BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014F15

Length=787
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076582.1|  PREDICTED: probable inactive serine/threonin...    102   1e-20   Sesamum indicum [beniseed]
ref|XP_011076581.1|  PREDICTED: probable inactive serine/threonin...    102   1e-20   Sesamum indicum [beniseed]
gb|EYU20126.1|  hypothetical protein MIMGU_mgv1a001437mg              96.3    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_010667551.1|  PREDICTED: N-terminal kinase-like protein        91.3    4e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009623483.1|  PREDICTED: probable inactive serine/threonin...  88.6    3e-16   Nicotiana tomentosiformis
ref|XP_009623482.1|  PREDICTED: probable inactive serine/threonin...  88.6    3e-16   Nicotiana tomentosiformis
ref|XP_009798482.1|  PREDICTED: probable inactive serine/threonin...  87.8    5e-16   Nicotiana sylvestris
ref|XP_009779913.1|  PREDICTED: probable inactive serine/threonin...  87.8    5e-16   Nicotiana sylvestris
ref|XP_009798481.1|  PREDICTED: probable inactive serine/threonin...  87.8    5e-16   Nicotiana sylvestris
ref|XP_009590238.1|  PREDICTED: probable inactive serine/threonin...  87.4    9e-16   Nicotiana tomentosiformis
ref|XP_006358741.1|  PREDICTED: probable inactive serine/threonin...  83.6    1e-14   
gb|AFK35663.1|  unknown                                               79.7    2e-14   Lotus japonicus
ref|XP_006358740.1|  PREDICTED: probable inactive serine/threonin...  82.8    2e-14   
ref|XP_009779914.1|  PREDICTED: probable inactive serine/threonin...  82.8    3e-14   Nicotiana sylvestris
ref|XP_006365332.1|  PREDICTED: probable inactive serine/threonin...  82.0    5e-14   Solanum tuberosum [potatoes]
ref|XP_009590239.1|  PREDICTED: probable inactive serine/threonin...  81.6    5e-14   Nicotiana tomentosiformis
ref|XP_010322119.1|  PREDICTED: probable inactive serine/threonin...  80.9    9e-14   Solanum lycopersicum
ref|XP_010322118.1|  PREDICTED: probable inactive serine/threonin...  80.9    1e-13   Solanum lycopersicum
ref|XP_011463428.1|  PREDICTED: probable inactive serine/threonin...  80.1    2e-13   Fragaria vesca subsp. vesca
ref|XP_004297714.1|  PREDICTED: probable inactive serine/threonin...  79.7    2e-13   Fragaria vesca subsp. vesca
ref|XP_007225258.1|  hypothetical protein PRUPE_ppa001574mg           78.6    6e-13   Prunus persica
ref|XP_003556441.1|  PREDICTED: probable inactive serine/threonin...  78.2    8e-13   Glycine max [soybeans]
ref|XP_010321457.1|  PREDICTED: probable inactive serine/threonin...  77.0    2e-12   
ref|XP_008221084.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  77.0    2e-12   Prunus mume [ume]
ref|XP_010554724.1|  PREDICTED: probable inactive serine/threonin...  76.3    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_010031076.1|  PREDICTED: probable inactive serine/threonin...  73.2    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010031075.1|  PREDICTED: probable inactive serine/threonin...  72.8    3e-11   Eucalyptus grandis [rose gum]
ref|XP_010031074.1|  PREDICTED: probable inactive serine/threonin...  72.8    4e-11   Eucalyptus grandis [rose gum]
ref|NP_001146277.1|  uncharacterized protein LOC100279852             71.6    1e-10   Zea mays [maize]
gb|AFW84753.1|  hypothetical protein ZEAMMB73_694445                  71.2    1e-10   
emb|CDM84765.1|  unnamed protein product                              70.5    2e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004495542.1|  PREDICTED: probable inactive serine/threonin...  69.7    4e-10   
ref|XP_004495541.1|  PREDICTED: probable inactive serine/threonin...  69.7    4e-10   Cicer arietinum [garbanzo]
emb|CDY22472.1|  BnaC03g22820D                                        69.3    6e-10   Brassica napus [oilseed rape]
gb|KDP21639.1|  hypothetical protein JCGZ_03310                       68.9    6e-10   Jatropha curcas
ref|XP_002458682.1|  hypothetical protein SORBIDRAFT_03g038150        68.6    8e-10   Sorghum bicolor [broomcorn]
tpg|DAA57073.1|  TPA: hypothetical protein ZEAMMB73_293561            67.8    8e-10   
ref|XP_010540261.1|  PREDICTED: probable inactive serine/threonin...  67.8    1e-09   Tarenaya hassleriana [spider flower]
ref|XP_002280870.1|  PREDICTED: N-terminal kinase-like protein        67.4    2e-09   Vitis vinifera
ref|XP_010111055.1|  putative inactive serine/threonine-protein k...  67.4    2e-09   
ref|XP_008674884.1|  PREDICTED: probable inactive serine/threonin...  67.4    2e-09   Zea mays [maize]
ref|XP_008674885.1|  PREDICTED: probable inactive serine/threonin...  67.4    2e-09   
emb|CAN63376.1|  hypothetical protein VITISV_042412                   67.0    3e-09   Vitis vinifera
gb|EMT22366.1|  N-terminal kinase-like protein                        67.0    3e-09   
ref|XP_004970383.1|  PREDICTED: probable inactive serine/threonin...  67.0    3e-09   Setaria italica
ref|XP_004970384.1|  PREDICTED: probable inactive serine/threonin...  67.0    3e-09   Setaria italica
ref|NP_001044644.1|  Os01g0819900                                     66.6    4e-09   
ref|XP_003564494.1|  PREDICTED: N-terminal kinase-like protein        65.9    7e-09   Brachypodium distachyon [annual false brome]
gb|KEH27102.1|  Serine/Threonine kinase family protein                65.5    1e-08   Medicago truncatula
ref|XP_007011362.1|  Kinase family protein with ARM repeat domain...  65.1    1e-08   
gb|EMS65875.1|  N-terminal kinase-like protein                        64.7    2e-08   Triticum urartu
dbj|BAJ85082.1|  predicted protein                                    64.7    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007011363.1|  Kinase family protein with ARM repeat domain...  64.3    2e-08   
gb|EEC71713.1|  hypothetical protein OsI_04229                        64.3    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006644915.1|  PREDICTED: probable inactive serine/threonin...  63.5    4e-08   Oryza brachyantha
ref|XP_002325930.1|  hypothetical protein POPTR_0019s08720g           63.5    4e-08   
ref|XP_006371290.1|  hypothetical protein POPTR_0019s08720g           63.5    5e-08   Populus trichocarpa [western balsam poplar]
gb|KHG02829.1|  N-terminal kinase-like protein                        63.2    6e-08   Gossypium arboreum [tree cotton]
emb|CDX93162.1|  BnaC04g47340D                                        62.8    7e-08   
ref|XP_010252046.1|  PREDICTED: probable inactive serine/threonin...  62.8    8e-08   Nelumbo nucifera [Indian lotus]
ref|XP_011001384.1|  PREDICTED: probable inactive serine/threonin...  62.8    8e-08   Populus euphratica
ref|XP_008780109.1|  PREDICTED: uncharacterized protein LOC103699893  61.2    8e-08   Phoenix dactylifera
gb|KJB67945.1|  hypothetical protein B456_010G219100                  62.4    1e-07   Gossypium raimondii
gb|KJB67946.1|  hypothetical protein B456_010G219100                  62.4    1e-07   Gossypium raimondii
gb|KJB67947.1|  hypothetical protein B456_010G219100                  62.4    1e-07   Gossypium raimondii
ref|XP_006486152.1|  PREDICTED: LOW QUALITY PROTEIN: N-terminal k...  62.4    1e-07   
ref|XP_002319344.2|  HEAT repeat-containing family protein            62.4    1e-07   
ref|XP_011010141.1|  PREDICTED: probable inactive serine/threonin...  62.0    1e-07   Populus euphratica
ref|XP_011010140.1|  PREDICTED: probable inactive serine/threonin...  62.0    1e-07   Populus euphratica
ref|XP_006411339.1|  hypothetical protein EUTSA_v10016269mg           61.2    3e-07   Eutrema salsugineum [saltwater cress]
gb|KHN29287.1|  N-terminal kinase-like protein                        60.8    3e-07   Glycine soja [wild soybean]
gb|KDO67541.1|  hypothetical protein CISIN_1g0040252mg                60.1    3e-07   Citrus sinensis [apfelsine]
ref|XP_009133450.1|  PREDICTED: N-terminal kinase-like protein        60.8    3e-07   Brassica rapa
emb|CDY35443.1|  BnaA03g19170D                                        60.8    3e-07   Brassica napus [oilseed rape]
gb|KJB67948.1|  hypothetical protein B456_010G219100                  60.5    4e-07   Gossypium raimondii
ref|XP_006587814.1|  PREDICTED: N-terminal kinase-like protein-like   60.5    4e-07   Glycine max [soybeans]
ref|XP_006435941.1|  hypothetical protein CICLE_v10030740mg           59.7    8e-07   Citrus clementina [clementine]
ref|XP_008782671.1|  PREDICTED: probable inactive serine/threonin...  58.5    2e-06   
ref|XP_008782670.1|  PREDICTED: probable inactive serine/threonin...  58.2    3e-06   Phoenix dactylifera
ref|XP_008340425.1|  PREDICTED: probable inactive serine/threonin...  57.8    3e-06   
dbj|BAF02142.1|  hypothetical protein                                 57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143981.1|  hypothetical protein PHAVU_007G118900g           57.8    4e-06   Phaseolus vulgaris [French bean]
ref|NP_181605.2|  cytoplasmic tRNA export protein                     57.8    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460279.1|  PREDICTED: probable inactive serine/threonin...  57.0    7e-06   Cucumis melo [Oriental melon]
ref|XP_008810839.1|  PREDICTED: probable inactive serine/threonin...  57.0    7e-06   Phoenix dactylifera
ref|XP_010253047.1|  PREDICTED: probable inactive serine/threonin...  56.6    8e-06   
ref|XP_010253050.1|  PREDICTED: probable inactive serine/threonin...  56.6    9e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010253049.1|  PREDICTED: probable inactive serine/threonin...  56.6    1e-05   
ref|XP_004144420.1|  PREDICTED: probable inactive serine/threonin...  56.6    1e-05   Cucumis sativus [cucumbers]
ref|XP_008460276.1|  PREDICTED: probable inactive serine/threonin...  56.2    1e-05   Cucumis melo [Oriental melon]
gb|KHG09100.1|  N-terminal kinase-like protein                        55.8    2e-05   Gossypium arboreum [tree cotton]
ref|XP_010252047.1|  PREDICTED: probable inactive serine/threonin...  55.8    2e-05   Nelumbo nucifera [Indian lotus]
gb|KGN58429.1|  hypothetical protein Csa_3G642700                     55.1    3e-05   Cucumis sativus [cucumbers]
gb|KFK36944.1|  hypothetical protein AALP_AA4G192400                  54.7    4e-05   Arabis alpina [alpine rockcress]
gb|KHN40459.1|  Putative inactive serine/threonine-protein kinase...  54.7    4e-05   Glycine soja [wild soybean]
ref|XP_007139742.1|  hypothetical protein PHAVU_008G055600g           54.7    4e-05   Phaseolus vulgaris [French bean]
ref|XP_006293704.1|  hypothetical protein CARUB_v10022662mg           53.9    7e-05   Capsella rubella
gb|KJB60173.1|  hypothetical protein B456_009G292700                  53.5    9e-05   Gossypium raimondii
ref|XP_010508814.1|  PREDICTED: N-terminal kinase-like protein is...  52.8    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010517510.1|  PREDICTED: N-terminal kinase-like protein        52.0    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_009141929.1|  PREDICTED: N-terminal kinase-like protein        52.0    3e-04   Brassica rapa
ref|XP_010505824.1|  PREDICTED: N-terminal kinase-like protein        50.4    0.001   Camelina sativa [gold-of-pleasure]



>ref|XP_011076582.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Sesamum indicum]
Length=818

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 108/154 (70%), Gaps = 9/154 (6%)
 Frame = -3

Query  776  EKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWGs  600
            +KDGWDD+EPLE   P AALANIQAAQKRPVS PK+QVS SRPKS  K + DDD DLWG+
Sbjct  665  DKDGWDDIEPLEEAKPSAALANIQAAQKRPVSVPKTQVSNSRPKSSLKTSKDDDSDLWGA  724

