGRRL  439

Query  210  PNMTRPSIDD  181
             N T  S D+
Sbjct  440  HNNTHYSPDE  449



>gb|ABK25236.1| unknown [Picea sitchensis]
Length=469

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PS++EQELRLRK  + +S+GVDVCM+ ER+FYFNLP VQKALHANRT LPY W
Sbjct  286  VILDVCPPSLIEQELRLRKKVSHMSLGVDVCMTSERQFYFNLPNVQKALHANRTNLPYDW  345

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y+  D  IDILP+LK II+  I VWIFSGDQDSVVPL+GSRT VR LA+D+ 
Sbjct  346  SMCSNVLNYSGYDEGIDILPVLKDIIQQGIRVWIFSGDQDSVVPLMGSRTNVRNLANDLK  405

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
              V VPY AW+H  QV GW T YG LLTFATVRGASHMVP++QP+RALHLF +F+ G+ L
Sbjct  406  MSVKVPYRAWYHEGQVAGWTTVYGDLLTFATVRGASHMVPYSQPARALHLFRTFLSGKDL  465

Query  210  PN  205
            P+
Sbjct  466  PD  467



>emb|CDX81435.1| BnaC09g08460D [Brassica napus]
Length=413

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  681  ISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLK  502
            +S+GVDVCM +ER+ YFNLP VQ ALH NRT LPY WSMCS  ++Y+  DGNI++LP+LK
Sbjct  248  MSMGVDVCMKHERQLYFNLPAVQHALHVNRTSLPYQWSMCSTLVNYSGIDGNINMLPILK  307

Query  501  RIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEY  322
            RII+N   VWI SGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEY
Sbjct  308  RIIQNKTYVWISSGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKNQVGGWVTEY  367

Query  321  GKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNMTRPSIDD  181
            GK+LTFATVRGA+HMVP+A PSRALH+FSSFVRGRRLPN T  S D+
Sbjct  368  GKILTFATVRGAAHMVPYA-PSRALHIFSSFVRGRRLPNSTHYSPDE  413



>ref|NP_178937.2| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 sp|Q84W27.1|SCP43_ARATH RecName: Full=Serine carboxypeptidase-like 43; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAO42304.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC06202.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=442

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 141/192 (73%), Gaps = 28/192 (15%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+                           ALHANRT+LPY W
Sbjct  277  ILLDVCYPSIVQQELRLKKM--------------------------NALHANRTRLPYEW  310

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+  DG ID+LP LKRII+N  PVWIFSGDQDSV+PL  SRTLVRELA D+ 
Sbjct  311  TMCSNRLNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAEDLN  370

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK T+PYGAWFH++QVGGW TEYG LLTFATVRGA+HMVP+A+PSRALH+FSSF+ GRRL
Sbjct  371  FKTTIPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRL  430

Query  210  PNM--TRPSIDD  181
            PN    + S DD
Sbjct  431  PNKPDLKSSTDD  442



>gb|KDO83620.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83621.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=185

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGW
Sbjct  51   VILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGW  110

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  111  SMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  170

Query  390  FKVTVPYGAWFHRKQ  346
            F+VTVPYGAWFH++Q
Sbjct  171  FEVTVPYGAWFHKQQ  185



>ref|XP_002885858.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62117.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 141/192 (73%), Gaps = 28/192 (15%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+                           ALHANRT+LPY W
Sbjct  286  VLLDVCYPSIVQQELRLKKM--------------------------NALHANRTRLPYEW  319

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+  DG ID+LP+LKRII+N  PVWIFSGDQDSV+PL  SRT VRELA D+ 
Sbjct  320  TMCSNRLNYSGIDGYIDMLPILKRIIQNQTPVWIFSGDQDSVIPLQSSRTRVRELAQDLN  379

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            FK TVPYGAWFH++QVGGW TEYG LLTFATVRGA+HMV +A+PSRALH+FS+FV GRRL
Sbjct  380  FKTTVPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVAYAEPSRALHMFSTFVTGRRL  439

Query  210  PNM--TRPSIDD  181
            PN    + SIDD
Sbjct  440  PNKPDLKSSIDD  451



>ref|NP_001031351.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
 gb|AEC06203.1| serine carboxypeptidase-like 43 [Arabidopsis thaliana]
Length=443

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 141/193 (73%), Gaps = 29/193 (15%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYPSIV+QELRL+K+                           ALHANRT+LPY W
Sbjct  277  ILLDVCYPSIVQQELRLKKM--------------------------NALHANRTRLPYEW  310

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MCS  L+Y+  DG ID+LP LKRII+N  PVWIFSGDQDSV+PL  SRTLVRELA D+ 
Sbjct  311  TMCSNRLNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAEDLN  370

Query  390  FKVTVPYGAWFHRKQ-VGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRR  214
            FK T+PYGAWFH++Q VGGW TEYG LLTFATVRGA+HMVP+A+PSRALH+FSSF+ GRR
Sbjct  371  FKTTIPYGAWFHKEQVVGGWVTEYGNLLTFATVRGAAHMVPYAEPSRALHMFSSFMNGRR  430

Query  213  LPNM--TRPSIDD  181
            LPN    + S DD
Sbjct  431  LPNKPDLKSSTDD  443



>gb|KDO83619.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=265

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGW
Sbjct  131  VILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGW  190

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  191  SMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  250

Query  390  FKVTVPYGAWFHRKQ  346
            F+VTVPYGAWFH++Q
Sbjct  251  FEVTVPYGAWFHKQQ  265



>gb|KDO83617.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83618.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=304

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGW
Sbjct  170  VILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGW  229

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  230  SMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  289

Query  390  FKVTVPYGAWFHRKQ  346
            F+VTVPYGAWFH++Q
Sbjct  290  FEVTVPYGAWFHKQQ  304



>ref|XP_006434389.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
 gb|ESR47629.1| hypothetical protein CICLE_v10000998mg [Citrus clementina]
Length=424

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+YER FY NLPEVQKALHANRT LPYGW
Sbjct  290  VILDVCYPAIVEQELRLRKMATKMSVGVDVCMTYERFFYLNLPEVQKALHANRTNLPYGW  349

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCSR L+Y++ D NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  350  SMCSRVLNYSDADSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  409

Query  390  FKVTVPYGAWFHRKQ  346
            F+VTVPYGAWFH++Q
Sbjct  410  FEVTVPYGAWFHKQQ  424



>gb|KDO83614.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
 gb|KDO83615.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=423

 Score =   235 bits (600),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVCYP+IVEQELRLRK+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGW
Sbjct  289  VILDVCYPTIVEQELRLRKMATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGW  348

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMCS  L+Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ 
Sbjct  349  SMCSGVLNYSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLN  408

Query  390  FKVTVPYGAWFHRKQ  346
            F+VTVPYGAWFH++Q
Sbjct  409  FEVTVPYGAWFHKQQ  423



>ref|XP_002990798.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ08071.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=467

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PSIVEQE RL+K     S+GVDVCMSYER +YFNLPEVQKALHAN T LPY W
Sbjct  283  IILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFNLPEVQKALHANTTGLPYPW  342

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            + C   + Y+  D  +DI+P+L+ +++N + VW+FSGD+D+VVP LG+R  V  LA ++ 
Sbjct  343  TNCDGPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELK  402

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             + T  Y AWF R QVGGWA  +G  LTFATVRGA+HMVP AQP+RAL LF  F+ G+ L
Sbjct  403  LRTTASYKAWFLRTQVGGWAESFGN-LTFATVRGAAHMVPLAQPARALLLFQKFISGQPL  461

Query  210  P  208
            P
Sbjct  462  P  462



>ref|XP_002974500.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ24722.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=471

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PSIVEQE RL+K     S+GVDVCMSYER +YFNLPEVQKALHAN T LPY W
Sbjct  287  IILDVCVPSIVEQEFRLKKRMGHRSIGVDVCMSYERYYYFNLPEVQKALHANTTGLPYPW  346

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            + C   + Y+  D  +DI+P+L+ +++N + VW+FSGD+D+VVP LG+R  V  LA ++ 
Sbjct  347  TNCDGPVQYDINDMRLDIVPVLRDLLKNGLRVWVFSGDEDAVVPFLGTRVNVNSLAQELK  406

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             + T  Y AWF R QVGGWA  +G  LTFATVRGA+HMVP AQP+RAL LF  F+ G+ L
Sbjct  407  LRTTASYKAWFLRTQVGGWAESFGN-LTFATVRGAAHMVPLAQPARALLLFQKFISGQPL  465

Query  210  P  208
            P
Sbjct  466  P  466



>emb|CDY51660.1| BnaC03g66990D [Brassica napus]
Length=441

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 133/187 (71%), Gaps = 18/187 (10%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            D+CYPSIV+QE RL+K+AT +S+G         +  F  P         R    +   +C
Sbjct  273  DLCYPSIVQQEPRLKKMATHMSIG---------KVLFQSP---------RGPTRFFCLLC  314

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
               ++Y+  D NI +LPLLKRII+N  PVWIFSGDQDS+VP LG+RT +RELAHD+ F  
Sbjct  315  HSLVNYHGIDSNITMLPLLKRIIQNKTPVWIFSGDQDSIVPFLGTRTNIRELAHDLNFST  374

Query  381  TVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPNM  202
            T+PYG WFH+ QVGGW TEYGKLLTFATVRGA+HMVP+AQP+RALH+FS FVRGRRLPN 
Sbjct  375  TLPYGHWFHKDQVGGWVTEYGKLLTFATVRGAAHMVPYAQPARALHMFSFFVRGRRLPNN  434

Query  201  TRPSIDD  181
            T    D+
Sbjct  435  THYPHDE  441



>emb|CDY37202.1| BnaA09g08230D [Brassica napus]
Length=456

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 138/192 (72%), Gaps = 17/192 (9%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPE--VQKALHANRTKLPY  577
            + LDVC+PSI+EQELRL+K+AT++S+GVDV       F F  P    + +   + + LP 
Sbjct  280  VLLDVCFPSIIEQELRLKKMATQMSMGVDV-------FIFQSPSGATRSSREPHSSTLPM  332

Query  576  GWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHD  397
             +      L ++  +         KRII+N   VWIFSGDQDSVVPLLGSRTLVRELAHD
Sbjct  333  VYVQHPGKLQWHGREH--------KRIIQNKTSVWIFSGDQDSVVPLLGSRTLVRELAHD  384

Query  396  MGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGR  217
            + F  T+PYG WFH+ QVGGW TEYGK+LTFATVRGA+HMVP+AQPSRALH+FSSFVRGR
Sbjct  385  LNFSTTLPYGPWFHKNQVGGWVTEYGKILTFATVRGAAHMVPYAQPSRALHIFSSFVRGR  444

Query  216  RLPNMTRPSIDD  181
            RLPN T  S D+
Sbjct  445  RLPNSTHYSPDE  456



>ref|XP_002967656.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ31003.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PSI  QE+RL++   + S GVD+C+  ER  YFNLPEVQ+ LHAN T LPY W
Sbjct  281  VILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNLPEVQRELHANTTGLPYSW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMC+  + Y   DG+ +++PLL  I++  + VWIFSGDQDSVVPL G+R+L+  LA  +G
Sbjct  341  SMCTGPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLG  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             + T PY AW+   QV GW   YG  LT+AT+RGA+HMVP+AQP RAL LF SF+RG  L
Sbjct  401  MQTTQPYTAWYQGGQVAGWTQSYGN-LTYATIRGAAHMVPYAQPERALLLFRSFIRGNAL  459

Query  210  P  208
            P
Sbjct  460  P  460



>ref|XP_002964377.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ34710.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=464

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 128/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PSI  QE+RL++   + S GVD+C+  ER  YFNLPEVQ+ LHAN T L Y W
Sbjct  281  VILDVCLPSIFLQEVRLKQQMAQKSYGVDICIDKERDVYFNLPEVQRELHANTTGLSYSW  340

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            SMC+  + Y   DG+ +++PLL  I++  + VWIFSGDQDSVVPL G+R+L+  LA  +G
Sbjct  341  SMCTGPVDYAMQDGSTNMVPLLGDILKAGLRVWIFSGDQDSVVPLTGTRSLIGGLAKSLG  400

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             + T PY AW+   QV GW   YG  LT+AT+RGA+HMVP+AQP RAL LF SF+RG  L
Sbjct  401  MQTTQPYTAWYQGGQVAGWTQSYGN-LTYATIRGAAHMVPYAQPERALLLFRSFIRGNAL  459