Query  599  aaapvpkttkaaSSRGASF---DNDPWDSVap----apkttakkaaTVDDDLWGSIAAPE  441
             A P P++T   S+  AS    ++DPW ++A     +   +    ++ DDDLW SIAAP 
Sbjct  725  PADPAPRSTSKPSTAKASRAVDEDDPWGAIAAPVPKSSSKSMNLKSSADDDLWASIAAPP  784

Query  440  PTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            PTT  +P  GRGR +K AAPKLGAQRINRTS GM
Sbjct  785  PTTGPKPLSGRGRVTKAAAPKLGAQRINRTSSGM  818



>ref|XP_011076581.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Sesamum indicum]
Length=820

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 108/154 (70%), Gaps = 9/154 (6%)
 Frame = -3

Query  776  EKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWGs  600
            +KDGWDD+EPLE   P AALANIQAAQKRPVS PK+QVS SRPKS  K + DDD DLWG+
Sbjct  667  DKDGWDDIEPLEEAKPSAALANIQAAQKRPVSVPKTQVSNSRPKSSLKTSKDDDSDLWGA  726

Query  599  aaapvpkttkaaSSRGASF---DNDPWDSVap----apkttakkaaTVDDDLWGSIAAPE  441
             A P P++T   S+  AS    ++DPW ++A     +   +    ++ DDDLW SIAAP 
Sbjct  727  PADPAPRSTSKPSTAKASRAVDEDDPWGAIAAPVPKSSSKSMNLKSSADDDLWASIAAPP  786

Query  440  PTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            PTT  +P  GRGR +K AAPKLGAQRINRTS GM
Sbjct  787  PTTGPKPLSGRGRVTKAAAPKLGAQRINRTSSGM  820



>gb|EYU20126.1| hypothetical protein MIMGU_mgv1a001437mg [Erythranthe guttata]
Length=820

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 100/156 (64%), Gaps = 18/156 (12%)
 Frame = -3

Query  773  KDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWGsaa  594
            KDGWDD+EPLE P   AALANIQAAQKRPVS PK QVS SRPKS       D DLWGS+ 
Sbjct  671  KDGWDDIEPLEDPKQSAALANIQAAQKRPVSLPKPQVSNSRPKS------TDGDLWGSSV  724

Query  593  a-----pvpkttkaaSSRGASFDNDPWDSVap------apkttakkaaTVDDDLWGSIAA  447
            A        + + + +SR    ++DPW ++A       +     K + + DDDLW SIAA
Sbjct  725  ADPAPKSTSRNSNSKTSRVVEEEDDPWGAIAAPVPKSSSKAMNLKGSGSADDDLWASIAA  784

Query  446  PEPTTASRPS-VGRGRSKPAAPKLGAQRINRTSPGM  342
            P PT   +PS VGRGR K AAP+LGAQRINRTS G+
Sbjct  785  PAPTAGHKPSSVGRGRGKAAAPRLGAQRINRTSSGV  820



>ref|XP_010667551.1| PREDICTED: N-terminal kinase-like protein [Beta vulgaris subsp. 
vulgaris]
Length=799

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 102/157 (65%), Gaps = 30/157 (19%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPV-------SQPKSQVSISRPKS-ISKMN  627
            +++KDGWDD+EPLE P P  ALANIQ AQKRPV       SQPKS  S S+PKS + K  
Sbjct  663  DSDKDGWDDIEPLEEPKPSPALANIQVAQKRPVAQPKPALSQPKSAASSSQPKSTVRKAK  722

Query  626  TDDDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAA  447
             DDD+LWGS AAP PKTT  A S GA                      TVDDDLWG+IAA
Sbjct  723  DDDDELWGSIAAPPPKTTSKAMSLGA--------------------PKTVDDDLWGAIAA  762

Query  446  PEPTTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P P T ++P S GRGR +KPAAPKLGAQRINRTS GM
Sbjct  763  PPPMTKAKPLSAGRGRGAKPAAPKLGAQRINRTSSGM  799



>ref|XP_009623483.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 105/156 (67%), Gaps = 10/156 (6%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWG  603
            ++KDGWDD+EP E P P  +LANIQAAQ+RPVSQPK QV+  R K+ SK++ DDD DLWG
Sbjct  662  SDKDGWDDIEPQEEPKPSPSLANIQAAQRRPVSQPKPQVTGLRGKTTSKISKDDDEDLWG  721

Query  602  saaapvpkttka-aSSRGASFDNDPWDSVapapkttakkaaTV-------DDDLWGSIAA  447
            S AAP P+ T   ++SR     ND     A A    + K   V       D+D W +IAA
Sbjct  722  SVAAPAPRATSQPSNSRANRTVNDDDPWAAIAAPAPSAKPLNVKRSGALDDNDPWAAIAA  781

Query  446  PEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P PT  +RPS+GRGR +KPAAP+LGAQR+NRTS GM
Sbjct  782  PVPTATARPSIGRGRGTKPAAPRLGAQRVNRTSSGM  817



>ref|XP_009623482.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana tomentosiformis]
Length=819

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 105/156 (67%), Gaps = 10/156 (6%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWG  603
            ++KDGWDD+EP E P P  +LANIQAAQ+RPVSQPK QV+  R K+ SK++ DDD DLWG
Sbjct  664  SDKDGWDDIEPQEEPKPSPSLANIQAAQRRPVSQPKPQVTGLRGKTTSKISKDDDEDLWG  723

Query  602  saaapvpkttka-aSSRGASFDNDPWDSVapapkttakkaaTV-------DDDLWGSIAA  447
            S AAP P+ T   ++SR     ND     A A    + K   V       D+D W +IAA
Sbjct  724  SVAAPAPRATSQPSNSRANRTVNDDDPWAAIAAPAPSAKPLNVKRSGALDDNDPWAAIAA  783

Query  446  PEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P PT  +RPS+GRGR +KPAAP+LGAQR+NRTS GM
Sbjct  784  PVPTATARPSIGRGRGTKPAAPRLGAQRVNRTSSGM  819



>ref|XP_009798482.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana sylvestris]
Length=804

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 10/156 (6%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWG  603
            ++KDGWDD+EP E P P  +LANIQAAQ+RPVSQPK QV+  R K+ SKM+ DDD DLWG
Sbjct  649  SDKDGWDDIEPQEEPKPSPSLANIQAAQRRPVSQPKPQVTGLRGKTTSKMSKDDDEDLWG  708

Query  602  saaapvpkttkaaSSRGA--SFDND------PWDSVapapkttakkaaTVDDDLWGSIAA  447
            S AAP P+ T   S+  A  + D+D         + +  P    +  A  D+D W +IAA
Sbjct  709  SVAAPAPRATSQPSNSRANRTVDDDDPWAAIAAPAPSAKPLNVKRSGALDDNDPWAAIAA  768

Query  446  PEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P PT  +RPS+GRGR +KPAAP+LGAQR+NRTS GM
Sbjct  769  PVPTATARPSIGRGRGTKPAAPRLGAQRVNRTSSGM  804



>ref|XP_009779913.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana sylvestris]
Length=820

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 99/159 (62%), Gaps = 12/159 (8%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMN-TDDDDLW  606
            +N+KDGWDD+EP E P P  +LANIQAAQ+RPVSQPKSQV+  R     K+   +DDDLW
Sbjct  662  DNDKDGWDDIEPHEEPKPSPSLANIQAAQRRPVSQPKSQVTGLRGSITPKVTKNEDDDLW  721

Query  605  GsaaapvpkttkaaSSRGASF-----DNDPWDSVapap-----kttakkaaTVDDDLWGS  456
            GS  A  P    ++    +       D+DPW ++A            K  A  D+D W +
Sbjct  722  GSVPASAPAPRTSSQPSSSRASRPVDDDDPWGAIAAPAPSSKPLNVKKGGALDDNDPWAA  781

Query  455  IAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            IAAP PT  +RPS+GRGR +KP  PKLGAQRINRTS GM
Sbjct  782  IAAPVPTAKARPSIGRGRGNKPTVPKLGAQRINRTSSGM  820



>ref|XP_009798481.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana sylvestris]
Length=818

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 10/156 (6%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLWG  603
            ++KDGWDD+EP E P P  +LANIQAAQ+RPVSQPK QV+  R K+ SKM+ DDD DLWG
Sbjct  663  SDKDGWDDIEPQEEPKPSPSLANIQAAQRRPVSQPKPQVTGLRGKTTSKMSKDDDEDLWG  722

Query  602  saaapvpkttkaaSSRGA--SFDND------PWDSVapapkttakkaaTVDDDLWGSIAA  447
            S AAP P+ T   S+  A  + D+D         + +  P    +  A  D+D W +IAA
Sbjct  723  SVAAPAPRATSQPSNSRANRTVDDDDPWAAIAAPAPSAKPLNVKRSGALDDNDPWAAIAA  782

Query  446  PEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P PT  +RPS+GRGR +KPAAP+LGAQR+NRTS GM
Sbjct  783  PVPTATARPSIGRGRGTKPAAPRLGAQRVNRTSSGM  818



>ref|XP_009590238.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nicotiana tomentosiformis]
Length=820

 Score = 87.4 bits (215),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 98/159 (62%), Gaps = 12/159 (8%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMN-TDDDDLW  606
            +N+KDGWDD+EP E P P  ALANIQAAQ+RPVSQPK QV+  R     K+   +DDDLW
Sbjct  662  DNDKDGWDDIEPHEEPKPSPALANIQAAQRRPVSQPKLQVTGLRGSITPKVTKNEDDDLW  721

Query  605  GsaaapvpkttkaaSSRGASF-----DNDPWDSVapapkttakkaaTV-----DDDLWGS  456
            GS  A  P    ++    +       D+DPW ++A    ++            D+D W +
Sbjct  722  GSVPASAPAPRTSSQPSSSRASRPVDDDDPWGAIAAPASSSKPLNVKKGGALDDNDPWAA  781

Query  455  IAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            IAAP PT  +RPSVGRGR +KP  PKLGAQRINRTS GM
Sbjct  782  IAAPVPTAKARPSVGRGRGNKPTVPKLGAQRINRTSSGM  820



>ref|XP_006358741.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X2 [Solanum tuberosum]
Length=621

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTD-DDDLW  606
            +++KDGWDD+ P E P P  +LANIQAAQ+RPVSQPK Q +  R K+  KM+ D D+DLW
Sbjct  465  DSDKDGWDDINPQEEPKPSPSLANIQAAQRRPVSQPKPQGTGLRGKTTPKMSKDNDEDLW  524

Query  605  Gsaaapvpkttka-aSSRGASFDNDPWDSVapapkttakkaaTV-------DDDLWGSIA  450
            GS A P P+TT   ++SR     +D     A A    + K   V       D+D W +IA
Sbjct  525  GSVAVPAPRTTSQPSNSRANKTVDDDDPWAAIAAPAPSSKPLNVKRSGALDDNDPWAAIA  584

Query  449  APEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            AP PT+++RPS+GRGR +KPAAPKLGAQR+NRTS GM
Sbjct  585  APVPTSSARPSIGRGRGTKPAAPKLGAQRVNRTSSGM  621



>gb|AFK35663.1| unknown [Lotus japonicus]
Length=227

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 94/150 (63%), Gaps = 29/150 (19%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ---VSISRPKSISKMNTD-DD  615
            EN+KDGWDD+EPLE   P  ALANIQAAQ+RPVSQP SQ    S  + K+  +++ D DD
Sbjct  97   ENDKDGWDDLEPLEETKPAPALANIQAAQRRPVSQPVSQSKQASSLKSKNTPRLSKDEDD  156

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWG+ AAP PKT+    S                         T DDD W SIAAP PT
Sbjct  157  DLWGAIAAPAPKTSLNLKS-----------------------TTTEDDDPWASIAAPAPT  193

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            T ++P S GRGR +KPAAPKLGAQRINRTS
Sbjct  194  TRAKPLSAGRGRGAKPAAPKLGAQRINRTS  223



>ref|XP_006358740.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X1 [Solanum tuberosum]
Length=706

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 105/157 (67%), Gaps = 10/157 (6%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTD-DDDLW  606
            +++KDGWDD+ P E P P  +LANIQAAQ+RPVSQPK Q +  R K+  KM+ D D+DLW
Sbjct  550  DSDKDGWDDINPQEEPKPSPSLANIQAAQRRPVSQPKPQGTGLRGKTTPKMSKDNDEDLW  609

Query  605  Gsaaapvpkttka-aSSRGASFDNDPWDSVapapkttakkaaTV-------DDDLWGSIA  450
            GS A P P+TT   ++SR     +D     A A    + K   V       D+D W +IA
Sbjct  610  GSVAVPAPRTTSQPSNSRANKTVDDDDPWAAIAAPAPSSKPLNVKRSGALDDNDPWAAIA  669

Query  449  APEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            AP PT+++RPS+GRGR +KPAAPKLGAQR+NRTS GM
Sbjct  670  APVPTSSARPSIGRGRGTKPAAPKLGAQRVNRTSSGM  706



>ref|XP_009779914.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana sylvestris]
Length=818

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ-VSISRPKSISKMNTDDDDLW  606
            +N+KDGWDD+EP E P P  +LANIQAAQ+RPVSQPKSQ +  S    ++K   +DDDLW
Sbjct  662  DNDKDGWDDIEPHEEPKPSPSLANIQAAQRRPVSQPKSQGLRGSITPKVTK--NEDDDLW  719

Query  605  GsaaapvpkttkaaSSRGASF-----DNDPWDSVapapkttakkaaTV-----DDDLWGS  456
            GS  A  P    ++    +       D+DPW ++A    ++            D+D W +
Sbjct  720  GSVPASAPAPRTSSQPSSSRASRPVDDDDPWGAIAAPAPSSKPLNVKKGGALDDNDPWAA  779

Query  455  IAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            IAAP PT  +RPS+GRGR +KP  PKLGAQRINRTS GM
Sbjct  780  IAAPVPTAKARPSIGRGRGNKPTVPKLGAQRINRTSSGM  818



>ref|XP_006365332.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Solanum tuberosum]
Length=818

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 95/160 (59%), Gaps = 16/160 (10%)
 Frame = -3

Query  785  LENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLW  606
            L+ +KDGWDD+EP E P P   L NIQAAQ+RPVSQPK QV+  R      +  DD+DLW
Sbjct  663  LDGDKDGWDDIEPQEEPKPSPFLVNIQAAQRRPVSQPKPQVASLR----GSIKNDDEDLW  718

Query  605  GsaaapvpkttkaaSSRGASF------DNDPWDSVap----apkttakkaaTVDD-DLWG  459
            GS  A  P    ++             D DPW +++           KK  ++DD D W 
Sbjct  719  GSVPATAPAPRTSSQPSSTRSSRTVDDDEDPWGAISAPAPSTKSLNVKKGGSLDDTDPWA  778

Query  458  SIAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            +IAAP PT+ +R S+GRGR +KP  PKLGAQRINRTS GM
Sbjct  779  AIAAPVPTSKARSSIGRGRGNKPTVPKLGAQRINRTSSGM  818



>ref|XP_009590239.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nicotiana tomentosiformis]
Length=818

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 98/159 (62%), Gaps = 14/159 (9%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ-VSISRPKSISKMNTDDDDLW  606
            +N+KDGWDD+EP E P P  ALANIQAAQ+RPVSQPK Q +  S    ++K   +DDDLW
Sbjct  662  DNDKDGWDDIEPHEEPKPSPALANIQAAQRRPVSQPKLQGLRGSITPKVTK--NEDDDLW  719

Query  605  GsaaapvpkttkaaSSRGASF-----DNDPWDSVapapkttakkaaTV-----DDDLWGS  456
            GS  A  P    ++    +       D+DPW ++A    ++            D+D W +
Sbjct  720  GSVPASAPAPRTSSQPSSSRASRPVDDDDPWGAIAAPASSSKPLNVKKGGALDDNDPWAA  779

Query  455  IAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            IAAP PT  +RPSVGRGR +KP  PKLGAQRINRTS GM
Sbjct  780  IAAPVPTAKARPSVGRGRGNKPTVPKLGAQRINRTSSGM  818



>ref|XP_010322119.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Solanum lycopersicum]
Length=820

 Score = 80.9 bits (198),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLW  606
            +++KDGWDD+ P E P P  +LANIQAAQ+RPVSQPK Q +  R K+  KM+ DDD DLW
Sbjct  668  DSDKDGWDDINPQEEPKPSPSLANIQAAQRRPVSQPKPQGTGLRGKTTLKMSKDDDEDLW  727

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTV----DDDLWGSIAAPEP  438
            GS A P P+ T   +++    D+      APAP +            D+D W +IAAP P
Sbjct  728  GSLAVPAPRATSQPANKKVDDDDPWAAIAAPAPSSKPLNVKRSGALDDNDPWAAIAAPVP  787

Query  437  TTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T+++RPS+GR R +KPAAPKLG QR+NRTS GM
Sbjct  788  TSSARPSIGRSRGTKPAAPKLGGQRVNRTSSGM  820



>ref|XP_010322118.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Solanum lycopersicum]
Length=824

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDD-DLW  606
            +++KDGWDD+ P E P P  +LANIQAAQ+RPVSQPK Q +  R K+  KM+ DDD DLW
Sbjct  672  DSDKDGWDDINPQEEPKPSPSLANIQAAQRRPVSQPKPQGTGLRGKTTLKMSKDDDEDLW  731

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTV----DDDLWGSIAAPEP  438
            GS A P P+ T   +++    D+      APAP +            D+D W +IAAP P
Sbjct  732  GSLAVPAPRATSQPANKKVDDDDPWAAIAAPAPSSKPLNVKRSGALDDNDPWAAIAAPVP  791

Query  437  TTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T+++RPS+GR R +KPAAPKLG QR+NRTS GM
Sbjct  792  TSSARPSIGRSRGTKPAAPKLGGQRVNRTSSGM  824



>ref|XP_011463428.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Fragaria vesca subsp. vesca]
Length=797

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 98/147 (67%), Gaps = 21/147 (14%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTD-DDDLW  606
            E++KDGWDD+EPLE P P  ALANIQAAQKRPVSQ + + +  RPK+ +K+  D DDDLW
Sbjct  665  ESDKDGWDDIEPLEEPTPSPALANIQAAQKRPVSQSQPKQASLRPKNTAKVIKDEDDDLW  724

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTAS  426
            GS AAP PKT+  A +   S   D                   DDD W +IAAP PTT +
Sbjct  725  GSIAAPAPKTSSKALNLNTSRAVDD------------------DDDPWAAIAAPLPTTKA  766

Query  425  RP-SVGRGR-SKPAAPKLGAQRINRTS  351
            +P ++GRGR +KPAAPKLGAQRINRTS
Sbjct  767  KPLALGRGRGAKPAAPKLGAQRINRTS  793



>ref|XP_004297714.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Fragaria vesca subsp. vesca]
Length=798

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 99/149 (66%), Gaps = 24/149 (16%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQ--PKSQVSISRPKSISKMNTD-DDD  612
            E++KDGWDD+EPLE P P  ALANIQAAQKRPVSQ  PK   S+ RPK+ +K+  D DDD
Sbjct  665  ESDKDGWDDIEPLEEPTPSPALANIQAAQKRPVSQSQPKQAASL-RPKNTAKVIKDEDDD  723

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWGS AAP PKT+  A +   S   D                   DDD W +IAAP PTT
Sbjct  724  LWGSIAAPAPKTSSKALNLNTSRAVDD------------------DDDPWAAIAAPLPTT  765

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
             ++P ++GRGR +KPAAPKLGAQRINRTS
Sbjct  766  KAKPLALGRGRGAKPAAPKLGAQRINRTS  794



>ref|XP_007225258.1| hypothetical protein PRUPE_ppa001574mg [Prunus persica]
 gb|EMJ26457.1| hypothetical protein PRUPE_ppa001574mg [Prunus persica]
Length=800

 Score = 78.6 bits (192),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISK-MNTDD  618
            E++KDGWDD+EPLE P P   LA+IQAAQKRPVSQP    K Q +  RPK+ +K +  +D
Sbjct  665  ESDKDGWDDIEPLEEPKPSPVLASIQAAQKRPVSQPVSQPKQQATSLRPKNTAKAIKNED  724

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAP PKT     +   S   D                   DDD W +IAAP+P
Sbjct  725  DDLWGSIAAPAPKTISKPLNLKTSGAVD-------------------DDDPWAAIAAPQP  765

Query  437  TTASRPSV---GRGRSKPAAPKLGAQRINRTS  351
            TT ++P     GRG +KPAAPKLGAQRINRTS
Sbjct  766  TTKAKPLAAVKGRG-TKPAAPKLGAQRINRTS  796



>ref|XP_003556441.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Glycine max]
 gb|KHN04976.1| Putative inactive serine/threonine-protein kinase scy1 [Glycine 
soja]
Length=793

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 90/154 (58%), Gaps = 28/154 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV---SISRPKSISKMNTDDD-  615
            EN+KDGWDD+EPLE   P  AL NIQAAQ+RPVSQP SQ+   S    KS  K++ D+D 
Sbjct  661  ENDKDGWDDLEPLEEIKPTPALVNIQAAQRRPVSQPVSQIKQASSLLSKSTPKLSKDEDG  720

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWG             SS+  S  +   D                DDD W SIAAP PT
Sbjct  721  DLWG-----SIAAPAPKSSKPLSLKSTVTD----------------DDDPWASIAAPAPT  759

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINR-TSPGM  342
            T ++P S GRGR +K AAPKLGAQRINR TS GM
Sbjct  760  TKAKPLSAGRGRGAKLAAPKLGAQRINRTTSSGM  793



>ref|XP_010321457.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Solanum lycopersicum]
Length=818

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 95/161 (59%), Gaps = 17/161 (11%)
 Frame = -3

Query  785  LENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLW  606
            L+ +KDGWDD+EP E P P   LANIQAAQKRPVSQPK QV+  R      +  DD+D W
Sbjct  662  LDGDKDGWDDIEPQEEPKPSPFLANIQAAQKRPVSQPKPQVASLR----GSIKNDDEDPW  717

Query  605  GsaaapvpkttkaaSSRGASF------DNDPWDSVap-----apkttakkaaTVD-DDLW  462
            GS  A  P    ++             D DPW +++            KK  ++D +D W
Sbjct  718  GSVPATAPAPRTSSQPSSTRSSRTVDDDEDPWGAISAPAPSAKSSLNVKKGGSLDANDPW  777

Query  461  GSIAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTSPGM  342
             +IAAP PT+ +R S+GRGR +KP  PKLGAQRINRTS GM
Sbjct  778  AAIAAPVPTSKARSSIGRGRGNKPTVPKLGAQRINRTSSGM  818



>ref|XP_008221084.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive serine/threonine-protein 
kinase scy1 [Prunus mume]
Length=796

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 94/152 (62%), Gaps = 28/152 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISK-MNTDD  618
            E++KDGWDD+EPLE P P   LA+IQAAQKRPVSQP    K Q +  RPK+ +K +  +D
Sbjct  661  ESDKDGWDDIEPLEDPKPSPVLASIQAAQKRPVSQPVSQPKQQATSLRPKNTAKAIKDED  720

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAP PKT     +   S   D                   DDD W +IAAP+P
Sbjct  721  DDLWGSIAAPAPKTISKPLNLKTSGAVD-------------------DDDPWAAIAAPQP  761

Query  437  TTASRPSV---GRGRSKPAAPKLGAQRINRTS  351
            TT ++P     GRG +KPAAPKLGAQRINRTS
Sbjct  762  TTKAKPLAAVKGRG-TKPAAPKLGAQRINRTS  792



>ref|XP_010554724.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Tarenaya hassleriana]
Length=801

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 97/158 (61%), Gaps = 30/158 (19%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ-------VSISRPK--SISKM  630
            +++K+GW D+EPLE P P  ALANIQAAQKRP SQP SQ        + SRPK  ++   
Sbjct  663  DSQKEGWGDLEPLEEPKPSPALANIQAAQKRPFSQPASQSSRLPVQATTSRPKATTVKAT  722

Query  629  NTDDDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIA  450
             T+DDDLWGS AAP+P  T  A +   +  +D                   DDD W +IA
Sbjct  723  KTEDDDLWGSIAAPMPGATSRALNAKRAGQDD-------------------DDDPWAAIA  763

Query  449  APEPTTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            AP PTT ++P + GRGR +KPAAPKLGAQRINRTS G 
Sbjct  764  APLPTTRAKPFTAGRGRAAKPAAPKLGAQRINRTSSGY  801



>ref|XP_010031076.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X3 [Eucalyptus grandis]
Length=798

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 92/151 (61%), Gaps = 27/151 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ----VSISRPKSISKMNTD-D  618
            E++KDGWDD+EPLE P P   LANIQAAQKRPVSQP S      +  RPKS  K+  D D
Sbjct  664  ESDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPVSHSKPPATSLRPKSAVKVTKDED  723

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAPVPK+     +   +                     T DDD W +IAAP P
Sbjct  724  DDLWGSIAAPVPKSASKPMTVKPAI--------------------TADDDPWAAIAAPLP  763