Query  210  P  208
            P
Sbjct  460  P  460



>gb|KDO83616.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=211

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  690  ATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILP  511
            ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGWSMCS  L+Y++TD NI+ILP
Sbjct  97   ATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLNYSDTDSNINILP  156

Query  510  LLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQ  346
            +LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYGAWFH++Q
Sbjct  157  VLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYGAWFHKQQ  211



>gb|KDO83613.1| hypothetical protein CISIN_1g0117641mg, partial [Citrus sinensis]
Length=394

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -3

Query  726  SIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLH  547
            S +E      K+ATK+SVGVDVCM+ ER FY NLPEVQKALHANRT LPYGWSMCS  L+
Sbjct  268  SCIEAITEANKIATKMSVGVDVCMTLERFFYLNLPEVQKALHANRTNLPYGWSMCSGVLN  327

Query  546  YNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYG  367
            Y++TD NI+ILP+LKRII+N IPVW+FSGDQDSVVPLLGSRTL+RELA D+ F+VTVPYG
Sbjct  328  YSDTDSNINILPVLKRIIQNGIPVWVFSGDQDSVVPLLGSRTLIRELARDLNFEVTVPYG  387

Query  366  AWFHRKQ  346
            AWFH++Q
Sbjct  388  AWFHKQQ  394



>ref|XP_002961948.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ37208.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=480

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PS+  QELRL++  T+ S GVDVC+  ER  Y N   VQ+ALHAN T L Y W
Sbjct  298  VILDVCLPSLFLQELRLKQHITQKSYGVDVCIDDERDLYLNDYRVQQALHANVTGLNYKW  357

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MC   + Y   DG+IDI+PLL+ I++  + VW+FSGDQDSVVPL G+RT++  L   + 
Sbjct  358  TMCDGPVQYYLQDGSIDIVPLLQSIVKTGLRVWVFSGDQDSVVPLTGTRTIINGLGKSLN  417

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
               TVPY AW+   QV GW   YG  LT+AT+RGA+HMVP+AQP+RAL LF +F+ G+ L
Sbjct  418  LPATVPYTAWYLGGQVAGWTQVYGN-LTYATIRGAAHMVPYAQPARALLLFQTFLSGQTL  476

Query  210  P  208
            P
Sbjct  477  P  477



>ref|XP_002971138.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ27736.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=475

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LDVC PS+  QELRL++  T+ S GVDVC+  ER  Y N   VQ+ALHAN T L Y W
Sbjct  293  VILDVCLPSLFLQELRLKQHITQKSYGVDVCIDDERDLYLNDYRVQQALHANVTGLNYKW  352

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            +MC   + Y   DG+IDI+PLL+ I++  + VW+FSGDQDSVVPL G+RT++  L   + 
Sbjct  353  TMCDGPVQYYLQDGSIDIVPLLQNIVKTGLRVWVFSGDQDSVVPLTGTRTIINGLGKSLN  412

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
               TVPY AW+   QV GW   YG  LT+AT+RGA+HMVP+AQP+RAL LF +F+ G+ L
Sbjct  413  LPATVPYTAWYLGGQVAGWTQVYGN-LTYATIRGAAHMVPYAQPARALLLFQTFLSGQTL  471

Query  210  P  208
            P
Sbjct  472  P  472



>ref|XP_002972012.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26929.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 125/181 (69%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD C P  V QE RLRK+ ++ S+GVD+C++ ER  YF  PEVQ+ALHAN T LPY W
Sbjct  284  VLLDACLPEAVHQEFRLRKMKSQRSIGVDICITRERTRYFRRPEVQRALHANTTGLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            S C   L+Y+  + NID++ +L+ ++   + ++I+SGD DSVVP LG+RT++  + + + 
Sbjct  344  SNCEGPLYYDNGNLNIDMVTVLENLLVQGLRIFIYSGDADSVVPFLGTRTIIDSIVNRLR  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K  VPY AW+ + QV GW    G  LTFATV+GA HMVP+AQP+RAL +F +FV  + L
Sbjct  404  LKTLVPYSAWYSQSQVAGWTQVTGN-LTFATVKGAGHMVPYAQPTRALVMFQAFVNNKNL  462

Query  210  P  208
            P
Sbjct  463  P  463



>ref|XP_008798399.1| PREDICTED: serine carboxypeptidase-like 42 [Phoenix dactylifera]
Length=335

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 121/186 (65%), Gaps = 5/186 (3%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKL--ATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWS  568
            DVC P I+ Q + L KL          DVC+ +E   Y N P+VQKALHAN T LPY W 
Sbjct  152  DVCPPPILHQAILLHKLMGVAGQKDATDVCIDHEITRYLNKPDVQKALHANLTSLPYPWE  211

Query  567  MCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGF  388
             CSR ++YN TD   D++P+L R+++  +PVWIFSGDQDSVVPL G+R+ + +LA  +  
Sbjct  212  ACSRIVNYNATDQLTDMIPILARLVKKGLPVWIFSGDQDSVVPLTGTRSQIAKLAQQLKL  271

Query  387  KVTVPYGAWFHRKQVGGWATEYGK-LLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
            K   PY  W+   QVGGW+  YG   L +ATVR  SHMVP+AQP RAL LF+ F+ G+ L
Sbjct  272  KPKSPYQPWYAHGQVGGWSETYGNGRLVYATVRDGSHMVPYAQPERALVLFTRFIEGKLL  331

Query  210  PNMTRP  193
            P  +RP
Sbjct  332  P--SRP  335



>ref|XP_002972549.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
 gb|EFJ26635.1| serine carboxypeptidase-like enzyme [Selaginella moellendorffii]
Length=465

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 123/181 (68%), Gaps = 1/181 (1%)
 Frame = -3

Query  750  MFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            + LD C P  V QE RLRK+ ++ S+GVD+C++ ER  YF  PEVQ+ALHAN T LPY W
Sbjct  284  VLLDACLPEAVHQEFRLRKMKSQRSIGVDICITRERTRYFRRPEVQRALHANTTGLPYEW  343

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            S C   L Y+  + NID++ +L+ ++   + ++I+SGD DSVVP LG+RT++  + + + 
Sbjct  344  SNCEGPLFYDNGNLNIDMVTVLENLLVQGLRIFIYSGDADSVVPFLGTRTIIDSIVNRLR  403

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K  VPY AW+ + QV GW    G  LTFATV+GA HMVP+AQP RAL +F +FV  + L
Sbjct  404  LKTLVPYSAWYSQSQVAGWTQVTGN-LTFATVKGAGHMVPYAQPMRALVMFQAFVNNKNL  462

Query  210  P  208
            P
Sbjct  463  P  463



>ref|XP_006830556.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
 gb|ERM97972.1| hypothetical protein AMTR_s00117p00106310 [Amborella trichopoda]
Length=486

 Score =   190 bits (482),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 126/199 (63%), Gaps = 11/199 (6%)
 Frame = -3

Query  774  LVNM*TTTMFLDVCYPSIVEQELRLRKL-------ATKISVGVDVCMSYERRFYFNLPEV  616
             +NM   T  LDVC P IV Q L L KL       + + S  VDVC+ +E   Y N P V
Sbjct  287  FINMYDVT--LDVCAPPIVHQALLLHKLMGHLVETSKEGSDEVDVCIDHELTRYLNHPTV  344

Query  615  QKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPL  436
            Q+ALHAN T LPY W  CS  + Y   D   D+LPLLK ++++ + +WIFSGDQDSVVPL
Sbjct  345  QRALHANLTSLPYAWEACSDIVDYKYEDQLEDMLPLLKDLVKSRVRIWIFSGDQDSVVPL  404

Query  435  LGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKL--LTFATVRGASHMVPFAQ  262
             G+R+ +  LAH +  K  +PY AW+   QVGGW   Y +   L +ATVRGA+HMVP+AQ
Sbjct  405  TGTRSQLTTLAHHLRLKTMIPYSAWYANGQVGGWVEAYEESLGLVYATVRGAAHMVPYAQ  464

Query  261  PSRALHLFSSFVRGRRLPN  205
            P RAL LFSSF+  + LP+
Sbjct  465  PERALILFSSFLHAQPLPS  483



>gb|EMT31513.1| Serine carboxypeptidase-like 42 [Aegilops tauschii]
Length=433

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 118/187 (63%), Gaps = 27/187 (14%)
 Frame = -3

Query  741  DVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMC  562
            DVCYPSIV QELRLRK ATKIS+GVDVCMSYE  FYFNLPEVQ ALHANRT LPYGWS C
Sbjct  273  DVCYPSIVMQELRLRKYATKISLGVDVCMSYEGSFYFNLPEVQHALHANRTHLPYGWSKC  332

Query  561  SRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKV  382
            S      +    +D+    +R    ++P                      E+ H +    
Sbjct  333  SGV---TKISLGVDVCMSYERYFYFNLP----------------------EVQHALHANR  367

Query  381  T-VPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
            T +PYG W     VGGWAT+YG +LTFATVRGASHMVPF+QP RAL LF SFV G+RLPN
Sbjct  368  THLPYG-WSMCSGVGGWATQYGNMLTFATVRGASHMVPFSQPDRALGLFRSFVLGQRLPN  426

Query  204  MTRPSID  184
             T   ID
Sbjct  427  TTHRPID  433



>ref|XP_010413849.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 118/179 (66%), Gaps = 1/179 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q  R+     ++   VDVC+  E   Y N  +VQKALHA R      WS+
Sbjct  285  LDVCIPSVLSQSKRVNPQPQQMGEAVDVCVEDETVNYLNRRDVQKALHA-RLVGTRKWSV  343

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++ R+++  +PV ++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  344  CSNVLDYEVLDVEVPTINIVGRLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLADELGLR  403

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
             TVPY  WF  +QVGGW   YG +L FATVRGA+H VPF+QP+RAL LF +F+ GR LP
Sbjct  404  TTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>ref|XP_010469459.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=466

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 117/179 (65%), Gaps = 1/179 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q  R+     ++   VDVC+  E   Y N  +VQKALHA R      W++
Sbjct  286  LDVCIPSVLSQSKRVNPQPQQVGEAVDVCVEDETVNYLNRRDVQKALHA-RLVGTRNWAV  344

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV ++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  345  CSNVLDYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLR  404

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
             TVPY  WF  +QVGGW   YG +L FATVRGA+H VPF+QP+RAL LF +F+ GR LP
Sbjct  405  TTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFSQPARALVLFKAFMGGRPLP  463



>ref|XP_009415855.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q L L     ++   +DVC+  E   Y N
Sbjct  266  VMSQVTRETSRFVDKYDVT--LDVCISSVLSQSLVLS--PQQVPENIDVCIEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA  T +   W++CS  L Y   +  I  + L+  +++  IPV ++SGDQDS
Sbjct  322  RKDVQDALHARLTGVT-KWTVCSSVLQYELLNLEIPTITLVGSLLKARIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV++LA++MG K TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVQKLANEMGLKTTVPYRVWFEGKQVGGWTQVYGDILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF++GR LP 
Sbjct  441  SQPERSLVLFRSFLQGRPLPE  461



>ref|XP_007223032.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24231.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=464

 Score =   179 bits (455),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 124/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L  L  +++  +DVC+  E   Y N
Sbjct  267  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKVL--LPQQVTEAIDVCVEDEIVNYLN  322

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I    ++ ++I+  IPV ++SGDQDS
Sbjct  323  RPDVQKALHARLVGV-RQWAVCSNILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDS  381

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +G   TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  382  VIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEAPF  441

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  442  SQPERSLVLFKSFLEGRPLPEV  463



>ref|XP_008222371.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Prunus 
mume]
Length=464

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L  L  +++  +DVC+  E   Y N
Sbjct  267  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKVL--LPQQVTEAIDVCVEDEIVNYLN  322

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  323  RPDVQKALHARLVGV-RQWAVCSNILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  381

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +G   TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  382  VIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNMLSFATIRGASHEAPF  441

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ G+ LP +
Sbjct  442  SQPERSLVLFKSFLEGQPLPEV  463



>gb|KJB31552.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=316

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 117/181 (65%), Gaps = 7/181 (4%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            LDVC  S++ Q     ++ T   VG  +DVC+  E   Y N  +VQKALHA    + + W
Sbjct  138  LDVCISSVLSQS----EILTTQQVGDTIDVCVEDETVNYLNRQDVQKALHARLVGV-HKW  192