Query  437  TTASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            TT ++P S  R R +KPAAPKLGAQRINRTS
Sbjct  764  TTTAKPLSSSRIRGAKPAAPKLGAQRINRTS  794



>ref|XP_010031075.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Eucalyptus grandis]
Length=799

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 92/151 (61%), Gaps = 27/151 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ----VSISRPKSISKMNTD-D  618
            E++KDGWDD+EPLE P P   LANIQAAQKRPVSQP S      +  RPKS  K+  D D
Sbjct  665  ESDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPVSHSKPPATSLRPKSAVKVTKDED  724

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAPVPK+     +   +                     T DDD W +IAAP P
Sbjct  725  DDLWGSIAAPVPKSASKPMTVKPAI--------------------TADDDPWAAIAAPLP  764

Query  437  TTASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            TT ++P S  R R +KPAAPKLGAQRINRTS
Sbjct  765  TTTAKPLSSSRIRGAKPAAPKLGAQRINRTS  795



>ref|XP_010031074.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Eucalyptus grandis]
 gb|KCW50336.1| hypothetical protein EUGRSUZ_J00108 [Eucalyptus grandis]
Length=801

 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 92/151 (61%), Gaps = 27/151 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ----VSISRPKSISKMNTD-D  618
            E++KDGWDD+EPLE P P   LANIQAAQKRPVSQP S      +  RPKS  K+  D D
Sbjct  667  ESDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPVSHSKPPATSLRPKSAVKVTKDED  726

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAPVPK+     +   +                     T DDD W +IAAP P
Sbjct  727  DDLWGSIAAPVPKSASKPMTVKPAI--------------------TADDDPWAAIAAPLP  766

Query  437  TTASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            TT ++P S  R R +KPAAPKLGAQRINRTS
Sbjct  767  TTTAKPLSSSRIRGAKPAAPKLGAQRINRTS  797



>ref|NP_001146277.1| uncharacterized protein LOC100279852 [Zea mays]
 gb|ACL53620.1| unknown [Zea mays]
Length=823

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 96/154 (62%), Gaps = 11/154 (7%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV QPK  V+  S+P  +    ++DD LWG
Sbjct  666  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVVQPKQPVANSSKPNPLKAPKSEDDPLWG  725

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap---apkttakkaaTVDDDLWGSIAAP  444
              AA  PK+   ++    S   + ++D W S+A    +     K A    DDLWG+IAAP
Sbjct  726  PIAAAPPKSAVKSADIKPSTSHNDEDDLWGSIAAPPKSSGKPLKPAVANSDDLWGAIAAP  785

Query  443  EPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
             P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  786  PPATKARPLASSGRGRGTKPAQPKLGAQRIGRTS  819



>gb|AFW84753.1| hypothetical protein ZEAMMB73_694445 [Zea mays]
Length=865

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 96/154 (62%), Gaps = 11/154 (7%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV QPK  V+  S+P  +    ++DD LWG
Sbjct  708  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVVQPKQPVANSSKPNPLKAPKSEDDPLWG  767

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap---apkttakkaaTVDDDLWGSIAAP  444
              AA  PK+   ++    S   + ++D W S+A    +     K A    DDLWG+IAAP
Sbjct  768  PIAAAPPKSAVKSADIKPSTSHNDEDDLWGSIAAPPKSSGKPLKPAVANSDDLWGAIAAP  827

Query  443  EPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
             P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  828  PPATKARPLASSGRGRGTKPAQPKLGAQRIGRTS  861



>emb|CDM84765.1| unnamed protein product [Triticum aestivum]
Length=824

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 94/155 (61%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV-SISRPKSISKMNTDDDDLWG  603
            ++ +GWDD++P E   PP+ L+NIQAAQKRPV QPK  + S SRP   +    ++D LWG
Sbjct  666  SDNEGWDDVDPFEEKSPPSLLSNIQAAQKRPVVQPKQPIPSSSRPNQPAAPKAEEDALWG  725

Query  602  saaapvpkttkaaSSRGASF----DNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              A P  K    ++    S     D+D W S+A     +     K AA  +DDLWG+IAA
Sbjct  726  PTAVPALKIAPKSAGIKPSVSHNDDDDLWGSIAAPQPKSSGKALKPAAANNDDLWGAIAA  785

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  786  PPPATKARPLASSGRGRGAKPAQPKLGAQRIGRTS  820



>ref|XP_004495542.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X2 [Cicer arietinum]
Length=793

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 96/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS--RPKSISKMNTD-DDD  612
            EN+KDGWDD+EPLE   P  AL NIQAAQ+RPVSQP SQ   S  RPK   K+N D DDD
Sbjct  663  ENDKDGWDDLEPLEEAKPTPALTNIQAAQRRPVSQPVSQTKASSLRPKITPKLNKDEDDD  722

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWG+ AAP PKT K  + +  + D                     DDD W +IAAP P+T
Sbjct  723  LWGAIAAPAPKTAKPLNLKSTATD---------------------DDDPWAAIAAPAPST  761

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
             ++P S GRGR +KPAA KLGAQRINRTS G+
Sbjct  762  RAKPLSAGRGRGAKPAATKLGAQRINRTSSGI  793



>ref|XP_004495541.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X1 [Cicer arietinum]
Length=794

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 96/152 (63%), Gaps = 26/152 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS--RPKSISKMNTD-DDD  612
            EN+KDGWDD+EPLE   P  AL NIQAAQ+RPVSQP SQ   S  RPK   K+N D DDD
Sbjct  664  ENDKDGWDDLEPLEEAKPTPALTNIQAAQRRPVSQPVSQTKASSLRPKITPKLNKDEDDD  723

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWG+ AAP PKT K  + +  + D                     DDD W +IAAP P+T
Sbjct  724  LWGAIAAPAPKTAKPLNLKSTATD---------------------DDDPWAAIAAPAPST  762

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
             ++P S GRGR +KPAA KLGAQRINRTS G+
Sbjct  763  RAKPLSAGRGRGAKPAATKLGAQRINRTSSGI  794



>emb|CDY22472.1| BnaC03g22820D [Brassica napus]
Length=797

 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 96/155 (62%), Gaps = 30/155 (19%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP------KSQVSISRPKSISKMNTD  621
            E++KDGW D++P++ P P  AL+NIQAAQKRPVSQP       S+  +S  K+ +K+  +
Sbjct  665  ESDKDGW-DLDPIDEPKPAPALSNIQAAQKRPVSQPSRPPATSSRPKVSTAKATAKL--E  721

Query  620  DDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPE  441
            DDDLWGS AAP P TT    +   +  +D                   D+D W +IA P 
Sbjct  722  DDDLWGSIAAPPPATTSRPLNLKKTVQSD-------------------DEDPWAAIATPP  762

Query  440  PTTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            PTT ++P S GRGR +KPAAPKLGAQRINRTS GM
Sbjct  763  PTTRAKPLSSGRGRAAKPAAPKLGAQRINRTSSGM  797



>gb|KDP21639.1| hypothetical protein JCGZ_03310 [Jatropha curcas]
Length=799

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 95/154 (62%), Gaps = 26/154 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTD-D  618
            +N+KDGWDD+EPLE P    +LA IQAAQKRPVSQP    K Q +  RPK+  K+  D D
Sbjct  665  DNDKDGWDDVEPLEEPKVAPSLATIQAAQKRPVSQPVSQPKPQATSLRPKNTVKVTKDED  724

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAP P+T+    +   +   D                   DDD W +IAAP P
Sbjct  725  DDLWGSIAAPAPQTSSKRLAAKTALTLD-------------------DDDPWAAIAAPPP  765

Query  437  TTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            TT ++P S GRGR +KP APKLGAQRINRTS GM
Sbjct  766  TTRAKPLSAGRGRGAKPIAPKLGAQRINRTSSGM  799



>ref|XP_002458682.1| hypothetical protein SORBIDRAFT_03g038150 [Sorghum bicolor]
 gb|EES03802.1| hypothetical protein SORBIDRAFT_03g038150 [Sorghum bicolor]
Length=824

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV QPK  V+  S+   +    ++DD LWG
Sbjct  666  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVVQPKQAVANSSKSNPLKAPKSEDDPLWG  725

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA  PK+   ++    S   + ++D W S+A     +     K AA   DDLWG+IAA
Sbjct  726  PIAAAPPKSAVKSADIKPSTSHNDEDDLWGSIAAPPPKSSGKPLKPAAANSDDLWGAIAA  785

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  786  PPPATKARPLASSGRGRGTKPAQPKLGAQRIGRTS  820



>tpg|DAA57073.1| TPA: hypothetical protein ZEAMMB73_293561 [Zea mays]
Length=331

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV+QPK  V+  S+   +    ++DD LWG
Sbjct  173  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVAQPKQAVANSSKSNPLKAPKSEDDPLWG  232

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA  PK+    +    S   + ++D W S+A     +     K AA   DDLWG+IAA
Sbjct  233  PIAAAPPKSAAKPADIKPSTSHNDEDDLWGSIAAPPPKSSGKPLKPAAANSDDLWGAIAA  292

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S G+GR +KPA PKLGAQRI RTS
Sbjct  293  PPPGTKARPLASSGKGRGTKPAQPKLGAQRIGRTS  327



>ref|XP_010540261.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Tarenaya hassleriana]
Length=812

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 88/163 (54%), Gaps = 31/163 (19%)
 Frame = -3

Query  782  ENEKDGWDDMe-pleapippaalaniqaaQKRPV-SQPKSQ------VSISRPKSISKMN  627
            ++EK+GWDD+E   E    PA      A +KR V SQP SQ       + SRPK+I+ M 
Sbjct  665  DSEKEGWDDLEPLEEPKPSPALANIQAAQKKRTVSSQPASQSSRPLPATSSRPKNITTMK  724

Query  626  T----DDDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWG  459
                 DDDDLWGS AAP+P TT + +           D                DDD W 
Sbjct  725  AARAEDDDDLWGSIAAPMPGTTTSRALNAKKAAGQGKDD---------------DDDPWA  769

Query  458  SIAAPEPTTASRPSV-GRGRS---KPAAPKLGAQRINRTSPGM  342
            +IAAP PTT ++P + GRGR    KPAA KLGAQRINRTS GM
Sbjct  770  AIAAPLPTTRAKPLMSGRGRGGGVKPAASKLGAQRINRTSSGM  812



>ref|XP_002280870.1| PREDICTED: N-terminal kinase-like protein [Vitis vinifera]
 emb|CBI25347.3| unnamed protein product [Vitis vinifera]
Length=794

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 85/175 (49%), Gaps = 79/175 (45%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            E++KDGWDD+EPLE P PP+ALANIQAAQKRPVSQPK QV  SRPK   K++ D+D    
Sbjct  664  ESDKDGWDDIEPLEEPKPPSALANIQAAQKRPVSQPKPQVP-SRPKIPPKVSKDED----  718

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                                                       DDLWGSIAAP P TAS+
Sbjct  719  -------------------------------------------DDLWGSIAAPAPKTASK  735

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            P                              S GRGR +KPAAPKLGAQRINRTS
Sbjct  736  PLNVKTAGAVDNDDPWAAIAAPPPTTRAKPLSAGRGRGAKPAAPKLGAQRINRTS  790



>ref|XP_010111055.1| putative inactive serine/threonine-protein kinase scy1 [Morus 
notabilis]
 gb|EXC29917.1| putative inactive serine/threonine-protein kinase scy1 [Morus 
notabilis]
Length=815

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 96/153 (63%), Gaps = 25/153 (16%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPV----SQPKSQVSISRPKSISKMNTDDD  615
            E +KDGWDD+EPLE P P  AL+NIQAAQKRPV    SQPK   +  RPKS +    +DD
Sbjct  682  ETDKDGWDDIEPLEEPKPSPALSNIQAAQKRPVVLHASQPKQPATSLRPKSTAMAKNNDD  741

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWGS AAP PKT+    +  AS   D                   DDD W +IAAP PT
Sbjct  742  DLWGSIAAPAPKTSSKPLNLKASATVD-------------------DDDPWAAIAAPAPT  782

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T ++P S G+GR +KPAAPKLGAQ+INRTS GM
Sbjct  783  TRAKPLSAGKGRGAKPAAPKLGAQKINRTSSGM  815



>ref|XP_008674884.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Zea mays]
Length=823

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV+QPK  V+  S+   +    ++DD LWG
Sbjct  665  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVAQPKQAVANSSKSNPLKAPKSEDDPLWG  724

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA  PK+    +    S   + ++D W S+A     +     K AA   DDLWG+IAA
Sbjct  725  PIAAAPPKSAAKPADIKPSTSHNDEDDLWGSIAAPPPKSSGKPLKPAAANSDDLWGAIAA  784

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S G+GR +KPA PKLGAQRI RTS
Sbjct  785  PPPGTKARPLASSGKGRGTKPAQPKLGAQRIGRTS  819



>ref|XP_008674885.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Zea mays]
Length=778

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 96/155 (62%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++KDGWDD++P E    P+ L+NIQAAQKRPV+QPK  V+  S+   +    ++DD LWG
Sbjct  620  SDKDGWDDVDPFEDKPSPSLLSNIQAAQKRPVAQPKQAVANSSKSNPLKAPKSEDDPLWG  679

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA  PK+    +    S   + ++D W S+A     +     K AA   DDLWG+IAA
Sbjct  680  PIAAAPPKSAAKPADIKPSTSHNDEDDLWGSIAAPPPKSSGKPLKPAAANSDDLWGAIAA  739

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S G+GR +KPA PKLGAQRI RTS
Sbjct  740  PPPGTKARPLASSGKGRGTKPAQPKLGAQRIGRTS  774



>emb|CAN63376.1| hypothetical protein VITISV_042412 [Vitis vinifera]
Length=770

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 85/175 (49%), Gaps = 79/175 (45%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            E++KDGWDD+EPLE P PP+ALANIQAAQKRPVSQPK QV  SRPK   K++ D+D    
Sbjct  640  ESDKDGWDDIEPLEEPKPPSALANIQAAQKRPVSQPKPQVP-SRPKIPPKVSKDED----  694

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                                                       DDLWGSIAAP P TAS+
Sbjct  695  -------------------------------------------DDLWGSIAAPAPKTASK  711

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            P                              S GRGR +KPAAPKLGAQRINRTS
Sbjct  712  PLNVKTAGAVDDDDPWAAIAAPPPTXRAKPLSAGRGRGAKPAAPKLGAQRINRTS  766



>gb|EMT22366.1| N-terminal kinase-like protein [Aegilops tauschii]
Length=808

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 94/155 (61%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV-SISRPKSISKMNTDDDDLWG  603
            ++ +GWDD++P E   PP+ L+NIQAAQKRPV QPK  + S SR    +    ++D LWG
Sbjct  650  SDNEGWDDVDPFEEKSPPSLLSNIQAAQKRPVVQPKQPIPSSSRSNQPAAPKAEEDALWG  709

Query  602  saaapvpkttkaaSSRGASF----DNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              A P PK    ++    S     D+D W S+A     +     K AA  +DDLWG+IAA
Sbjct  710  PTAVPAPKIAPKSAGIKPSVSHNDDDDLWGSIAAPQPKSSGKALKPAAANNDDLWGAIAA  769

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  770  PPPATKARPLASSGRGRGAKPAQPKLGAQRIGRTS  804



>ref|XP_004970383.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X1 [Setaria italica]
Length=826

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS-RPKSISKMNTDDDDLWG  603
            ++K+GWDD++P +    P+ L+NIQAAQKRPV QPK   + S +   +    ++DD LWG
Sbjct  668  SDKEGWDDVDPFDDKPSPSLLSNIQAAQKRPVVQPKQAAATSAKSHQLKAPKSEDDPLWG  727

Query  602  saaap----vpkttkaaSSRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA       K+     S   + ++D W ++A     +     K AA   DD+WGSIAA
Sbjct  728  PIAAAPPKSASKSADVKPSTSHNDEDDLWGTIAAPAPKSSGKPLKAAAANSDDIWGSIAA  787

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P+T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  788  PPPSTKARPLASSGRGRGTKPAQPKLGAQRIGRTS  822



>ref|XP_004970384.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like isoform X2 [Setaria italica]
Length=824

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS-RPKSISKMNTDDDDLWG  603
            ++K+GWDD++P +    P+ L+NIQAAQKRPV QPK   + S +   +    ++DD LWG
Sbjct  666  SDKEGWDDVDPFDDKPSPSLLSNIQAAQKRPVVQPKQAAATSAKSHQLKAPKSEDDPLWG  725

Query  602  saaap----vpkttkaaSSRGASFDNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              AA       K+     S   + ++D W ++A     +     K AA   DD+WGSIAA
Sbjct  726  PIAAAPPKSASKSADVKPSTSHNDEDDLWGTIAAPAPKSSGKPLKAAAANSDDIWGSIAA  785

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P+T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  786  PPPSTKARPLASSGRGRGTKPAQPKLGAQRIGRTS  820



>ref|NP_001044644.1| Os01g0819900 [Oryza sativa Japonica Group]
 dbj|BAD73564.1| putative kinase-like protein splice variant 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06558.1| Os01g0819900 [Oryza sativa Japonica Group]
 dbj|BAG90404.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64980.1| hypothetical protein OsJ_19897 [Oryza sativa Japonica Group]
Length=825

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 103/161 (64%), Gaps = 23/161 (14%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT------DD  618
            ++K+GWDD++P +   PP+ L+NIQAAQKRPV+QPK  VS S     S++N       ++
Sbjct  666  SDKEGWDDVDPFDEKPPPSLLSNIQAAQKRPVAQPKQPVSNS-----SRLNQPKVPKPEE  720

Query  617  DDLWGsaaapvpkttkaaS----SRGASFDNDPWDSVapapkttakk-----aaTVDDDL  465
            D LWGS AAP PK    +S    S   + D+D W S+A  P  +A K     AA   DDL
Sbjct  721  DPLWGSIAAPAPKNASKSSDIKPSTSHNDDDDLWGSIAAPPPKSAGKPLKPPAAANSDDL  780

Query  464  WGSIAAPEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            WG+IAAP P+T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  781  WGAIAAPPPSTKARPLASSGRGRGTKPAQPKLGAQRIGRTS  821



>ref|XP_003564494.1| PREDICTED: N-terminal kinase-like protein [Brachypodium distachyon]
Length=823

 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 84/154 (55%), Gaps = 12/154 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS-ISRPKSISKMNTDDDDLWG  603
            ++K+GWDD++P E            A  KRPV QPK  VS  SR         DDD LWG
Sbjct  666  SDKEGWDDVDPFEKSPQSLLSNIQAAQ-KRPVVQPKQPVSNSSRSNPPMAPKADDDALWG  724

Query  602  saaapvpkttkaaS----SRGASFDNDPWDSVapapkttakk----aaTVDDDLWGSIAA  447
              A P PK+   ++    S   + D+D W S+A     ++ K    AA  +DDLWG+IAA
Sbjct  725  PMAVPAPKSALKSADIKPSTSHNADDDLWGSIAAPQPKSSGKPLKPAAANNDDLWGAIAA  784

Query  446  PEPTTASRP--SVGRGRSKPAAPKLGAQRINRTS  351
            P P T +RP  S GRGR    APKLGAQRI RTS
Sbjct  785  PPPVTKARPLASSGRGRGAKPAPKLGAQRIGRTS  818



>gb|KEH27102.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=798

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV--SISRPKSISKMNTD-DDD  612
            EN+KDGWDD+EPLE   P  AL NIQAAQ+RPV QP SQ   S SRPK   +++ D D+D
Sbjct  667  ENDKDGWDDLEPLEETKPTPALTNIQAAQRRPVVQPVSQTKASSSRPKIPPRLSRDEDED  726

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWG             +SR  + ++   +                DDD W +IAAP PTT
Sbjct  727  LWG-----AIAAPAPTTSRPLNLNSTTTN----------------DDDPWAAIAAPAPTT  765

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTSPG  345
             +RP + GRGR +KPAAPKLGAQRINRTS G
Sbjct  766  RARPLAAGRGRGAKPAAPKLGAQRINRTSSG  796



>ref|XP_007011362.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
 gb|EOY20172.1| Kinase family protein with ARM repeat domain isoform 1 [Theobroma 
cacao]
Length=802

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 81/179 (45%), Gaps = 82/179 (46%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDD  615
            E+EKDGWDD+EPLE P P  ALANIQAAQKRPVSQP    K Q    RPKS  K+  D+D
Sbjct  667  ESEKDGWDDIEPLEEPKPSPALANIQAAQKRPVSQPVSQPKPQAKSLRPKSTVKVTKDED  726

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
                                                           DDLWGSIAAP P 
Sbjct  727  -----------------------------------------------DDLWGSIAAPPPK  739

Query  434  TASRP------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            +AS+P                              S GRGR +KPAAPKLGAQRINRTS
Sbjct  740  SASKPLNVKTAGAVDDDDPWAAIAAPPPTTKAKPLSAGRGRGAKPAAPKLGAQRINRTS  798



>gb|EMS65875.1| N-terminal kinase-like protein [Triticum urartu]
Length=910

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV-SISRPKSISKMNTDDDDLWG  603
            ++ +GWDD++P E   PP+ L+NIQAAQKRPV QPK  + S SR    +    ++D LWG
Sbjct  752  SDNEGWDDVDPFEEKSPPSLLSNIQAAQKRPVVQPKQPIPSSSRSNQPAAPKAEEDALWG  811

Query  602  saaapvpkttkaaSSRGASF----DNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
              A P PK    ++    S     D+D W S+A     +     K AA  +DDLWG+IAA
Sbjct  812  PTAVPAPKIAPKSAGIKPSVSHNDDDDLWGSIAAPQPKSSGKALKPAAANNDDLWGAIAA  871

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S  RGR +KPA PKLGAQRI RTS
Sbjct  872  PPPATKARPLASSSRGRGAKPAQPKLGAQRIGRTS  906



>dbj|BAJ85082.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=824

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 12/155 (8%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV-SISRPKSISKMNTDDDDLWG  603
            ++ +GWDD++P E   PP+ L+NIQAAQKRPV  PK  + S SR    +    ++D LWG
Sbjct  666  SDNEGWDDVDPFEEKSPPSLLSNIQAAQKRPVVHPKQPIPSSSRSNPPAAPKAEEDALWG  725

Query  602  saaapvpkttkaaSSRGASF----DNDPWDSVap----apkttakkaaTVDDDLWGSIAA  447
                P PK+   ++    S     D+D W S+A     +     K AA  +DDLWG+IAA
Sbjct  726  PTVVPAPKSAPKSAGIKPSVSHNDDDDLWGSIAAPQPKSSGKALKPAAANNDDLWGAIAA  785

Query  446  PEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            P P T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  786  PPPATKARPLASSGRGRGAKPAQPKLGAQRIGRTS  820



>ref|XP_007011363.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
 gb|EOY20173.1| Kinase family protein with ARM repeat domain isoform 2 [Theobroma 
cacao]
Length=803

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 81/180 (45%), Gaps = 83/180 (46%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQ-----VSISRPKSISKMNTDD  618
            E+EKDGWDD+EPLE P P  ALANIQAAQKRPVSQP SQ         RPKS  K+  D+
Sbjct  667  ESEKDGWDDIEPLEEPKPSPALANIQAAQKRPVSQPVSQPKPQAAKSLRPKSTVKVTKDE  726

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            D                                               DDLWGSIAAP P
Sbjct  727  D-----------------------------------------------DDLWGSIAAPPP  739

Query  437  TTASRP------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
             +AS+P                              S GRGR +KPAAPKLGAQRINRTS
Sbjct  740  KSASKPLNVKTAGAVDDDDPWAAIAAPPPTTKAKPLSAGRGRGAKPAAPKLGAQRINRTS  799



>gb|EEC71713.1| hypothetical protein OsI_04229 [Oryza sativa Indica Group]
Length=825

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 101/161 (63%), Gaps = 23/161 (14%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT------DD  618
            ++ +GWDD++P +   PP+ L+NIQAAQKRPV+QPK  VS S     S++N       ++
Sbjct  666  SDNEGWDDVDPYDEKPPPSLLSNIQAAQKRPVAQPKQPVSNS-----SRLNQPKVPKPEE  720

Query  617  DDLWGsaaapvpkttkaaS----SRGASFDNDPWDSVapapkttakka-----aTVDDDL  465
            D LWGS AAP PK    +S    S   + D+D W S+A  P  +A K      A   DDL
Sbjct  721  DPLWGSIAAPAPKNASKSSDIKPSTSHNDDDDLWGSIAAPPPKSAGKPLKPPPAANSDDL  780

Query  464  WGSIAAPEPTTASRP--SVGRGR-SKPAAPKLGAQRINRTS  351
            WG+IAAP P+T +RP  S GRGR +KPA PKLGAQRI RTS
Sbjct  781  WGAIAAPPPSTKARPLASSGRGRGTKPAQPKLGAQRIGRTS  821



>ref|XP_006644915.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Oryza brachyantha]
Length=822