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            ++CS  L Y   D  I  + ++ R+++  IPV ++SGDQDSV+PL GSR LV +LA ++G
Sbjct  193  AVCSSVLDYELLDLEIPTITIVGRLVKAGIPVMVYSGDQDSVIPLTGSRKLVNQLAEELG  252

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF+QP R+L LF +F+ GR L
Sbjct  253  LKTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEAPFSQPERSLVLFKAFLEGRPL  312

Query  210  P  208
            P
Sbjct  313  P  313



>ref|XP_007223033.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
 gb|EMJ24232.1| hypothetical protein PRUPE_ppa005360mg [Prunus persica]
Length=465

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 123/202 (61%), Gaps = 4/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y N
Sbjct  267  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKVLLP-QQQVTEAIDVCVEDEIVNYLN  323

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I    ++ ++I+  IPV ++SGDQDS
Sbjct  324  RPDVQKALHARLVGV-RQWAVCSNILDYQLLDVEIPTTTIVGKLIKAGIPVLVYSGDQDS  382

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +G   TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  383  VIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEAPF  442

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  443  SQPERSLVLFKSFLEGRPLPEV  464



>ref|XP_009378815.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 125/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L  L  +++  +DVC+  E   Y N
Sbjct  265  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKAL--LPQQVADSIDVCVEDEVVNYLN  320

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  321  RPDVQKALHARLVGV-RQWAVCSNILDYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  379

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +    TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  380  VIPLTGSRTLVHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPF  439

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF++GR LP +
Sbjct  440  SQPERSLVLFKSFLKGRPLPEV  461



>ref|XP_008222370.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Prunus 
mume]
Length=465

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 124/202 (61%), Gaps = 4/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y N
Sbjct  267  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKVLLP-QQQVTEAIDVCVEDEIVNYLN  323

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  324  RPDVQKALHARLVGV-RQWAVCSNILDYQLLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  382

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +G   TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  383  VIPLTGSRTLVHRLAEQLGLNTTVPYRVWFEGQQVGGWTQAYGNMLSFATIRGASHEAPF  442

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ G+ LP +
Sbjct  443  SQPERSLVLFKSFLEGQPLPEV  464



>ref|XP_010509871.1| PREDICTED: serine carboxypeptidase-like 46 [Camelina sativa]
Length=465

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 117/180 (65%), Gaps = 1/180 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q  R+     ++   VDVC+  E   Y N  +VQKALHA R      WS+
Sbjct  285  LDVCIPSVLSQSKRVNPQPQEMGETVDVCVEDETVNYLNRRDVQKALHA-RLVGTRKWSV  343

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV ++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  344  CSNVLDYEVLDVEVPTINIVGTLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLR  403

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TVPY  WF  +QVGGW   YG +L FATVRGA+H VPF+QP+RAL LF +F+ G  LP+
Sbjct  404  TTVPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFSQPARALVLFKAFLGGLPLPD  463



>ref|XP_009380118.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=467

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 130/201 (65%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + L     +++  VDVC+  E   Y N
Sbjct  266  VMSQVTRETSRFVDKYDVT--LDVCISSVLSQSMVLS--PQQVTERVDVCVEDETVSYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHAN   +   W++CS  + Y   +  +  + ++  ++++ IPV ++SGDQDS
Sbjct  322  RKDVQAALHANLVGVT-KWTVCSSVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA+++G K T+PY AWF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  381  VIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDVLSFATVRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  441  SQPERSLVLFRAFLQGRPLPE  461



>ref|XP_002268172.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CBI35664.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 124/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  266  VMSQVGRETSRFVDKYDVT--LDVCISSVLSQSKVLS--PQQVTETIDVCVEDETESYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   WS+CS  L Y   D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  322  RRDVQKALHARLVGVN-KWSVCSNILDYELLDLEIPTISIVGKLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVHGLAEELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F+ GR LP 
Sbjct  441  SQPERSLVLFRAFLGGRPLPQ  461



>ref|XP_009359890.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=463

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+V Q   L  L  +++  +DVC+  E   Y N
Sbjct  266  VMSQVSRETSKFVDKYDVT--LDVCISSVVSQSKAL--LPQEVADTIDVCVDDEIVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y + D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  322  RPDVQKALHARLVGV-RQWAVCSTILDYQQLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR LV  LA  +    TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNMLSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  441  SQPERSLVLFKSFLEGRPLPEV  462



>ref|XP_009380117.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 130/201 (65%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + L     +++  VDVC+  E   Y N
Sbjct  288  VMSQVTRETSRFVDKYDVT--LDVCISSVLSQSMVLSP--QQVTERVDVCVEDETVSYLN  343

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHAN   +   W++CS  + Y   +  +  + ++  ++++ IPV ++SGDQDS
Sbjct  344  RKDVQAALHANLVGVT-KWTVCSSVIEYELLNLEVPTISIVGSLVKSGIPVLVYSGDQDS  402

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA+++G K T+PY AWF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  403  VIPLTGSRTLVQRLANELGLKTTIPYRAWFEGEQVGGWTQVYGDVLSFATVRGASHEAPF  462

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  463  SQPERSLVLFRAFLQGRPLPE  483



>ref|XP_008390188.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=462

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 125/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L  L  +++  +DVC+  E   Y N
Sbjct  265  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKAL--LPQQVADSIDVCVEDEVVNYLN  320

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    + + W++CS  L Y   D  I  + ++ ++I+  IPV ++SGDQDS
Sbjct  321  RPDVQKALHARLVGVRH-WAVCSNILGYQVLDVEIPTITIVGKLIKAGIPVLVYSGDQDS  379

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTL+  LA  +    TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  380  VIPLTGSRTLIHGLAEQLRLNTTVPYRVWFEGQQVGGWTQVYGNMLSFATIRGASHEAPF  439

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  440  SQPERSLVLFKSFLEGRPLPEV  461



>ref|XP_010929656.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   L     ++   +DVC+  E   Y N
Sbjct  266  VMGQVTRETSRFVDKYDVT--LDVCISSVLSQSKVLS--PQQVPEHIDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ A+HA  T +P  WS+CS  L Y   +  I  + ++  ++R+ IPV ++SGDQDS
Sbjct  322  RKDVQDAMHARLTGVP-KWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA ++  K TVPY  WF  KQVGGW   YG +LTFAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVQRLAKELKLKTTVPYRVWFEDKQVGGWTQVYGDILTFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  441  SQPERSLVLFRAFLQGRPLPE  461



>ref|NP_850212.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
 sp|Q8VY01.1|SCP46_ARATH RecName: Full=Serine carboxypeptidase-like 46; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL67013.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC08849.1| serine carboxypeptidase-like 46 [Arabidopsis thaliana]
Length=465

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 116/179 (65%), Gaps = 1/179 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q   +     ++   VDVC+  E   Y N  +VQKALHA R      W++
Sbjct  285  LDVCIPSVLSQSKVVSPQPQQVGETVDVCLEDETVNYLNRRDVQKALHA-RLVGTRKWTV  343

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV+++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  344  CSDVLDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLR  403

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
             TVPY  WF  +QVGGW   YG  L FATVRGA+H VPF+QP+RAL LF +F+ GR LP
Sbjct  404  TTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  462



>gb|KDP23272.1| hypothetical protein JCGZ_23105 [Jatropha curcas]
Length=463

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 123/200 (62%), Gaps = 5/200 (3%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   L     ++   +DVC+  E   Y N
Sbjct  266  VMGQVSRETSRFVDKYDVT--LDVCISSVLAQSNALS--PKQVGDNIDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   D  I  + ++ R+IR  IPV ++SGDQDS
Sbjct  322  RQDVQKALHARLVGVRR-WTVCSNILDYELLDLEIPTIAIVGRLIRAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLVR LA  +G K +VPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVRGLAEKLGLKTSVPYRVWFGGQQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F+ GR LP
Sbjct  441  SQPERSLVLFKAFLEGRPLP  460



>ref|XP_002304645.2| hypothetical protein POPTR_0003s16250g [Populus trichocarpa]
 gb|EEE79624.2| hypothetical protein POPTR_0003s16250g [Populus trichocarpa]
Length=343

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 124/200 (62%), Gaps = 4/200 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S + Q  ++     ++   +DVC+  E   Y N
Sbjct  145  VMSQVTRETSRFVDKYDVT--LDVCISSALSQS-KILSPQQQLGDNIDVCVEDETVNYLN  201

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQ ALHA    +   W++CS  L Y   D  I  + ++ R+I+  IPV ++SGDQDS
Sbjct  202  RPDVQMALHARLVGVRR-WAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDS  260

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G + TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  261  VIPLTGSRTLVHGLAEELGLQTTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEAPF  320

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F+ G+ LP
Sbjct  321  SQPERSLVLFKAFLGGQPLP  340



>ref|XP_008777393.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Phoenix 
dactylifera]
Length=463

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 125/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  266  VMGQVTQETSRFVDKYDVT--LDVCISSVLSQSKVLS--PQQVTENIDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA    +P  WS+CS  L Y   +  I  + ++  ++R+ IPV ++SGDQDS
Sbjct  322  RKDVQDALHARLAGVP-KWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA ++  K TVPY  WF  KQVGGW   YG +LTFAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDILTFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  441  SQPERSLVLFRAFLQGRPLPE  461



>ref|XP_006438865.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52105.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=273

 Score =   169 bits (429),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 10/204 (5%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG---VDVCMSYERRF  637
            VM+   R+T+  V+    T  LDVC  S++ Q     K+ T   VG   VDVC+  E   
Sbjct  75   VMSLVSRETSRFVDKYDVT--LDVCISSVLSQS----KVLTPKQVGETTVDVCVEDETVN  128

Query  636  YFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGD  457
            Y N  +VQKALHA    +  GW++CS  L Y   D  I  + ++ ++++  IPV ++SGD
Sbjct  129  YLNRKDVQKALHARLVGV-RGWAVCSNILDYELLDLEIPTITVVGKLVKAGIPVMVYSGD  187

Query  456  QDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHM  277
            QDSV+PL GSR LV  LA ++  + TVPY  WF  +QVGGW   YG +L+FAT+RGASH 
Sbjct  188  QDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHE  247

Query  276  VPFAQPSRALHLFSSFVRGRRLPN  205
             PF+QP R+L LF +F+  R LP 
Sbjct  248  APFSQPERSLVLFEAFLDSRPLPE  271



>ref|XP_009404114.1| PREDICTED: serine carboxypeptidase-like 45 [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 129/201 (64%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + L     +++  VDVC+  E   Y N
Sbjct  266  VMSQVTRETSRFVDKYDVT--LDVCISSVLSQSMVLSP--QQVTERVDVCVEDETVRYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA+   +   W++CS  L Y   D  +  + ++  ++++ IPV ++SGDQDS
Sbjct  322  RRDVQSALHAHLDGVT-KWTVCSSVLEYELLDLEVPTISVVGSLVKSGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA+++G K TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  381  VIPLTGSRTLVQRLANELGLKTTVPYRVWFEGEQVGGWTQVYGDVLSFATVRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  441  SQPERSLVLFRAFLQGRPLPE  461



>ref|XP_007038110.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOY22611.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 126/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + L     ++S  VDVC+  +   Y N
Sbjct  266  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSMVLN--PQQVSERVDVCVEDKIVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   +  I  + ++  +I+  IPV ++SGDQDS
Sbjct  322  RKDVQKALHALLVGVRR-WAVCSNILDYQLLNLEIPTISIVGSLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLVR LA ++G + TVPY  WF  KQVGGW   YG +L FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVRGLAKELGLETTVPYRVWFEGKQVGGWTQVYGNILAFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ G+ LP +
Sbjct  441  SQPERSLMLFKSFLEGKPLPEV  462



>ref|XP_006294161.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
 gb|EOA27059.1| hypothetical protein CARUB_v10023154mg [Capsella rubella]
Length=465

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 116/180 (64%), Gaps = 1/180 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q   +     ++   VDVC+  E   Y N  +VQKALHA R      W++
Sbjct  285  LDVCIPSVLSQSKVVNPQPQQMGETVDVCVEDETVNYLNRRDVQKALHA-RLVGTRKWAV  343

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV ++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  344  CSNVLDYEVLDVEVPTINIVGSLVKARVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLR  403

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             T PY  WF  +QVGGW   YG +L FATVRGA+H VPF+QP+RAL LF +F+ GR LP+
Sbjct  404  TTGPYRVWFAGQQVGGWTQVYGNILAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLPD  463



>ref|XP_008777392.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Phoenix 
dactylifera]
Length=474

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 125/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  277  VMGQVTQETSRFVDKYDVT--LDVCISSVLSQSKVLS--PQQVTENIDVCVEDETVNYLN  332

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA    +P  WS+CS  L Y   +  I  + ++  ++R+ IPV ++SGDQDS
Sbjct  333  RKDVQDALHARLAGVP-KWSVCSSVLEYELLNLEIPTISVVGSLVRSGIPVLVYSGDQDS  391

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA ++  K TVPY  WF  KQVGGW   YG +LTFAT+RGASH  PF
Sbjct  392  VIPLTGSRTLVQRLAKELKLKTTVPYRVWFAGKQVGGWTQVYGDILTFATIRGASHEAPF  451

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  452  SQPERSLVLFRAFLQGRPLPE  472



>ref|XP_002881286.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57545.1| hypothetical protein ARALYDRAFT_482299 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 115/179 (64%), Gaps = 1/179 (1%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q   +     ++   VDVC+  E   Y N  +VQ+ALHA R      W++
Sbjct  276  LDVCIPSVLSQSKVVNPQPQQVGETVDVCVEDETVNYLNRRDVQRALHA-RLVGTRKWAV  334

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV ++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  335  CSNVLDYEVLDVEVPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVKRLAEELGLR  394

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
             TVPY  WF  +QVGGW   YG  L FATVRGA+H VPF+QP+RAL LF +F+ GR LP
Sbjct  395  TTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  453



>ref|XP_010682654.1| PREDICTED: serine carboxypeptidase-like 45 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 124/204 (61%), Gaps = 9/204 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VM+   R+T+  V+    T  LDVC PSI  Q     K  T   VG  +DVC+  E   Y
Sbjct  276  VMSLVSRETSRFVDKYDVT--LDVCLPSIFSQS----KFLTPHQVGETIDVCVEDETVGY  329

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQKALHA    +   W++CSR L Y   D     + L+  +++  IPV I+SGDQ
Sbjct  330  LNRRDVQKALHARLVGVN-SWTVCSRILDYEMLDLERPTIHLIGNLVKAGIPVLIYSGDQ  388

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSVVPL GSRTLV+ LA ++    TVPY  WF  KQVGGW   +G LL+FATVRGASH  
Sbjct  389  DSVVPLTGSRTLVKRLAEELKLNTTVPYRVWFVGKQVGGWTEVHGDLLSFATVRGASHEA  448

Query  273  PFAQPSRALHLFSSFVRGRRLPNM  202
            PF+QP R+L LF SF+ G+ LP +
Sbjct  449  PFSQPERSLVLFKSFLEGKPLPEV  472



>ref|XP_006410496.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
 gb|ESQ51949.1| hypothetical protein EUTSA_v10016623mg [Eutrema salsugineum]
Length=462

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 126/203 (62%), Gaps = 9/203 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VMT    +T+  V+    T  LDVC PS++ Q     K+     VG  VDVC+  E   Y
Sbjct  265  VMTQVSTETSRFVDKYDVT--LDVCIPSVLSQS----KVVNPQQVGETVDVCVEDETVNY  318

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQKALHA R      W++CS  L Y   D  +  + ++  +++  +PV ++SGDQ
Sbjct  319  LNRRDVQKALHA-RLVGTRKWAVCSNVLDYELLDVEVPTVNIVGSLVKAGVPVLVYSGDQ  377

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV+ LA ++G + TVPY  WF  +QVGGW   YG++L FATVRGA+H V
Sbjct  378  DSVIPLTGSRTLVKRLAEELGLRTTVPYRVWFAGQQVGGWTQVYGEILAFATVRGAAHEV  437

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF +F+ GR LP 
Sbjct  438  PFSQPERSLVLFKAFLGGRPLPE  460



>ref|XP_011073181.1| PREDICTED: serine carboxypeptidase-like 45 [Sesamum indicum]
Length=458

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 121/200 (61%), Gaps = 5/200 (3%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+++  VN    T  LDVC PS++ Q   +     + S  +DVC+  E   Y N
Sbjct  261  VMSLVNRESSRFVNKYDVT--LDVCIPSVLSQSKIIA--PQRNSERIDVCVEDETVSYLN  316

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y+  D  I  + ++  +I+  IPV I+SGDQDS
Sbjct  317  RRDVQKALHARLVGV-RRWDVCSNILDYDMLDLEIPTISIIGSLIKEGIPVLIYSGDQDS  375

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +G   TVPY  WF  +QVGGW   YG LL+FAT+RGASH  PF
Sbjct  376  VIPLTGSRTLVHRLAKQLGLNTTVPYRVWFEGQQVGGWTQVYGNLLSFATIRGASHEAPF  435

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+  LF SF+ GR LP
Sbjct  436  SQPERSFVLFKSFLDGRPLP  455



>gb|KJB31548.1| hypothetical protein B456_005G196500 [Gossypium raimondii]
Length=463

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 117/181 (65%), Gaps = 7/181 (4%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            LDVC  S++ Q     ++ T   VG  +DVC+  E   Y N  +VQKALHA    + + W
Sbjct  285  LDVCISSVLSQS----EILTTQQVGDTIDVCVEDETVNYLNRQDVQKALHARLVGV-HKW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            ++CS  L Y   D  I  + ++ R+++  IPV ++SGDQDSV+PL GSR LV +LA ++G
Sbjct  340  AVCSSVLDYELLDLEIPTITIVGRLVKAGIPVMVYSGDQDSVIPLTGSRKLVNQLAEELG  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF+QP R+L LF +F+ GR L
Sbjct  400  LKTTVPYRVWFEGQQVGGWTQAYGNILSFATIRGASHEAPFSQPERSLVLFKAFLEGRPL  459

Query  210  P  208
            P
Sbjct  460  P  460



>gb|AFK49319.1| unknown [Lotus japonicus]
Length=224

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+    +T+  V+    T  LDVC  S+  Q   L     + +  +DVC+  E   Y N
Sbjct  27   VMSQVTTETSRFVDKYDVT--LDVCISSVFSQTKVLS--PQQGTETIDVCVEDEAANYLN  82

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA+   +   WS+CS  L+Y   D  I  +  + ++++  +PV ++SGDQDS
Sbjct  83   RKDVQSALHAHLVGVQR-WSVCSNVLNYEFRDLEIPTITAVSKLVKAGLPVLVYSGDQDS  141

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV +LA ++G K TVPY  WF  KQVGGW   YG + +FAT+RGASH  PF
Sbjct  142  VIPLTGSRTLVHQLAKELGLKTTVPYRVWFEGKQVGGWTQVYGNIPSFATIRGASHEAPF  201

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF++G  LP 
Sbjct  202  SQPERSLVLFRSFLQGHALPE  222



>ref|XP_007139316.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
 gb|ESW11310.1| hypothetical protein PHAVU_008G019100g [Phaseolus vulgaris]
Length=461

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 123/203 (61%), Gaps = 5/203 (2%)
 Frame = -3

Query  813  NCVMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFY  634
            + VM+    +T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y
Sbjct  262  SSVMSQVSTETSRFVDKYDVT--LDVCLSSVFSQTKVLN--PQQVTETIDVCVEDETVNY  317

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ ALHA    +   WS CS  L Y   D  I  + ++ ++++  IPV ++SGDQ
Sbjct  318  LNRKDVQSALHARLVGVQR-WSACSNVLDYELRDLEIPTITVVGKLVQEGIPVLVYSGDQ  376

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV +LA  +G K TVPY  WF ++QVGGW   YG +L+FAT+RGASH  
Sbjct  377  DSVIPLTGSRTLVHKLAKKLGLKTTVPYRVWFEKQQVGGWTQVYGDILSFATIRGASHEA  436

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP RAL LF SF+ GR +P 
Sbjct  437  PFSQPERALVLFKSFLEGRPMPQ  459



>ref|XP_011020860.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 124/200 (62%), Gaps = 4/200 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S + Q  ++     ++   +DVC+  E   Y N
Sbjct  265  VMNQVTRETSRFVDKYDVT--LDVCISSALSQS-KILSPQQQLGDNIDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I  + ++ R+I+  IPV ++SGDQDS
Sbjct  322  RPDVQKALHARLVGVRR-WAVCSNILDYELLDLEIPTISIVGRLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G + TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVHGLAEELGLQTTVPYRVWFGGQQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F+ G+ LP
Sbjct  441  SQPERSLVLFKAFLGGQPLP  460



>ref|XP_002297872.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE82677.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=454

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 125/203 (62%), Gaps = 9/203 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VM+   R+T+  V+    T  LDVC  S++ Q     K+ T   VG  VDVC+  E   Y
Sbjct  257  VMSQVTRETSRFVDKYDVT--LDVCISSVLSQS----KVLTPQQVGDNVDVCVEDETVNY  310

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N P+VQ ALHA    +   W++CS  L Y   D  I  + ++ R+I+  IPV ++SGDQ
Sbjct  311  LNRPDVQMALHARLVGVRR-WAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQ  369

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSR LV  L+ ++G K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  
Sbjct  370  DSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEA  429

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF +F+ G+ LP 
Sbjct  430  PFSQPERSLVLFKAFLGGQPLPE  452



>ref|XP_010044871.1| PREDICTED: serine carboxypeptidase-like 45 [Eucalyptus grandis]
 gb|KCW86989.1| hypothetical protein EUGRSUZ_B03549 [Eucalyptus grandis]
Length=473

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 127/202 (63%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   ++T+  V+    T  LDVC  S++ Q  RL     +++  +DVC+  E   Y N
Sbjct  276  VMSQVNKETSKFVDNYDVT--LDVCIASVMSQSRRLS--PQQVTDTIDVCVEDETVNYLN  331

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y+ T+  I  + +L ++I+  IPV ++SGDQDS
Sbjct  332  RQDVQKALHARLVGV-RKWAVCSDVLDYDLTNLEIPTITILGKLIKAGIPVLVYSGDQDS  390

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR LV  LA  +G   T+PY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  391  VIPLTGSRRLVHGLAEKLGLNTTIPYRVWFQGQQVGGWTQVYGNVLSFATIRGASHEAPF  450

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF++G+ LP +
Sbjct  451  SQPQRSLVLFKSFLQGQPLPEV  472



>ref|XP_002318164.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
 gb|EEE96384.2| hypothetical protein POPTR_0012s10730g [Populus trichocarpa]
Length=463

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 124/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM     +T+  V+    T  LDVC PS++ Q   +     ++S  +DVC+  E   Y N
Sbjct  266  VMKQVSTETSRFVDKYDVT--LDVCIPSVLSQSKVIS--PKQVSERIDVCIEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +V+KALHA    +   W +CS  L Y   +  I  + ++  +I+  IPV I+SGDQDS
Sbjct  322  REDVRKALHARLIGVRR-WEVCSNILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY AWF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF++G+ LP +
Sbjct  441  SQPERSLMLFKSFLQGKHLPEV  462



>gb|AAB80670.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=458

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 116/179 (65%), Gaps = 8/179 (4%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS++ Q       + ++   VDVC+  E   Y N  +VQKALHA R      W++
Sbjct  285  LDVCIPSVLSQ-------SKQVGETVDVCLEDETVNYLNRRDVQKALHA-RLVGTRKWTV  336

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   D  +  + ++  +++  +PV+++SGDQDSV+PL GSRTLV+ LA ++G +
Sbjct  337  CSDVLDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLR  396

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
             TVPY  WF  +QVGGW   YG  L FATVRGA+H VPF+QP+RAL LF +F+ GR LP
Sbjct  397  TTVPYRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLP  455



>ref|XP_011036160.1| PREDICTED: serine carboxypeptidase-like 45 isoform X2 [Populus 
euphratica]
Length=462

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 124/203 (61%), Gaps = 9/203 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VM    R+T+  V+    T  LDVC  S++ Q     K+ T   VG  VDVC+  E   Y
Sbjct  265  VMNQVTRETSRFVDKYDVT--LDVCISSVLSQS----KVLTPQQVGDNVDVCVEDETVNY  318