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 95/156 (61%), Gaps = 16/156 (10%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS----ISRPKSISKMNTDDDD  612
            ++K+GWDD++P +   PP+ L+NIQAAQKRPV Q K  VS    +++PK+      +DD 
Sbjct  666  SDKEGWDDVDPFDEKPPPSLLSNIQAAQKRPVVQAKQPVSNSSRLNQPKA---HKPEDDP  722

Query  611  LWG----saaapvpkttkaaSSRGASFDNDPWDSVap----apkttakkaaTVDDDLWGS  456
            LWG     A     K+    SS   S D+D W S+A     +     K AA   DDLWG+
Sbjct  723  LWGPIAAPAPKNAAKSADIKSSASHSDDDDLWGSIAAPPPKSAGKPLKSAAANSDDLWGA  782

Query  455  IAAPEPTTASRPSVGRGR-SKPAAPKLGAQRINRTS  351
            IAAP P+T +RP  GRGR +KPA PKLGAQRI RTS
Sbjct  783  IAAPPPSTKARPLSGRGRGTKPAQPKLGAQRIGRTS  818



>ref|XP_002325930.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
 gb|EEF00312.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
Length=794

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 76/177 (43%), Gaps = 81/177 (46%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDD  612
            ++KDGWDD+EP E P P  AL NIQAAQKRPVSQP    K+Q +  RPKS  K+  D+D 
Sbjct  661  SDKDGWDDIEPFEEPKPSPALVNIQAAQKRPVSQPVSQHKAQATSLRPKSTVKVTNDED-  719

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
                                                          DDLWGSIAAP P T
Sbjct  720  ----------------------------------------------DDLWGSIAAPAPKT  733

Query  431  ASRP------------------------------SVGRGRSKPAAPKLGAQRINRTS  351
             +RP                                GRGR KPAA KLGAQRINRTS
Sbjct  734  TTRPLNVKSATALDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAASKLGAQRINRTS  790



>ref|XP_006371290.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
 gb|ERP49087.1| hypothetical protein POPTR_0019s08720g [Populus trichocarpa]
Length=801

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 76/177 (43%), Gaps = 81/177 (46%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDD  612
            ++KDGWDD+EP E P P  AL NIQAAQKRPVSQP    K+Q +  RPKS  K+  D+D 
Sbjct  668  SDKDGWDDIEPFEEPKPSPALVNIQAAQKRPVSQPVSQHKAQATSLRPKSTVKVTNDED-  726

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
                                                          DDLWGSIAAP P T
Sbjct  727  ----------------------------------------------DDLWGSIAAPAPKT  740

Query  431  ASRP------------------------------SVGRGRSKPAAPKLGAQRINRTS  351
             +RP                                GRGR KPAA KLGAQRINRTS
Sbjct  741  TTRPLNVKSATALDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAASKLGAQRINRTS  797



>gb|KHG02829.1| N-terminal kinase-like protein [Gossypium arboreum]
Length=723

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 88/148 (59%), Gaps = 24/148 (16%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT---DDDDL  609
            ++KDGWDD++PLE P P +ALANIQAAQKRPVSQPK Q +  R KS  K      +DDDL
Sbjct  590  SDKDGWDDIKPLEEPKPSSALANIQAAQKRPVSQPKPQATSLRSKSTVKAVATKDEDDDL  649

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            WGS A                    P   +A          A  DDD W +IAAP PTT 
Sbjct  650  WGSIAV-------------------PTPKIASKSLKVKTSGAVEDDDPWAAIAAPPPTTK  690

Query  428  SRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            ++P S GRGR +K AAPKLGAQRINRTS
Sbjct  691  AKPLSAGRGRGTKAAAPKLGAQRINRTS  718



>emb|CDX93162.1| BnaC04g47340D [Brassica napus]
Length=795

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 41/76 (54%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGRS-KPA  390
            DDDLWGSIAAP+P T SRP                              S GRGR+ KPA
Sbjct  720  DDDLWGSIAAPQPATTSRPLNLKKTVQSDDEDPWAAIAAPPPTTRAKPLSSGRGRAAKPA  779

Query  389  APKLGAQRINRTSPGM  342
            APKLGAQRINRTS GM
Sbjct  780  APKLGAQRINRTSSGM  795



>ref|XP_010252046.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
Length=796

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 94/147 (64%), Gaps = 22/147 (15%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMN-TDDDDLW  606
            +++KDGWDD+EPLE   PP ALA IQAAQKRPVSQPK QV+  R K++ K    +DDDLW
Sbjct  665  DSDKDGWDDVEPLEEQKPPPALATIQAAQKRPVSQPKPQVTGVRTKNVVKATKVEDDDLW  724

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTAS  426
            GS AAP P+T+    +   +  +D                   DDD W +IAAP PTT +
Sbjct  725  GSIAAPAPQTSSKPLNLKQAAMHD-------------------DDDPWAAIAAPPPTTKA  765

Query  425  RP-SVGRGR-SKPAAPKLGAQRINRTS  351
            +P S GRGR +K A PKLGAQRINRTS
Sbjct  766  KPLSAGRGRGTKAAVPKLGAQRINRTS  792



>ref|XP_011001384.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Populus euphratica]
Length=801

 Score = 62.8 bits (151),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 77/177 (44%), Gaps = 81/177 (46%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDD  612
            ++KDGWDD+EP E P P  ALANIQAAQKRPVSQP    K+Q +  RPKS  K+  D+D 
Sbjct  668  SDKDGWDDIEPFEEPKPSPALANIQAAQKRPVSQPVSQHKTQATSLRPKSTVKVTKDED-  726

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
                                                          DDLWGSIAAP P T
Sbjct  727  ----------------------------------------------DDLWGSIAAPAPKT  740

Query  431  ASRP------------------------------SVGRGRSKPAAPKLGAQRINRTS  351
             +RP                                GRGR KPAA KLGAQR+NRTS
Sbjct  741  TTRPLNVKSATALDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAASKLGAQRVNRTS  797



>ref|XP_008780109.1| PREDICTED: uncharacterized protein LOC103699893 [Phoenix dactylifera]
Length=240

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 80/153 (52%), Gaps = 12/153 (8%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLW  606
            + +K+GWDD++P+E   PP   +   A   RPV QPK   S  RPK+  K    +DDDLW
Sbjct  87   DGDKEGWDDIDPVEEQKPPPLASIQAAQ-NRPVVQPKPAASSMRPKTTLKPSKAEDDDLW  145

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVap-------apkttakkaaTVDDDLWGSIAA  447
            G+            +S  +  D+D W S+A                 A+ D D W +IAA
Sbjct  146  GTPRTASRSLHVKPAS--SQDDDDLWGSIAAPPPKTTAKSLNRKTTMASDDSDPWAAIAA  203

Query  446  PEPTTASRPSVGRGR-SKPAAPKLGAQRINRTS  351
            P  T A   S+GRGR +KPA  KLGAQRI+RTS
Sbjct  204  PPSTKAKPLSLGRGRGAKPAPVKLGAQRIDRTS  236



>gb|KJB67945.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=796

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 87/148 (59%), Gaps = 24/148 (16%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT---DDDDL  609
            ++KDGWDD+EPLE P P + LANIQAAQKRPVSQPK Q +  R KS  K      +DDDL
Sbjct  663  SDKDGWDDIEPLEEPKPSSVLANIQAAQKRPVSQPKPQATSLRSKSTVKAVATKDEDDDL  722

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            WGS A                    P   +A          A  DDD W +IAAP PTT 
Sbjct  723  WGSIAV-------------------PTPKIASKSLKVKTSGAVEDDDPWAAIAAPPPTTK  763

Query  428  SRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            ++P S GRGR +K AAPKLGAQRINRTS
Sbjct  764  AKPLSAGRGRGTKAAAPKLGAQRINRTS  791



>gb|KJB67946.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=799

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 87/148 (59%), Gaps = 24/148 (16%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT---DDDDL  609
            ++KDGWDD+EPLE P P + LANIQAAQKRPVSQPK Q +  R KS  K      +DDDL
Sbjct  666  SDKDGWDDIEPLEEPKPSSVLANIQAAQKRPVSQPKPQATSLRSKSTVKAVATKDEDDDL  725

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            WGS A                    P   +A          A  DDD W +IAAP PTT 
Sbjct  726  WGSIAV-------------------PTPKIASKSLKVKTSGAVEDDDPWAAIAAPPPTTK  766

Query  428  SRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            ++P S GRGR +K AAPKLGAQRINRTS
Sbjct  767  AKPLSAGRGRGTKAAAPKLGAQRINRTS  794



>gb|KJB67947.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=789

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 87/148 (59%), Gaps = 24/148 (16%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNT---DDDDL  609
            ++KDGWDD+EPLE P P + LANIQAAQKRPVSQPK Q +  R KS  K      +DDDL
Sbjct  656  SDKDGWDDIEPLEEPKPSSVLANIQAAQKRPVSQPKPQATSLRSKSTVKAVATKDEDDDL  715

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            WGS A                    P   +A          A  DDD W +IAAP PTT 
Sbjct  716  WGSIAV-------------------PTPKIASKSLKVKTSGAVEDDDPWAAIAAPPPTTK  756

Query  428  SRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            ++P S GRGR +K AAPKLGAQRINRTS
Sbjct  757  AKPLSAGRGRGTKAAAPKLGAQRINRTS  784



>ref|XP_006486152.1| PREDICTED: LOW QUALITY PROTEIN: N-terminal kinase-like protein-like 
[Citrus sinensis]
Length=799

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 80/178 (45%), Gaps = 78/178 (44%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            +++KDGWDD+EPLE P P   LANIQAAQKRPVSQP+   +  RPKS  K+  ++D    
Sbjct  669  DSDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPRPTATSLRPKSTGKVPKEED----  724

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                                                       DDLWGSIAAP P T+S+
Sbjct  725  -------------------------------------------DDLWGSIAAPAPRTSSK  741

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            P                              + GRGR +KP  PKLGAQRINRTS GM
Sbjct  742  PLNVKPAAALDDDDPWAAIAAPPPTTKAKPLAAGRGRGAKPVVPKLGAQRINRTSXGM  799



>ref|XP_002319344.2| HEAT repeat-containing family protein [Populus trichocarpa]
 gb|EEE95267.2| HEAT repeat-containing family protein [Populus trichocarpa]
Length=842

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 78/175 (45%), Gaps = 81/175 (46%)
 Frame = -3

Query  773  KDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDDLW  606
            KDGWDD+EPLE P P  ALA+IQAAQKRPVSQP    K+Q +  RPKS  +   D+D   
Sbjct  711  KDGWDDIEPLEEPKPSPALASIQAAQKRPVSQPVSQQKAQAASVRPKSTGRATKDED---  767

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP----  438
                                                        DDLWGSIAAP P    
Sbjct  768  --------------------------------------------DDLWGSIAAPAPKTNK  783

Query  437  -------------------------TTASRPSV-GRGRSKPAAPKLGAQRINRTS  351
                                     TT ++P V GRGR KPAAPKLGAQRINRTS
Sbjct  784  KPLNVKSATALDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAAPKLGAQRINRTS  838



>ref|XP_011010141.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Populus euphratica]
Length=800

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 80/178 (45%), Gaps = 82/178 (46%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDD  612
            ++KDGWDD+EPLE P P  ALA+IQAAQKRPVSQP    K+Q +  RPKS  +   D+D 
Sbjct  666  SDKDGWDDIEPLEEPKPSPALASIQAAQKRPVSQPVSQQKAQAASVRPKSTGRATKDED-  724

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP--  438
                                                          DDLWGSIAAP P  
Sbjct  725  ----------------------------------------------DDLWGSIAAPAPKT  738

Query  437  ----------------------------TTASRPSV-GRGRSKPAAPKLGAQRINRTS  351
                                        TT ++P V GRGR KPAAPKLGAQRINRTS
Sbjct  739  NKKPLNVKSATALDDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAAPKLGAQRINRTS  796



>ref|XP_011010140.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010142.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010143.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010144.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
 ref|XP_011010146.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Populus euphratica]
Length=801

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 80/178 (45%), Gaps = 82/178 (46%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSISRPKSISKMNTDDDD  612
            ++KDGWDD+EPLE P P  ALA+IQAAQKRPVSQP    K+Q +  RPKS  +   D+D 
Sbjct  667  SDKDGWDDIEPLEEPKPSPALASIQAAQKRPVSQPVSQQKAQAASVRPKSTGRATKDED-  725

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP--  438
                                                          DDLWGSIAAP P  
Sbjct  726  ----------------------------------------------DDLWGSIAAPAPKT  739

Query  437  ----------------------------TTASRPSV-GRGRSKPAAPKLGAQRINRTS  351
                                        TT ++P V GRGR KPAAPKLGAQRINRTS
Sbjct  740  NKKPLNVKSATALDDDDDPWAAIAAPPPTTRAKPLVAGRGRGKPAAPKLGAQRINRTS  797