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N P+VQ ALHA    +   W++CS  L Y   D  I  + ++ R+I+  IPV ++SGDQ
Sbjct  319  LNRPDVQMALHARLVGVRR-WAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQ  377

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSR LV  L+ ++G K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  
Sbjct  378  DSVIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEA  437

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF +F+ G+ LP 
Sbjct  438  PFSQPERSLVLFKAFLGGQPLPE  460



>gb|EPS74304.1| hypothetical protein M569_00447, partial [Genlisea aurea]
Length=308

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 113/181 (62%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S++ Q  RL ++  +  V  DVC+  E   Y N  +V KALHA    +   WS+
Sbjct  126  LDVCLSSVLLQAARLNQIQYQQEV--DVCVEDEAVAYLNREDVHKALHARLVGVD-KWSV  182

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CSR L Y+  +  I    ++  +++  I V ++SGDQDSV+PLL +R  + ELA  +G  
Sbjct  183  CSRVLKYDRENLQIPTTSIVGSLVKAGIRVLVYSGDQDSVIPLLATRRNINELAKQLGLN  242

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             T+ YGAWF+ KQV GW   YG  L++AT+RGASH  PF+QP R+  LFSSFV G++LP 
Sbjct  243  ATLSYGAWFYAKQVAGWTQSYGDFLSYATIRGASHEAPFSQPERSYALFSSFVEGKQLPQ  302

Query  204  M  202
            +
Sbjct  303  L  303



>ref|XP_003520486.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 118/181 (65%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S  +Q   L ++  + +  +DVC+  +   Y N  +VQKALHA   ++   WS 
Sbjct  283  LDVCLSSANQQAYVLNQM--QETQKIDVCVDDKAVTYLNRKDVQKALHAKLVEVS-KWSA  339

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CSR LHY+  +  I  + +L  ++ ++I V ++SGDQDSV+PLLGSR+LV  LA ++G  
Sbjct  340  CSRVLHYDRRNLEIPTVSILGSLVNSNIRVLVYSGDQDSVIPLLGSRSLVNGLAKELGLN  399

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TV Y AWF RKQV GW   YG+LL++AT+RGASH  PF QP R+L L  +F+ G+ LPN
Sbjct  400  TTVAYRAWFERKQVAGWTQVYGELLSYATIRGASHEAPFTQPQRSLVLLKAFLEGKPLPN  459

Query  204  M  202
            +
Sbjct  460  V  460



>ref|XP_010942380.1| PREDICTED: serine carboxypeptidase-like 45 [Elaeis guineensis]
Length=463

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 125/201 (62%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  266  VMGQVTKETSRFVDKYDVT--LDVCISSVLSQSKVLS--PQQVTENIDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA  T +P  W++CS  L Y   +  +  + ++  ++R+ IP+ ++SGDQDS
Sbjct  322  RKDVQDALHARLTGVP-KWTVCSSVLEYELLNLEVPTISVVGSLVRSGIPILVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA ++    TVPY  WF  KQVGGW   YG +LTFAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVQRLAKELKLNTTVPYRVWFVGKQVGGWTQVYGDILTFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F++GR LP 
Sbjct  441  SQPERSLVLFRAFLQGRPLPE  461



>ref|XP_011036159.1| PREDICTED: serine carboxypeptidase-like 45 isoform X1 [Populus 
euphratica]
Length=463

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 123/201 (61%), Gaps = 4/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q  ++     ++   VDVC+  E   Y N
Sbjct  265  VMNQVTRETSRFVDKYDVT--LDVCISSVLSQS-KVLTPQQQVGDNVDVCVEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQ ALHA    +   W++CS  L Y   D  I  + ++ R+I+  IPV ++SGDQDS
Sbjct  322  RPDVQMALHARLVGVRR-WAVCSNILDYELLDLEIPTITIVGRLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR LV  L+ ++G K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRILVHRLSEELGLKTTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F+ G+ LP 
Sbjct  441  SQPERSLVLFKAFLGGQPLPE  461



>emb|CDY66771.1| BnaC02g44710D [Brassica napus]
Length=115

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = -3

Query  465  SGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGA  286
            SGDQDSVVPLLGSRTLVRELAHD+ F  T+PYG WFH+ QVGGW TEYG+LLTFATVRGA
Sbjct  14   SGDQDSVVPLLGSRTLVRELAHDLNFSTTLPYGPWFHKDQVGGWVTEYGELLTFATVRGA  73

Query  285  SHMVPFAQPSRALHLFSSFVRGRRLPNMT  199
            +HMVP+AQPSRALHLFS FVRGRRLPN T
Sbjct  74   AHMVPYAQPSRALHLFSGFVRGRRLPNNT  102



>ref|XP_006438863.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52103.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=343

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 10/204 (5%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG---VDVCMSYERRF  637
            VM+   R+T+  V+    T  LDVC  S++ Q     K+ T   VG   VDVC+  E   
Sbjct  145  VMSLVSRETSRFVDKYDVT--LDVCISSVLSQS----KVLTPKQVGETTVDVCVEDETVN  198

Query  636  YFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGD  457
            Y N  +VQKALHA    +  GW++CS  L Y   D  I  + ++ ++++  IPV ++SGD
Sbjct  199  YLNRKDVQKALHARLVGVR-GWAVCSNILDYELLDLEIPTITVVGKLVKAGIPVMVYSGD  257

Query  456  QDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHM  277
            QDSV+PL GSR LV  LA ++  + TVPY  WF  +QVGGW   YG +L+FAT+RGASH 
Sbjct  258  QDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHE  317

Query  276  VPFAQPSRALHLFSSFVRGRRLPN  205
             PF+QP R+L LF +F+  R LP 
Sbjct  318  APFSQPERSLVLFEAFLDSRPLPE  341



>ref|XP_006844530.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
 gb|ERN06205.1| hypothetical protein AMTR_s00016p00162700 [Amborella trichopoda]
Length=460

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 127/200 (64%), Gaps = 6/200 (3%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  SI+ Q   LR +  ++S  +DVC+  E   Y N
Sbjct  263  VMSLVSRETSKFVDKYDVT--LDVCISSILMQSKALRPM--QVSEPIDVCVEDETVNYLN  318

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA R      WS+CS  ++YN  +  I  + LL  ++++ IPV ++SGDQDS
Sbjct  319  RKDVQRALHA-RLSGDETWSVCSS-MNYNRLNLEIPTISLLGLVVKSGIPVLVYSGDQDS  376

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA  +    TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  377  VIPLTGSRTLVHGLAAKLHLNTTVPYRVWFEGEQVGGWTQVYGNILSFATIRGASHEAPF  436

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F++GR LP
Sbjct  437  SQPQRSLGLFRAFLQGRPLP  456



>ref|XP_008369640.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=463

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 121/202 (60%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+    +T+  V+    T  LDVC  S+  Q   L  L  +++  +DVC+  E   Y N
Sbjct  266  VMSQVSTETSKFVDKYDVT--LDVCISSVFSQSKAL--LPQEVADTIDVCVEDEIVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
             P+VQKALHA    +   W++CS  L Y   D  I  + ++  +I+  IPV ++SGDQDS
Sbjct  322  RPDVQKALHARLVGV-RQWAVCSTILDYQHLDVEIPTITIIGNLIKAGIPVLVYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR LV  LA  +    TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRKLVNGLAEQLRLSTTVPYRVWFGGQQVGGWTQVYGNMLSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP M
Sbjct  441  SQPERSLVLFKSFLEGRPLPEM  462



>ref|XP_010250555.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=498

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 126/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   ++T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  301  VMSRVSKETSRFVDKYDVT--LDVCISSVLSQSKVLN--PQQVTERIDVCVEDETVNYLN  356

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   +  I  + ++  +++  IPV ++SGDQDS
Sbjct  357  RRDVQKALHARLVGV-RRWAVCSNILDYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDS  415

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV ELA ++G   TVPY  WF  +QVGGW  +YG +L+FAT+RGASH  PF
Sbjct  416  VIPLTGSRTLVHELAMELGLNTTVPYRVWFAGQQVGGWTQDYGNILSFATIRGASHEAPF  475

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  476  SQPERSLVLFKSFLEGRPLPEV  497



>gb|KHN31265.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 124/201 (62%), Gaps = 3/201 (1%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   +   + + +  +DVC+  +   Y N
Sbjct  258  VMGQVSRETSKFVDKYDVT--LDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  315

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W +CS  L Y+  +  +  LP++  +I+  + V I+SGDQDS
Sbjct  316  RRDVQEALHAKLVGI-RKWDVCSNILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDS  374

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  375  VIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPF  434

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF+ GR LP+
Sbjct  435  SQPERSLVLFKSFLEGRPLPD  455



>gb|KHN08898.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=453

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+ +Q   L +L  + +  +DVC+  +   Y N  +VQKALHAN   +   WS 
Sbjct  275  LDVCLSSVNQQAYVLNQL--QETQKIDVCIGDKTTTYLNRKQVQKALHANLVGVT-KWST  331

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  LHY+  +  I  +P+L  ++++ I V ++SGDQDSV+PL+GSR+LV  LA ++G  
Sbjct  332  CSSVLHYDYQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLD  391

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TV Y AWF  KQV GW   YG +L++AT+RGASH  PF+QP R+L L  +F+ G+ LP 
Sbjct  392  TTVAYRAWFEGKQVAGWTKVYGNILSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLPG  451

Query  204  M  202
            +
Sbjct  452  V  452



>emb|CBI32794.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS+V Q  RL +   + +  +DVC+  E   Y N  +VQKALHA+   +   WS+
Sbjct  272  LDVCLPSVVSQSERLNQ--PRGTEKIDVCVEDETIKYLNRKDVQKALHAHLKGVSR-WSI  328

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   +  I  + ++  ++++ I V ++SGDQDSVVPL G+RTLV  LA D+G  
Sbjct  329  CSEVLKYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLN  388

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TVPY  WF  +QVGGW   YG  L+FAT+RGASH  PF+QP R+L LF++F++G+ LP 
Sbjct  389  TTVPYRNWFQGRQVGGWTQVYGDKLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPE  448

Query  204  MT  199
             T
Sbjct  449  AT  450



>ref|XP_006578724.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=469

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 124/201 (62%), Gaps = 3/201 (1%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   +   + + +  +DVC+  +   Y N
Sbjct  270  VMGQVSRETSKFVDKYDVT--LDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  327

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W +CS  L Y+  +  +  LP++  +I+  + V I+SGDQDS
Sbjct  328  RRDVQEALHAKLVGI-RKWDVCSNILDYDMLNLEVPTLPVVGSLIKAGVKVLIYSGDQDS  386

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  387  VIPLTGSRTLVQKLARQLGLNSTVPYRVWFEGQQVGGWTQVYGNILSFATVRGASHEAPF  446

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF+ GR LP+
Sbjct  447  SQPERSLVLFKSFLEGRPLPD  467



>gb|KFK44681.1| hypothetical protein AALP_AA1G289600 [Arabis alpina]
Length=225

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 120/203 (59%), Gaps = 8/203 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VM+    +T   V+    T  LDVC PS++ Q     K+ +   VG  VDVC+  E   Y
Sbjct  27   VMSQVSTETTRFVDKYDVT--LDVCIPSVLSQS----KVVSPNQVGESVDVCVEDETVSY  80

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ ALHA        W++CS  L Y   D     + ++  +++  +PV ++SGDQ
Sbjct  81   LNRRDVQAALHARLIGGVREWTVCSNVLDYELLDVEKPTINIVGSLVKAGVPVLVYSGDQ  140

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV  LA  +G + +VPY  WF  +QVGGW   YG +L+FATVRGASH V
Sbjct  141  DSVIPLTGSRTLVSRLAKRLGLRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGASHEV  200

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF +F+ G  LP 
Sbjct  201  PFSQPERSLVLFKAFLDGHPLPE  223



>ref|XP_010100042.1| Serine carboxypeptidase-like 45 [Morus notabilis]
 gb|EXB81213.1| Serine carboxypeptidase-like 45 [Morus notabilis]
Length=443

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y N
Sbjct  246  VMNQVSKETSRFVDKYDVT--LDVCISSVFAQCQVLS--PQQVAETIDVCVEDETVNYLN  301

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    + + W++CS  L Y   D  I  + ++ ++I+  +PV ++SGDQDS
Sbjct  302  RQDVQKALHARLVGV-HRWAVCSNVLDYELLDVEIPTITIVGKLIKAGVPVLVYSGDQDS  360

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV ELA  +    TVPY  WF  +QVGGW   YG +L FAT+RGASH  PF
Sbjct  361  VIPLTGSRTLVHELAEKLALNTTVPYRVWFEGQQVGGWTQVYGNMLAFATIRGASHEAPF  420

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF+ GR LP 
Sbjct  421  SQPERSLVLFKSFLEGRPLPE  441



>ref|XP_011042948.1| PREDICTED: serine carboxypeptidase-like 45 [Populus euphratica]
Length=463

 Score =   171 bits (432),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM     +T+  V+    T  LDVC PS++ Q   +     ++S  +DVC+  E   Y N
Sbjct  266  VMKQVSTETSRFVDKYDVT--LDVCIPSVLSQSKVISP--KQVSERIDVCIEDETVNYLN  321

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +V+KA HA    +   W +CS  L Y   +  I  + ++  +I+  IPV I+SGDQDS
Sbjct  322  REDVRKAFHARLIGVRR-WEVCSNILDYEVLNIEIPTINIVGSLIKAGIPVLIYSGDQDS  380

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY AWF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  381  VIPLTGSRTLVHRLAKELGLNTTVPYRAWFAGKQVGGWTQVYGNILSFATIRGASHEAPF  440

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF++G+ LP +
Sbjct  441  SQPERSLMLFKSFLQGKHLPEV  462



>gb|KHN30340.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=460

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+ +Q   L +L  + +  +DVC+  +   Y N  EVQ+ALHAN   +   WS 
Sbjct  282  LDVCLSSVNQQAYVLNQL--QETQKIDVCIGDKTTTYLNTKEVQEALHANLVGVA-KWST  338

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  LHY+  +  I  +P+L  ++ + I V ++SGDQDSV+PLLGSR+LV  LA ++G  
Sbjct  339  CSSVLHYDYQNLEIPTIPILGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLD  398

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TV Y AWF  KQV GW   YG +L++AT+RGASH  PF+QP R+L L  +F+ G+ LP 
Sbjct  399  TTVAYRAWFEGKQVAGWTQVYGNILSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLPG  458

Query  204  M  202
            +
Sbjct  459  V  459



>ref|XP_010653629.1| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
Length=461

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 3/182 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC PS+V Q  RL +   + +  +DVC+  E   Y N  +VQKALHA+   +   WS+
Sbjct  280  LDVCLPSVVSQSERLNQ--PRGTEKIDVCVEDETIKYLNRKDVQKALHAHLKGVSR-WSI  336

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  L Y   +  I  + ++  ++++ I V ++SGDQDSVVPL G+RTLV  LA D+G  
Sbjct  337  CSEVLKYEYRNLEIPTIHVVGAVLKSGIRVLVYSGDQDSVVPLTGTRTLVNGLAKDLGLN  396

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TVPY  WF  +QVGGW   YG  L+FAT+RGASH  PF+QP R+L LF++F++G+ LP 
Sbjct  397  TTVPYRNWFQGRQVGGWTQVYGDKLSFATIRGASHEAPFSQPERSLVLFNTFLQGKPLPE  456

Query  204  MT  199
             T
Sbjct  457  AT  458



>ref|XP_003554110.2| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 117/181 (65%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+ +Q   L +L  + +  +DVC+  +   Y N  +VQKALHAN   +   WS 
Sbjct  284  LDVCLSSVNQQAYVLNQL--QETQKIDVCIGDKTTTYLNRKQVQKALHANLVGVT-KWST  340

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  LHY+  +  I  +P+L  ++++ I V ++SGDQDSV+PL+GSR+LV  LA ++G  
Sbjct  341  CSSVLHYDYQNLEIPTIPILGSLVKSGIKVLVYSGDQDSVIPLIGSRSLVNGLAKEIGLD  400

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TV Y AWF  KQV GW   YG +L++AT+RGASH  PF+QP R+L L  +F+ G+ LP 
Sbjct  401  TTVAYRAWFEGKQVAGWTKVYGNILSYATIRGASHEAPFSQPQRSLLLLKAFLEGKPLPG  460

Query  204  M  202
            +
Sbjct  461  V  461



>ref|XP_003521119.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=462

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 116/181 (64%), Gaps = 3/181 (2%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+ +Q   L +L  + +  +DVC+  +   Y N  EVQ+ALHAN   +   WS 
Sbjct  284  LDVCLSSVNQQAYVLNQL--QETQKIDVCIGDKTTTYLNTKEVQEALHANLVGVA-KWST  340

Query  564  CSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFK  385
            CS  LHY+  +  I  +P+L  ++ + I V ++SGDQDSV+PLLGSR+LV  LA ++G  
Sbjct  341  CSSVLHYDYQNLEIPTIPILGSLVNSGIRVLVYSGDQDSVLPLLGSRSLVNGLAKEIGLD  400

Query  384  VTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLPN  205
             TV Y AWF  KQV GW   YG +L++AT+RGASH  PF+QP R+L L  +F+ G+ LP 
Sbjct  401  TTVAYRAWFEGKQVAGWTQVYGNILSYATIRGASHEAPFSQPQRSLGLLKAFLEGKPLPG  460

Query  204  M  202
            +
Sbjct  461  V  461



>ref|XP_008392759.1| PREDICTED: serine carboxypeptidase-like 45, partial [Malus domestica]
Length=322

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   ++T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  125  VMSQVSKETSKFVDKYDVT--LDVCISSVLSQSKVIS--PNQMTERIDVCVEDKTVNYLN  180

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y   +  I  + L++ +++  IPV ++SGDQDS
Sbjct  181  RKDVQKALHARLVGVR-RWDVCSNILDYQVLNLEIPTIXLVRSLVKQGIPVLVYSGDQDS  239

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR LV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  240  VIPLTGSRRLVYRLAMELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  299

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  300  SQPERSLRLFKSFLAGRPLPEV  321



>ref|XP_003577529.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=468

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 126/203 (62%), Gaps = 10/203 (5%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRL---RKLATKISVGVDVCMSYERRF  637
            VM    R+T+  V+    T  LDVC  S++ Q + L   R +  +I    DVC+  E   
Sbjct  269  VMNQVTRETSRFVDKYDVT--LDVCLASVLSQSMILSPHRHVGQRI----DVCIEDETVN  322

Query  636  YFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGD  457
            Y N  +VQ+ALHA    +   W++CS  L Y   +  I  + ++  ++++ I V ++SGD
Sbjct  323  YLNRKDVQEALHAKLIGVK-NWAVCSSVLQYELLNLQIPTINIVGSLVKSGIRVLVYSGD  381

Query  456  QDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHM  277
            QDSV+PL GSRTLV+ LAHD+G K + PY  WF  KQVGGW   YG +L+FAT+RGASH 
Sbjct  382  QDSVIPLTGSRTLVQNLAHDLGLKTSTPYRVWFEGKQVGGWTQVYGDMLSFATIRGASHE  441

Query  276  VPFAQPSRALHLFSSFVRGRRLP  208
             PF+QP R+L L+ +F++GR LP
Sbjct  442  APFSQPKRSLVLYRAFLQGRPLP  464



>ref|XP_004298533.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=466

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  269  VMSLVSRETSKFVDKYDVT--LDVCISSVLSQSKAIS--PNQMTERIDVCVEDKIVNYLN  324

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA    +   W +CS  L Y   D  I  + L+  I++  IPV ++SGDQDS
Sbjct  325  RKDVQNALHAKLVGVRR-WDVCSNILDYQMLDLEIPTISLVGSIVKAGIPVLVYSGDQDS  383

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  384  VIPLTGSRTLVDRLARELGLNTTVPYRVWFQGKQVGGWTQVYGNILSFATIRGASHEAPF  443

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF++GR LP +
Sbjct  444  SQPERSLVLFKSFLQGRPLPQV  465



>emb|CDY19500.1| BnaC04g10990D [Brassica napus]
Length=463

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 124/203 (61%), Gaps = 9/203 (4%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFY  634
            VM+    +T+  V+    T  LDVC PS++ Q     K+ +   VG  VDVC+  E   Y
Sbjct  266  VMSQVSTETSRFVDKYDVT--LDVCIPSVLSQS----KVVSPQQVGETVDVCVEDETVNY  319

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQKALHA R      W++CS  L Y   D  +  + ++  +I+  +PV ++SGDQ
Sbjct  320  LNRRDVQKALHA-RLVGTRKWAVCSNVLDYELLDVEVPTINIVGSLIKAGVPVLVYSGDQ  378

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L FATVRGA+H V
Sbjct  379  DSVIPLTGSRTLVKQLAQQLGLSTTVPYRVWFAGQQVGGWTQVYGNVLAFATVRGAAHEV  438

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF +F+ G  LP 
Sbjct  439  PFSQPERSLVLFKAFLGGNPLPE  461



>ref|XP_007159976.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
 gb|ESW31970.1| hypothetical protein PHAVU_002G282700g [Phaseolus vulgaris]
Length=344

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 119/196 (61%), Gaps = 3/196 (2%)
 Frame = -3

Query  789  RQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQK  610
            R+T+  V+    T  LDVC  S++ Q   +     KI+  +DVC+  +   Y N  +VQ+
Sbjct  151  RETSRFVDKYDVT--LDVCISSVLSQSKAICPQGQKINESIDVCVDDKVTNYLNRKDVQE  208

Query  609  ALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLG  430
            ALHA    +   W +CS  L Y+  +     LP++  +I+  + V I+SGDQDSV+PL G
Sbjct  209  ALHAKLVGV-RKWDVCSNILDYDMLNLEKPTLPVVGSLIKAGVRVLIYSGDQDSVIPLTG  267

Query  429  SRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRA  250
            SRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF+QP R+
Sbjct  268  SRTLVQKLARQLGLNTTVPYRVWFEGQQVGGWTQVYGSILSFATVRGASHEAPFSQPERS  327

Query  249  LHLFSSFVRGRRLPNM  202
              LF SF+  R LP +
Sbjct  328  FVLFKSFLEDRPLPEI  343



>ref|XP_002512656.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF50108.1| serine carboxypeptidase, putative [Ricinus communis]
Length=458

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 122/201 (61%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   L      I+  VDVC+  E   Y N
Sbjct  261  VMGQVSRETSKFVDKYDVT--LDVCISSVLSQSKILSPHV--IADNVDVCVEDETVNYLN  316

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ ALHA    + + W++CS  L Y   D  I  + ++ ++I   +PV ++SGDQDS
Sbjct  317  RLDVQMALHARLVGV-HQWTVCSSILDYELLDLEIPTISIVGKLIEAGVPVLVYSGDQDS  375

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G K TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  376  VIPLTGSRTLVHGLAEELGLKTTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHEAPF  435

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF +F+ G+ LP 
Sbjct  436  SQPERSLVLFKAFLEGQPLPE  456



>gb|AFK47012.1| unknown [Lotus japonicus]
Length=344

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 123/202 (61%), Gaps = 3/202 (1%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S++ Q   +     + +  +DVC+  +   Y N
Sbjct  145  VMGQVSKETSKFVDKYDVT--LDVCISSVLSQSKVISPQTHQANERIDVCVDDKVTNYLN  202

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W +CS  L Y+  +  +  LP++  +I++ + V I+SGDQDS
Sbjct  203  RRDVQEALHAKLVGVR-KWDVCSNVLDYDMLNLEVPTLPIVGLLIKSGVRVLIYSGDQDS  261

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  262  VIPLTGSRTLVQKLATKLGLNTTVPYRVWFEGQQVGGWTQVYGSILSFATVRGASHEAPF  321

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+  LF SF+ GR LP +
Sbjct  322  SQPERSFVLFKSFLEGRPLPEV  343



>ref|XP_010239839.1| PREDICTED: serine carboxypeptidase-like 45 [Brachypodium distachyon]
Length=465

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 124/202 (61%), Gaps = 4/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATK-ISVGVDVCMSYERRFYF  631
            VM+   R+T+  V+    T  LDVC  S++ Q   L   +T+ +S  +DVC+  E   Y 
Sbjct  264  VMSQVTRETSRFVDKYDVT--LDVCISSVLAQSKTLTPQSTQQLSRELDVCVEDETMNYL  321

Query  630  NLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQD  451
            N  +VQ+A+HA    +P  W++CS  L Y + D  I  +  +  ++++ IPV ++SGDQD
Sbjct  322  NRKDVQQAMHARLNGVP-KWTVCSSVLEYKQLDLQIPTINTVGMLVKSGIPVLVYSGDQD  380