>ref|XP_006411339.1| hypothetical protein EUTSA_v10016269mg [Eutrema salsugineum]
 gb|ESQ52792.1| hypothetical protein EUTSA_v10016269mg [Eutrema salsugineum]
Length=798

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 40/76 (53%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGRS-KPA  390
            DDDLWGSIAAP P T SRP                              S GRGR+ KPA
Sbjct  723  DDDLWGSIAAPPPATTSRPLNLKKTVQADDEDPWAAIAAPPPTTRAKPLSSGRGRAAKPA  782

Query  389  APKLGAQRINRTSPGM  342
            APKLGAQRINRTS GM
Sbjct  783  APKLGAQRINRTSSGM  798



>gb|KHN29287.1| N-terminal kinase-like protein [Glycine soja]
Length=780

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 80/179 (45%), Gaps = 81/179 (45%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKS---QVSISRPKSISKMNTDDDDL  609
            +++DGWDD+EPLE   P  ALANIQAAQ+RPVSQP S   Q S    KS  K+N D+D  
Sbjct  650  SDRDGWDDLEPLEETKPAPALANIQAAQRRPVSQPISHTKQASNLLSKSTPKLNKDED--  707

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
                                                         DDLWGSIAAP P TA
Sbjct  708  ---------------------------------------------DDLWGSIAAPAPKTA  722

Query  428  SRP-----------------------------SVGRGR-SKPAAPKLGAQRINRTSPGM  342
             RP                             S GRGR +KPAAPKLGAQRINRTS GM
Sbjct  723  -RPLNLKSAQTDDDDPWAAIAAPAPTTKAKPLSTGRGRGAKPAAPKLGAQRINRTSSGM  780



>gb|KDO67541.1| hypothetical protein CISIN_1g0040252mg, partial [Citrus sinensis]
 gb|KDO67542.1| hypothetical protein CISIN_1g0040252mg, partial [Citrus sinensis]
Length=260

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 79/175 (45%), Gaps = 78/175 (45%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            +++KDGWDD+EPLE P P   LANIQAAQKRPVSQP+   +  RPKS  K+  ++D    
Sbjct  133  DSDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPRPTATSLRPKSTGKVPKEED----  188

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                                                       DDLWGSIAAP P T+S+
Sbjct  189  -------------------------------------------DDLWGSIAAPAPRTSSK  205

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            P                              + GRGR +KP APKLGAQRINRTS
Sbjct  206  PLNVKPAAALDDDDPWAAIAAPPPTTKAKPLAAGRGRGAKPVAPKLGAQRINRTS  260



>ref|XP_009133450.1| PREDICTED: N-terminal kinase-like protein [Brassica rapa]
Length=797

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 40/76 (53%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGR-SKPA  390
            DDDLWGSIAAP P T SRP                              S GRGR +KPA
Sbjct  722  DDDLWGSIAAPPPATTSRPLNLKKSVQSDDEDPWAAIAAPPPTTRAKPLSSGRGRGAKPA  781

Query  389  APKLGAQRINRTSPGM  342
            APKLGAQRINRTS GM
Sbjct  782  APKLGAQRINRTSSGM  797



>emb|CDY35443.1| BnaA03g19170D [Brassica napus]
Length=797

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 40/76 (53%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGR-SKPA  390
            DDDLWGSIAAP P T SRP                              S GRGR +KPA
Sbjct  722  DDDLWGSIAAPPPATTSRPLNLKKSVQSDDEDPWAAIAAPPPTTRAKPLSSGRGRGAKPA  781

Query  389  APKLGAQRINRTSPGM  342
            APKLGAQRINRTS GM
Sbjct  782  APKLGAQRINRTSSGM  797



>gb|KJB67948.1| hypothetical protein B456_010G219100 [Gossypium raimondii]
Length=800

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 88/149 (59%), Gaps = 25/149 (17%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS-RPKSISKMNT---DDDD  612
            ++KDGWDD+EPLE P P + LANIQAAQKRPVSQPK Q + S R KS  K      +DDD
Sbjct  666  SDKDGWDDIEPLEEPKPSSVLANIQAAQKRPVSQPKPQAATSLRSKSTVKAVATKDEDDD  725

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWGS A                    P   +A          A  DDD W +IAAP PTT
Sbjct  726  LWGSIAV-------------------PTPKIASKSLKVKTSGAVEDDDPWAAIAAPPPTT  766

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
             ++P S GRGR +K AAPKLGAQRINRTS
Sbjct  767  KAKPLSAGRGRGTKAAAPKLGAQRINRTS  795



>ref|XP_006587814.1| PREDICTED: N-terminal kinase-like protein-like [Glycine max]
Length=793

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 80/179 (45%), Gaps = 81/179 (45%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKS---QVSISRPKSISKMNTDDDDL  609
            +++DGWDD+EPLE   P  ALANIQAAQ+RPVSQP S   Q S    KS  K+N D+D  
Sbjct  663  SDRDGWDDLEPLEETKPAPALANIQAAQRRPVSQPISHTKQASNLLSKSTPKLNKDED--  720

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
                                                         DDLWGSIAAP P TA
Sbjct  721  ---------------------------------------------DDLWGSIAAPAPKTA  735

Query  428  SRP-----------------------------SVGRGR-SKPAAPKLGAQRINRTSPGM  342
             RP                             S GRGR +KPAAPKLGAQRINRTS GM
Sbjct  736  -RPLNLKSAQTDDDDPWAAIAAPAPTIKAKPLSAGRGRGAKPAAPKLGAQRINRTSSGM  793



>ref|XP_006435941.1| hypothetical protein CICLE_v10030740mg [Citrus clementina]
 gb|ESR49181.1| hypothetical protein CICLE_v10030740mg [Citrus clementina]
Length=796

 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 93/149 (62%), Gaps = 26/149 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKM-NTDDDDLW  606
            +++KDGWDD+EPLE P P   LANIQAAQKRPVSQP+   +  RPKS  K+   +DDDLW
Sbjct  669  DSDKDGWDDIEPLEEPKPSPVLANIQAAQKRPVSQPRPTATSLRPKSTGKVPKEEDDDLW  728

Query  605  GsaaapvpkttkaaSSR--GASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            GS AAP P+T+    +    A+ D                     DDD W +IAAP PTT
Sbjct  729  GSIAAPAPRTSSKPLNVKPAAALD---------------------DDDPWAAIAAPPPTT  767

Query  431  ASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
             ++P + GRGR +KP  PKLGAQRINRTS
Sbjct  768  KAKPLAAGRGRGAKPVVPKLGAQRINRTS  796



>ref|XP_008782671.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Phoenix dactylifera]
Length=816

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 84/174 (48%), Gaps = 52/174 (30%)
 Frame = -3

Query  776  EKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLWGs  600
            +K+GWDD++P+E   PP   +   A  KRPV QPK   S  RPK+  K    DDDDLWG+
Sbjct  659  DKEGWDDVDPVEEQKPPPLASIQAAQ-KRPVVQPKPAASSMRPKTTLKPSKADDDDLWGA  717

Query  599  aaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP  420
             AAP P+T   + +   +   D                   DDDLWGSIAAP P T ++ 
Sbjct  718  VAAPAPRTASRSLNVKPASSQD-------------------DDDLWGSIAAPPPKTTAKS  758

Query  419  ------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
                                          S+GRGR +KPA+ KLGAQRI+RTS
Sbjct  759  LNLKTTMASDDSDPWAAIAAPPPSTKAKPLSLGRGRGAKPASAKLGAQRIDRTS  812



>ref|XP_008782670.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Phoenix dactylifera]
Length=826

 Score = 58.2 bits (139),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 84/174 (48%), Gaps = 52/174 (30%)
 Frame = -3

Query  776  EKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLWGs  600
            +K+GWDD++P+E   PP   +   A  KRPV QPK   S  RPK+  K    DDDDLWG+
Sbjct  669  DKEGWDDVDPVEEQKPPPLASIQAAQ-KRPVVQPKPAASSMRPKTTLKPSKADDDDLWGA  727

Query  599  aaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP  420
             AAP P+T   + +   +   D                   DDDLWGSIAAP P T ++ 
Sbjct  728  VAAPAPRTASRSLNVKPASSQD-------------------DDDLWGSIAAPPPKTTAKS  768

Query  419  ------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
                                          S+GRGR +KPA+ KLGAQRI+RTS
Sbjct  769  LNLKTTMASDDSDPWAAIAAPPPSTKAKPLSLGRGRGAKPASAKLGAQRIDRTS  822



>ref|XP_008340425.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Malus domestica]
Length=797

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 79/178 (44%), Gaps = 81/178 (46%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPK---SQVSISRPKSISKMNTDDDD  612
            E++KDGWDD+EPLE P P   LA+IQAAQKRPVSQP     Q +  RPK+ +K   ++D 
Sbjct  663  ESDKDGWDDVEPLEEPKPSPVLASIQAAQKRPVSQPALQPKQATSLRPKNTAKAIKNED-  721

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
                                                          DDLWGSIAAP P T
Sbjct  722  ----------------------------------------------DDLWGSIAAPAPRT  735

Query  431  ASRP------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
             S+P                              SV +GR +KPAAPKLGAQRINRTS
Sbjct  736  VSKPLNVKASAAVDDDDPWAAIAAPPPSTKAKPLSVAKGRGAKPAAPKLGAQRINRTS  793



>dbj|BAF02142.1| hypothetical protein [Arabidopsis thaliana]
Length=798

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 39/76 (51%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGR-SKPA  390
            DDDLWGSIAAP P T SRP                              S GRGR +KPA
Sbjct  723  DDDLWGSIAAPPPATTSRPLNVKKTVQSDDEDPWAAIAAPPPTTRAKPLSSGRGRGAKPA  782

Query  389  APKLGAQRINRTSPGM  342
            A KLGAQRINRTS GM
Sbjct  783  ALKLGAQRINRTSSGM  798



>ref|XP_007143981.1| hypothetical protein PHAVU_007G118900g [Phaseolus vulgaris]
 gb|ESW15975.1| hypothetical protein PHAVU_007G118900g [Phaseolus vulgaris]
Length=793

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 99/152 (65%), Gaps = 28/152 (18%)
 Frame = -3

Query  779  NEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSIS---RPKSISKMNTDDDDL  609
            N+KDGWDD+EPLE   P +ALANIQAAQ+RPVSQP SQ  ++   + KS S+ + +DD+L
Sbjct  664  NDKDGWDDLEPLEEMKPTSALANIQAAQRRPVSQPVSQTKLASSLQSKSTSRKD-EDDEL  722

Query  608  WGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            WGS AAP PKT+K  + + +  D                     DDD W +IAAP PT+ 
Sbjct  723  WGSIAAPAPKTSKPLNLKSSVTD---------------------DDDPWAAIAAPAPTSK  761

Query  428  SRP-SVGRGRS-KPAAPKLGAQRINR-TSPGM  342
            ++P S GRGRS K AAPKLGAQRINR TS GM
Sbjct  762  AKPLSSGRGRSAKAAAPKLGAQRINRTTSSGM  793



>ref|NP_181605.2| cytoplasmic tRNA export protein [Arabidopsis thaliana]
 gb|AEC09869.1| cytoplasmic tRNA export protein [Arabidopsis thaliana]
Length=798

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 39/76 (51%), Gaps = 31/76 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEPTTASRP------------------------------SVGRGR-SKPA  390
            DDDLWGSIAAP P T SRP                              S GRGR +KPA
Sbjct  723  DDDLWGSIAAPPPATTSRPLNVKKTVQSDDEDPWAAIAAPPPTTRAKPLSSGRGRGAKPA  782

Query  389  APKLGAQRINRTSPGM  342
            A KLGAQRINRTS GM
Sbjct  783  ALKLGAQRINRTSSGM  798



>ref|XP_008460279.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Cucumis melo]
Length=794

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 88/146 (60%), Gaps = 21/146 (14%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            E EKDGWD++EPL+ P P  ALANIQAAQKRPVSQP SQ      +S ++   +DDDLWG
Sbjct  664  ETEKDGWDELEPLDEPKPSPALANIQAAQKRPVSQPVSQTKPPSSRSTARPAKEDDDLWG  723

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
            S AAP P+      +  +S   D                   DDD W +IAAP PTT ++
Sbjct  724  SIAAPAPRAVSKPLNVKSSAPVD-------------------DDDPWAAIAAPAPTTRAK  764