Query  450  SVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVP  271
            SV+PL GSRTLV  LA  +    TVPY  WF  KQVGGW   +G  L+FAT+RGASH  P
Sbjct  381  SVIPLTGSRTLVHRLAKRLRLNATVPYRVWFEGKQVGGWTQVFGDALSFATIRGASHEAP  440

Query  270  FAQPSRALHLFSSFVRGRRLPN  205
            F+QP R+L LF +F+ GR LP 
Sbjct  441  FSQPERSLVLFRAFLAGRPLPE  462



>ref|XP_003551804.1| PREDICTED: serine carboxypeptidase-like 45-like [Glycine max]
Length=461

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  813  NCVMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFY  634
            + VM+    +T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y
Sbjct  262  SSVMSQVSTETSRFVDKYDVT--LDVCLSSVFSQTKVLN--PQQVTETIDVCVEDETVNY  317

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ ALHA+   +   WS CS  L Y   D  I  + ++ ++++  IPV ++SGDQ
Sbjct  318  LNRKDVQSALHAHLVGVQR-WSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  376

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG +L+FAT+RGASH  
Sbjct  377  DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  436

Query  273  PFAQPSRALHLFSSFVRGRRLP  208
            PF+QP R+L LF SF+ G  LP
Sbjct  437  PFSQPERSLVLFKSFLEGGPLP  458



>ref|XP_007209121.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
 gb|EMJ10320.1| hypothetical protein PRUPE_ppa005457mg [Prunus persica]
Length=460

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  263  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSKVIS--PNQMTERIDVCVEDKIVNYLN  318

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y   +  I  + L+  +++  IPV ++SGDQDS
Sbjct  319  RKDVQKALHARLVGVRR-WDVCSNILDYQVLNLEIPTISLVGSLVKAGIPVLVYSGDQDS  377

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  378  VIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  437

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  438  SQPERSLRLFKSFLEGRPLPEV  459



>ref|XP_008357674.1| PREDICTED: serine carboxypeptidase-like 45 [Malus domestica]
Length=376

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+  Q  +LRK     +V +DVC+  E   YFN P+VQ+ALHA  T     W++
Sbjct  199  LDVCLSSVEAQSFQLRK-----TVKIDVCIGDETVTYFNRPDVQEALHARVTN----WTI  249

Query  564  CSR--FLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            CS    L Y+  +  I +LP+L  ++++ I V I+SGDQDS++PL  +RTLV  LA D+G
Sbjct  250  CSXGGVLEYDMKNXEIPMLPVLGDLVKSGIRVLIYSGDQDSIIPLTSTRTLVNGLARDLG  309

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             +  VPY  W   KQV GW   Y   L++AT+RGA H  P +QP R+L LF+SF+RG+ L
Sbjct  310  LQTNVPYRVWVQEKQVAGWTQVYSDALSYATIRGAGHEAPISQPKRSLLLFTSFLRGKPL  369

Query  210  P  208
            P
Sbjct  370  P  370



>gb|KJB40056.1| hypothetical protein B456_007G044700 [Gossypium raimondii]
Length=462

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 126/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + +     ++S  VDVC+  +   Y N
Sbjct  265  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSMAIN--PQQVSERVDVCVEDKIVNYLN  320

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   +  +  + ++  +I++ IPV ++SGDQDS
Sbjct  321  RKDVQKALHARLVGVRL-WTVCSNILDYQLLNLEMPTISIVGSLIKSGIPVLVYSGDQDS  379

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR+LV  LA ++  + TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  380  VIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  439

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ G+ LP +
Sbjct  440  SQPERSLMLFKSFLEGKPLPEV  461



>ref|XP_010249188.1| PREDICTED: serine carboxypeptidase-like 45 [Nelumbo nucifera]
Length=494

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 124/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    ++T+  V+    T  LDVC  S++ Q   L     +++  +DVC+  E   Y N
Sbjct  297  VMNQVSKETSRFVDKYDVT--LDVCISSVLSQSKVLSP--QQVTERIDVCVEDETVNYLN  352

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L+Y   +  I  + ++  +++  IPV ++SGDQDS
Sbjct  353  RRDVQKALHARLVGV-RRWAVCSNILNYELLNLEIPTISIVGSLVKAGIPVLVYSGDQDS  411

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA D+G   TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  412  VIPLTGSRTLVHGLAKDLGLNTTVPYRVWFAGQQVGGWTQVYGNVLSFATIRGASHEAPF  471

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  472  SQPERSLVLFKSFLEGRPLPEV  493



>ref|XP_006576775.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=426

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -3

Query  774  LVNM*TTTMFLDVC-YPSIVEQELRLRKLA-----TKISVGVDVCMSYERRFYFNLPEVQ  613
            L++  T  +F  VC Y +I  Q ++  + A      + +  +DVC+  +   Y N  +VQ
Sbjct  230  LISDSTYDLFTRVCNYSTIRRQTIQANQQAYVLNQMQETQKIDVCVDDKAVTYLNRKDVQ  289

Query  612  KALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLL  433
            KALHA   ++   WS CSR LHY+  +  I  + +L  ++ ++I V ++SGDQDSV+PLL
Sbjct  290  KALHAKLVEVS-KWSACSRVLHYDRRNLEIPTVSILGSLVNSNIRVLVYSGDQDSVIPLL  348

Query  432  GSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSR  253
            GSR+LV  LA ++G   TV Y AWF RKQV GW   YG+LL++AT+RGASH  PF QP R
Sbjct  349  GSRSLVNGLAKELGLNTTVAYRAWFERKQVAGWTQVYGELLSYATIRGASHEAPFTQPQR  408

Query  252  ALHLFSSFVRGRRLPNM  202
            +L L  +F+ G+ LPN+
Sbjct  409  SLVLLKAFLEGKPLPNV  425



>gb|KHG09716.1| Serine carboxypeptidase-like 45 [Gossypium arboreum]
Length=462

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 126/202 (62%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q + +     ++S  VDVC+  +   Y N
Sbjct  265  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSMAIN--PQQVSERVDVCVEDKIVNYLN  320

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   +  +  + ++  +I++ IPV ++SGDQDS
Sbjct  321  QKDVQKALHARLVGV-RRWTVCSNILDYQLLNLEMPTISIVGSLIKSGIPVLVYSGDQDS  379

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR+LV  LA ++  + TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  380  VIPLTGSRSLVSRLAKELELETTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  439

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ G+ LP +
Sbjct  440  SQPERSLMLFKSFLEGKPLPEV  461



>ref|XP_006585840.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X2 [Glycine 
max]
Length=429

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 123/203 (61%), Gaps = 5/203 (2%)
 Frame = -3

Query  813  NCVMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFY  634
            + VM+    +T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y
Sbjct  230  SSVMSQVTTETSRFVDKYDVT--LDVCLSSVFSQTKVLN--PQQVTETIDVCVEDETVNY  285

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ A+HA+   +   WS CS  L Y   D  I  + ++ ++++  IPV ++SGDQ
Sbjct  286  LNRKDVQSAMHAHLVGVQR-WSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  344

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG +L+FAT+RGASH  
Sbjct  345  DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  404

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF SF+ G  LP 
Sbjct  405  PFSQPERSLVLFKSFLEGGPLPQ  427



>gb|KHN47533.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=454

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 123/203 (61%), Gaps = 5/203 (2%)
 Frame = -3

Query  813  NCVMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFY  634
            + VM+    +T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y
Sbjct  255  SSVMSQVTTETSRFVDKYDVT--LDVCLSSVFSQTKVLN--PQQVTETIDVCVEDETVNY  310

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ A+HA+   +   WS CS  L Y   D  I  + ++ ++++  IPV ++SGDQ
Sbjct  311  LNRKDVQSAMHAHLVGVQR-WSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  369

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG +L+FAT+RGASH  
Sbjct  370  DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  429

Query  273  PFAQPSRALHLFSSFVRGRRLPN  205
            PF+QP R+L LF SF+ G  LP 
Sbjct  430  PFSQPERSLVLFKSFLEGGPLPQ  452



>ref|XP_002280796.2| PREDICTED: serine carboxypeptidase-like 45 [Vitis vinifera]
 emb|CAN81275.1| hypothetical protein VITISV_021177 [Vitis vinifera]
 emb|CBI15743.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 121/202 (60%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  265  VMAQVSRETSKFVDKYDVT--LDVCLSSVLSQSKVIS--PQQVAETIDVCIDDKTVNYLN  320

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   +  I  + ++  +I+  IPV ++SGDQDS
Sbjct  321  RKDVQKALHARLVGI-RSWTVCSDILDYELLNLEIPTISIVGSLIKAGIPVLVYSGDQDS  379

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  380  VIPLTGSRTLVHNLAKELGLNTTVPYRVWFEGKQVGGWTRVYGNILSFATIRGASHEAPF  439

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+  R LP  
Sbjct  440  SQPERSLVLFKSFLEARPLPEF  461



>ref|XP_002511104.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF51706.1| serine carboxypeptidase, putative [Ricinus communis]
Length=460

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 122/200 (61%), Gaps = 5/200 (3%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+    +T+  V+    T  LDVC  SI+ Q   LR    ++S  +DVC+  E   Y N
Sbjct  263  VMSRVNTETSRFVDKYDVT--LDVCISSILSQSKVLR--PQQVSERIDVCVDDETMNYLN  318

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y   +  I  + ++  +++  IPV ++SGDQDS
Sbjct  319  RKDVQKALHARLVGVGR-WEVCSNILDYELLNLEIPTISVVGSLVKAGIPVLVYSGDQDS  377

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   Y  +L+FAT+RGA+H VP+
Sbjct  378  VIPLTGSRTLVHGLAKELGLNTTVPYRVWFAEKQVGGWTQVYSDILSFATIRGAAHEVPY  437

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF SF+ G+ LP
Sbjct  438  SQPERSLVLFKSFLEGKHLP  457



>ref|XP_006438864.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
 gb|ESR52104.1| hypothetical protein CICLE_v10031451mg [Citrus clementina]
Length=464

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 124/204 (61%), Gaps = 10/204 (5%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVG---VDVCMSYERRF  637
            VM+   R+T+  V+    T  LDVC  S++ Q     K+ T   VG   VDVC+  E   
Sbjct  266  VMSLVSRETSRFVDKYDVT--LDVCISSVLSQS----KVLTPKQVGETTVDVCVEDETVN  319

Query  636  YFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGD  457
            Y N  +VQKALHA    +  GW++CS  L Y   D  I  + ++ ++++  IPV ++SGD
Sbjct  320  YLNRKDVQKALHARLVGV-RGWAVCSNILDYELLDLEIPTITVVGKLVKAGIPVMVYSGD  378

Query  456  QDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHM  277
            QDSV+PL GSR LV  LA ++  + TVPY  WF  +QVGGW   YG +L+FAT+RGASH 
Sbjct  379  QDSVIPLTGSRKLVNGLAKELKLETTVPYRVWFEGQQVGGWTQVYGNILSFATIRGASHE  438

Query  276  VPFAQPSRALHLFSSFVRGRRLPN  205
             PF+QP R+L LF +F+  R LP 
Sbjct  439  APFSQPERSLVLFEAFLDSRPLPE  462



>ref|XP_003531913.1| PREDICTED: serine carboxypeptidase-like 45-like isoform X1 [Glycine 
max]
Length=461

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  813  NCVMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFY  634
            + VM+    +T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y
Sbjct  262  SSVMSQVTTETSRFVDKYDVT--LDVCLSSVFSQTKVLN--PQQVTETIDVCVEDETVNY  317

Query  633  FNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQ  454
             N  +VQ A+HA+   +   WS CS  L Y   D  I  + ++ ++++  IPV ++SGDQ
Sbjct  318  LNRKDVQSAMHAHLVGVQR-WSACSNVLDYELRDLEIPTITVVGKLVKEGIPVLVYSGDQ  376

Query  453  DSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMV  274
            DSV+PL GSRTLV +LA ++G   TVPY  WF ++QVGGW   YG +L+FAT+RGASH  
Sbjct  377  DSVIPLTGSRTLVHKLAKELGLNTTVPYRVWFEKQQVGGWTQVYGNILSFATIRGASHEA  436

Query  273  PFAQPSRALHLFSSFVRGRRLP  208
            PF+QP R+L LF SF+ G  LP
Sbjct  437  PFSQPERSLVLFKSFLEGGPLP  458



>ref|XP_008239549.1| PREDICTED: serine carboxypeptidase-like 45 [Prunus mume]
Length=467

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   ++T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  270  VMSQVSKETSKFVDKYDVT--LDVCISSVLSQSKVIS--PNQMTERIDVCVEDKIVNYLN  325

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y   +  I  + L+  +++  IPV ++SGDQDS
Sbjct  326  RKDVQKALHARLVGVRR-WDVCSNILDYQVLNMEIPTISLVGSLVKAGIPVLVYSGDQDS  384

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  385  VIPLTGSRTLVYRLARELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  444

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  445  SQPERSLRLFKSFLEGRPLPEV  466



>gb|EEC68261.1| hypothetical protein OsI_36290 [Oryza sativa Indica Group]
Length=472

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q  ++     ++   +DVC+  E   Y N
Sbjct  273  VMNQVTRETSRFVDKYDVT--LDVCLSSVLSQS-KILTPHQQVGQRIDVCVEDETVNYLN  329

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W++CS  L Y   +  I  + ++  ++++ I V ++SGDQDS
Sbjct  330  RKDVQEALHAKLIGVK-NWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDS  388

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA D+G K +VPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  389  VIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDMLSFATIRGASHEAPF  448

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F++GR LP
Sbjct  449  SQPERSLVLFRAFLQGRPLP  468



>ref|NP_001176565.1| Os11g0522900 [Oryza sativa Japonica Group]
 gb|ABA93967.1| Serine carboxypeptidase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG86949.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52189.1| hypothetical protein OsJ_34064 [Oryza sativa Japonica Group]
 dbj|BAH95293.1| Os11g0522900 [Oryza sativa Japonica Group]
Length=472

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 125/200 (63%), Gaps = 4/200 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM    R+T+  V+    T  LDVC  S++ Q  ++     ++   +DVC+  E   Y N
Sbjct  273  VMNQVTRETSRFVDKYDVT--LDVCLSSVLSQS-KILTPHQQVGQRIDVCVEDETVNYLN  329

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W++CS  L Y   +  I  + ++  ++++ I V ++SGDQDS
Sbjct  330  RKDVQEALHAKLIGVK-NWAVCSSVLEYELLNLQIPTINIVGSLVKSGIRVLVYSGDQDS  388

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV+ LA D+G K +VPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  389  VIPLTGSRTLVQNLARDLGLKTSVPYRVWFEGQQVGGWTQVYGDMLSFATIRGASHEAPF  448

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF +F++GR LP
Sbjct  449  SQPERSLVLFRAFLQGRPLP  468



>gb|KHN09723.1| Serine carboxypeptidase-like 45 [Glycine soja]
Length=457

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 124/201 (62%), Gaps = 3/201 (1%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q   +   + + +  +DVC+  +   Y N
Sbjct  258  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSKVICPQSQEANESIDVCVDDKVTNYLN  315

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQ+ALHA    +   W +CS  L Y+  +  +  L ++  +I+  + V I+SGDQDS
Sbjct  316  RRDVQEALHAKLVGV-RKWEVCSNILDYDMLNLEVPTLLVVGSLIKAGVKVLIYSGDQDS  374

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV++LA  +G   TVPY  WF  +QVGGW   YG +L+FATVRGASH  PF
Sbjct  375  VIPLTGSRTLVQKLARKLGLNSTVPYRVWFEGQQVGGWTQGYGNILSFATVRGASHEAPF  434

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF+ GR LP+
Sbjct  435  SQPERSLVLFKSFLEGRPLPD  455



>ref|XP_004310134.1| PREDICTED: serine carboxypeptidase-like 45 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 121/201 (60%), Gaps = 5/201 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S+  Q   L     +++  +DVC+  E   Y N
Sbjct  261  VMSQVSRETSKFVDKYDVT--LDVCISSVFSQSKVLS--PQQVTESIDVCVEDETVNYLN  316

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W++CS  L Y   D  I  + ++ ++I+  I V ++SGDQDS
Sbjct  317  RLDVQKALHARLVGV-RKWAVCSNVLDYELLDLEIPTISIVGKLIKAGISVLVYSGDQDS  375

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV  LA ++    TVPY  WF  +QVGGW   YG +L+FAT+RGASH  PF
Sbjct  376  VIPLTGSRTLVHGLAEELKLNTTVPYRVWFEGQQVGGWTQVYGNMLSFATIRGASHEAPF  435

Query  267  AQPSRALHLFSSFVRGRRLPN  205
            +QP R+L LF SF+ GR LP 
Sbjct  436  SQPERSLVLFKSFLEGRPLPE  456



>ref|XP_010322561.1| PREDICTED: serine carboxypeptidase-like 46 isoform X3 [Solanum 
lycopersicum]
Length=394

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 104/171 (61%), Gaps = 8/171 (5%)
 Frame = -3

Query  696  KLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDI  517
            K   K+    D C++     Y N PEVQKALHAN T LPY W +CS  L Y   D  IDI
Sbjct  215  KFDKKVGKVADPCLNEWINLYLNKPEVQKALHANTTYLPYSWEVCSGPLQYKMEDAAIDI  274

Query  516  LPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGG  337
            +PLL  I++ HIP+ +FSGDQDSV+PL  +R + + LA D+       YG W+   Q+GG
Sbjct  275  IPLLSNILKQHIPILLFSGDQDSVLPLTQTRKIAKLLAQDLKLVALDKYGPWYDGLQIGG  334

Query  336  WATEYGKL--------LTFATVRGASHMVPFAQPSRALHLFSSFVRGRRLP  208
            W+  YG +        LTFATVRGA+H VP+  PS+AL LF +F+RG   P
Sbjct  335  WSQSYGGVREGKNITYLTFATVRGAAHEVPYTSPSQALTLFRAFLRGYPPP  385



>ref|XP_009355269.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=462

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLPYGWSM  565
            LDVC  S+  Q  +LRK     +V +DVC+  E   Y N P+VQ+ALHA  T     W++
Sbjct  285  LDVCLSSVEAQSFQLRK-----TVKIDVCIGDEIVTYLNRPDVQEALHARVTN----WTI  335

Query  564  CSR--FLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            CS    L Y+  D  I +LP+L  ++++ I V I+SGDQDS++PL+ +RTLV  LA D+G
Sbjct  336  CSNGGVLEYDMKDHEILMLPVLGDLVKSGIRVLIYSGDQDSIIPLVSTRTLVNGLAKDLG  395

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             +  VPY  W   KQV GW   YG  L++AT+RGA H  P +QP R+L LF+SF+RG+ L
Sbjct  396  LQTNVPYRVWVQEKQVAGWTQVYGDTLSYATIRGAGHEAPISQPERSLLLFTSFLRGKPL  455

Query  210  P  208
            P
Sbjct  456  P  456



>ref|XP_007043816.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 ref|XP_007043817.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99647.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
 gb|EOX99648.1| Serine carboxypeptidase-like 45 isoform 1 [Theobroma cacao]
Length=463

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 114/182 (63%), Gaps = 7/182 (4%)
 Frame = -3

Query  744  LDVCYPSIVEQELRLRKLATKISVG--VDVCMSYERRFYFNLPEVQKALHANRTKLPYGW  571
            LDVC  S++ Q     K+ T   VG  +DVC+  E   Y N  +VQKALHA    +   W
Sbjct  285  LDVCISSMLSQS----KVLTPQQVGETIDVCVEDETANYLNRQDVQKALHARLVGV-RKW  339

Query  570  SMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAHDMG  391
            ++CS  L Y   D  I  + ++  +++  IPV ++SGDQDSV+PL GSRTLV  LA ++G
Sbjct  340  AVCSNVLDYELLDLEIPTITIVGSLVKAGIPVMVYSGDQDSVIPLTGSRTLVNRLAKELG  399

Query  390  FKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRGRRL  211
             K TV Y  WF  +QVGGW   YG +L+FAT+RGASH  PF+QP R+L LF +F+ GR L
Sbjct  400  LKTTVTYRVWFEGQQVGGWTQVYGNILSFATIRGASHEAPFSQPERSLVLFKAFLEGRPL  459

Query  210  PN  205
            P 
Sbjct  460  PE  461



>ref|XP_009337518.1| PREDICTED: serine carboxypeptidase-like 45 [Pyrus x bretschneideri]
Length=468

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 123/202 (61%), Gaps = 5/202 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   ++T+  V+    T  LDVC  S++ Q   +     +++  +DVC+  +   Y N
Sbjct  271  VMSQVSKETSKFVDKYDVT--LDVCISSVLSQSKVIS--PNQMTERIDVCVEDKTVNYLN  326

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +   W +CS  L Y   +  I  + L+  +++  IPV ++SGDQDS
Sbjct  327  RKDVQKALHARLVGV-RRWDVCSNILDYQVLNLEIPTISLVGSLVKQGIPVLVYSGDQDS  385

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSR+LV  LA ++G   TVPY  WF  KQVGGW   YG +L+FAT+RGASH  PF
Sbjct  386  VIPLTGSRSLVYRLATELGLNTTVPYRVWFEGKQVGGWTQVYGNILSFATIRGASHEAPF  445

Query  267  AQPSRALHLFSSFVRGRRLPNM  202
            +QP R+L LF SF+ GR LP +
Sbjct  446  SQPGRSLRLFKSFLEGRPLPEV  467



>gb|KCW90016.1| hypothetical protein EUGRSUZ_A02215 [Eucalyptus grandis]
Length=469

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 114/184 (62%), Gaps = 3/184 (2%)
 Frame = -3

Query  759  TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFNLPEVQKALHANRTKLP  580
            T  + LDVC  ++  Q   L KL  + +  +DVC+  E   Y N  EVQ+ALHA    + 
Sbjct  276  TYDVTLDVCLSTVSSQSAVLNKL--QQTEKIDVCVQDETLKYLNRKEVQEALHARLVGIS  333

Query  579  YGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDSVVPLLGSRTLVRELAH  400
              W++CS  L Y   +  I  + +L  ++++ I V ++SGDQDS +PLLG+RTLV  LA 
Sbjct  334  -SWTVCSDVLEYEYQNLEIPTITILGELVKSGIHVLVYSGDQDSAIPLLGTRTLVNNLAK  392

Query  399  DMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPFAQPSRALHLFSSFVRG  220
             +G   TVPY  WF   QV GW   YG +L++AT+RGASH+ PF+QP R+L LFSSF+ G
Sbjct  393  QLGLNTTVPYRVWFEESQVAGWTQVYGDILSYATIRGASHVAPFSQPERSLVLFSSFLGG  452

Query  219  RRLP  208
            R LP
Sbjct  453  RPLP  456



>ref|XP_003630573.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AET05049.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=465

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 119/200 (60%), Gaps = 3/200 (2%)
 Frame = -3

Query  807  VMTPYXRQTA*LVNM*TTTMFLDVCYPSIVEQELRLRKLATKISVGVDVCMSYERRFYFN  628
            VM+   R+T+  V+    T  LDVC  S++ Q   +       +  +DVC+  E   Y N
Sbjct  266  VMSQVSRETSKFVDKYDVT--LDVCISSVLSQSKVICPQNHHANESIDVCVDDEVTNYLN  323

Query  627  LPEVQKALHANRTKLPYGWSMCSRFLHYNETDGNIDILPLLKRIIRNHIPVWIFSGDQDS  448
              +VQKALHA    +P  W++CS  L YN  +  +  L ++  II+  + V I+SGDQDS
Sbjct  324  RRDVQKALHAELIGVP-KWNVCSNILDYNMLNLEVPTLHVVGSIIKAGVRVLIYSGDQDS  382

Query  447  VVPLLGSRTLVRELAHDMGFKVTVPYGAWFHRKQVGGWATEYGKLLTFATVRGASHMVPF  268
            V+PL GSRTLV +LA  +  K T+PY  WF   QVGGW   YG  LTFAT+RGASH  PF
Sbjct  383  VIPLTGSRTLVHKLARQLALKTTIPYRVWFEGHQVGGWTQVYGNTLTFATIRGASHEAPF  442

Query  267  AQPSRALHLFSSFVRGRRLP  208
            +QP R+L LF SF+  + LP
Sbjct  443  SQPERSLVLFKSFLENKPLP  462



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1646677518220