Query  422  P-SVGRGRSKPAA-PKLGAQRINRTS  351
            P S GRGR   AA PKLGAQRINRTS
Sbjct  765  PLSAGRGRGNKAAPPKLGAQRINRTS  790



>ref|XP_008810839.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 [Phoenix dactylifera]
Length=825

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 85/177 (48%), Gaps = 55/177 (31%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLW  606
            +++K GWDD++P+E   PP   +   A  +RPV QPK   S  RPK+ SK    +DDDLW
Sbjct  667  DSDKSGWDDIDPVEEQKPPLLASIQAAQ-RRPVVQPKPAASSLRPKTTSKPSKAEDDDLW  725

Query  605  Gsaaa-pvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTA  429
            G+ AA      +++ + + AS  +                    DDDLWGSIAAP P T 
Sbjct  726  GAIAAPAPKTASRSLNVKSASLQD--------------------DDDLWGSIAAPPPKT-  764

Query  428  SRP------------------------------SVGRGRS-KPAAPKLGAQRINRTS  351
            +RP                              S+GRGR  KPA  KLGAQRI+RTS
Sbjct  765  TRPLNPKTTMASDDSDPWAAIAAAPPNTKAKPLSLGRGRGVKPAPAKLGAQRIDRTS  821



>ref|XP_010253047.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
 ref|XP_010253048.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Nelumbo nucifera]
Length=815

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 92/144 (64%), Gaps = 22/144 (15%)
 Frame = -3

Query  773  KDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLWGsa  597
            KDGWDD++P E   PP ALA+IQAAQK+PVSQPK QV++ + K++ K +  +D+ LWGS 
Sbjct  687  KDGWDDIDPFEEQKPPPALASIQAAQKQPVSQPKPQVTVQQSKNMVKGIKEEDNHLWGSI  746

Query  596  aapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP-  420
            AAP P+T+    +   +  +D                   D D W +IAAP PTT ++P 
Sbjct  747  AAPAPQTSSKPLNLKQAKTHD-------------------DGDPWAAIAAPPPTTKAKPL  787

Query  419  SVGRGR-SKPAAPKLGAQRINRTS  351
            S GRGR +K AAPKLGAQRINRTS
Sbjct  788  SAGRGRGTKGAAPKLGAQRINRTS  811



>ref|XP_010253050.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X3 [Nelumbo nucifera]
Length=796

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 92/144 (64%), Gaps = 22/144 (15%)
 Frame = -3

Query  773  KDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLWGsa  597
            KDGWDD++P E   PP ALA+IQAAQK+PVSQPK QV++ + K++ K +  +D+ LWGS 
Sbjct  668  KDGWDDIDPFEEQKPPPALASIQAAQKQPVSQPKPQVTVQQSKNMVKGIKEEDNHLWGSI  727

Query  596  aapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP-  420
            AAP P+T+    +   +  +D                   D D W +IAAP PTT ++P 
Sbjct  728  AAPAPQTSSKPLNLKQAKTHD-------------------DGDPWAAIAAPPPTTKAKPL  768

Query  419  SVGRGR-SKPAAPKLGAQRINRTS  351
            S GRGR +K AAPKLGAQRINRTS
Sbjct  769  SAGRGRGTKGAAPKLGAQRINRTS  792



>ref|XP_010253049.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nelumbo nucifera]
Length=810

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 92/144 (64%), Gaps = 22/144 (15%)
 Frame = -3

Query  773  KDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISK-MNTDDDDLWGsa  597
            KDGWDD++P E   PP ALA+IQAAQK+PVSQPK QV++ + K++ K +  +D+ LWGS 
Sbjct  682  KDGWDDIDPFEEQKPPPALASIQAAQKQPVSQPKPQVTVQQSKNMVKGIKEEDNHLWGSI  741

Query  596  aapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP-  420
            AAP P+T+    +   +  +D                   D D W +IAAP PTT ++P 
Sbjct  742  AAPAPQTSSKPLNLKQAKTHD-------------------DGDPWAAIAAPPPTTKAKPL  782

Query  419  SVGRGR-SKPAAPKLGAQRINRTS  351
            S GRGR +K AAPKLGAQRINRTS
Sbjct  783  SAGRGRGTKGAAPKLGAQRINRTS  806



>ref|XP_004144420.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Cucumis sativus]
 ref|XP_004160990.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1-like [Cucumis sativus]
Length=796

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 79/175 (45%), Gaps = 77/175 (44%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            E EKDGWD++EPL+ P P  ALANIQAAQKRPVSQP SQ   ++P  +S           
Sbjct  664  ETEKDGWDELEPLDEPKPSPALANIQAAQKRPVSQPVSQ---TKPPILS-----------  709

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                          SR A    +                   DDDLWGSIAAP P T S+
Sbjct  710  -------------GSRSARPAKE-------------------DDDLWGSIAAPAPRTVSK  737

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            P                              S GRGR SK AAPKLGAQRINRTS
Sbjct  738  PLNVKSSAPVDDDDPWAAIAAPAPSTRAKPLSAGRGRGSKAAAPKLGAQRINRTS  792



>ref|XP_008460276.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
 ref|XP_008460277.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
 ref|XP_008460278.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X1 [Cucumis melo]
Length=797

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 90/149 (60%), Gaps = 24/149 (16%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVS---ISRPKSISKMNTDDDD  612
            E EKDGWD++EPL+ P P  ALANIQAAQKRPVSQP SQ     +S  +S ++   +DDD
Sbjct  664  ETEKDGWDELEPLDEPKPSPALANIQAAQKRPVSQPVSQTKPPILSGSRSTARPAKEDDD  723

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTT  432
            LWGS AAP P+      +  +S   D                   DDD W +IAAP PTT
Sbjct  724  LWGSIAAPAPRAVSKPLNVKSSAPVD-------------------DDDPWAAIAAPAPTT  764

Query  431  ASRP-SVGRGRSKPAA-PKLGAQRINRTS  351
             ++P S GRGR   AA PKLGAQRINRTS
Sbjct  765  RAKPLSAGRGRGNKAAPPKLGAQRINRTS  793



>gb|KHG09100.1| N-terminal kinase-like protein [Gossypium arboreum]
Length=703

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 94/152 (62%), Gaps = 27/152 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSIS-RPKSISKMNTD-  621
            +++KDGWDD+EPL+ P P +ALANIQAAQKRPVSQP    K Q S S RPKS  K   D 
Sbjct  567  DSDKDGWDDIEPLDEPKPSSALANIQAAQKRPVSQPVSQPKPQASTSLRPKSTVKAAKDE  626

Query  620  DDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPE  441
            DDDLWGS AA  PK+     +   +   D                   DDD W +IAAP 
Sbjct  627  DDDLWGSIAAAPPKSASRPLNVKTAGAVD-------------------DDDPWAAIAAPP  667

Query  440  PTTASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            PTT ++P S GRGR ++ AAPKLGAQRINRTS
Sbjct  668  PTTKAKPLSAGRGRGNRAAAPKLGAQRINRTS  699



>ref|XP_010252047.1| PREDICTED: probable inactive serine/threonine-protein kinase 
scy1 isoform X2 [Nelumbo nucifera]
Length=794

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 89/146 (61%), Gaps = 22/146 (15%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            +++KDGWDD+EPLE   PP ALA IQAAQKRPVSQPK Q  +     +     +DDDLWG
Sbjct  665  DSDKDGWDDVEPLEEQKPPPALATIQAAQKRPVSQPKPQ-GVRTKNVVKATKVEDDDLWG  723

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
            S AAP P+T+    +   +  +D                   DDD W +IAAP PTT ++
Sbjct  724  SIAAPAPQTSSKPLNLKQAAMHD-------------------DDDPWAAIAAPPPTTKAK  764

Query  422  P-SVGRGR-SKPAAPKLGAQRINRTS  351
            P S GRGR +K A PKLGAQRINRTS
Sbjct  765  PLSAGRGRGTKAAVPKLGAQRINRTS  790



>gb|KGN58429.1| hypothetical protein Csa_3G642700 [Cucumis sativus]
Length=648

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 78/175 (45%), Gaps = 80/175 (46%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQVSISRPKSISKMNTDDDDLWG  603
            E EKDGWD++EPL+ P P  ALANIQAAQKRPVSQP   VS ++P S             
Sbjct  189  ETEKDGWDELEPLDEPKPSPALANIQAAQKRPVSQP---VSQTKPPS-------------  232

Query  602  saaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASR  423
                          SR A    +                   DDDLWGSIAAP P T S+
Sbjct  233  --------------SRSARPAKE-------------------DDDLWGSIAAPAPRTVSK  259

Query  422  P------------------------------SVGRGR-SKPAAPKLGAQRINRTS  351
            P                              S GRGR SK AAPKLGAQRINRTS
Sbjct  260  PLNVKSSAPVDDDDPWAAIAAPAPSTRAKPLSAGRGRGSKAAAPKLGAQRINRTS  314



>gb|KFK36944.1| hypothetical protein AALP_AA4G192400 [Arabis alpina]
Length=807

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 94/150 (63%), Gaps = 27/150 (18%)
 Frame = -3

Query  770  DGWDDMepleapippaalaniqaaQKRPVSQP-KSQVSISRPKSISKMN----TDDDDLW  606
            +GW D+EPL+ P P  AL+NIQAAQKRPVSQP +   + SRPK IS +     T+DDDLW
Sbjct  678  NGWGDLEPLDEPKPSPALSNIQAAQKRPVSQPSRPPATSSRPK-ISAVKAAPKTEDDDLW  736

Query  605  GsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPTTAS  426
            GS AAP P TT    +   +  +D                   D+D W +IAAP PTT +
Sbjct  737  GSIAAPAPATTSRPLNLKKTVQSD-------------------DEDPWAAIAAPPPTTRA  777

Query  425  RP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            +P S GRGR +KPAAPKLGAQRINRTS GM
Sbjct  778  KPLSSGRGRGAKPAAPKLGAQRINRTSSGM  807



>gb|KHN40459.1| Putative inactive serine/threonine-protein kinase scy1 [Glycine 
soja]
Length=790

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 39/71 (55%), Gaps = 29/71 (41%)
 Frame = -3

Query  476  DDDLWGSIAAPEP---------------------------TTASRP-SVGRGR-SKPAAP  384
            DDDLWGSIAAP P                           TT ++P S GRGR +KPAAP
Sbjct  720  DDDLWGSIAAPAPKTARPLNLKSAQTDDDDPWAAIAAPAPTTKAKPLSTGRGRGAKPAAP  779

Query  383  KLGAQRINRTS  351
            KLGAQRINRTS
Sbjct  780  KLGAQRINRTS  790



>ref|XP_007139742.1| hypothetical protein PHAVU_008G055600g [Phaseolus vulgaris]
 gb|ESW11736.1| hypothetical protein PHAVU_008G055600g [Phaseolus vulgaris]
Length=796

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 80/180 (44%), Gaps = 80/180 (44%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQPKSQV---SISRPKSISKMNTDDDD  612
            E+++DGWD++EPLE   P  ALANIQAAQ+RPVSQP SQ    S    K+  K+N D+D 
Sbjct  664  ESDRDGWDELEPLEETKPAPALANIQAAQRRPVSQPISQTKQASNLLSKTTPKLNKDED-  722

Query  611  LWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP--  438
                                                          DDLWGSIAAP P  
Sbjct  723  ----------------------------------------------DDLWGSIAAPAPKT  736

Query  437  --------------------------TTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
                                      TT ++P S  R R +KPAAPKLGAQRINRTS GM
Sbjct  737  GRPLSLKTAQTDDDDDPWAAIAAPAPTTKAKPLSTSRVRVAKPAAPKLGAQRINRTSSGM  796



>ref|XP_006293704.1| hypothetical protein CARUB_v10022662mg [Capsella rubella]
 gb|EOA26602.1| hypothetical protein CARUB_v10022662mg [Capsella rubella]
Length=798

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 97/153 (63%), Gaps = 26/153 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP-KSQVSISRPK---SISKMNTDDD  615
            E++KDGWD +EPL+ PI   ALANIQAAQKRPVSQ  +   + SRPK   + + + T+DD
Sbjct  666  ESDKDGWD-LEPLDEPIASPALANIQAAQKRPVSQSSRPAATSSRPKISAAKAAVKTEDD  724

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWGS AAP P TT    +   +  +D                   D+D W +IAAP PT
Sbjct  725  DLWGSIAAPPPATTSRPLNLKKTVQSD-------------------DEDPWAAIAAPPPT  765

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T ++P S GRGR +KPAAP+LGAQRINRTS GM
Sbjct  766  TRAKPLSSGRGRGAKPAAPRLGAQRINRTSSGM  798



>gb|KJB60173.1| hypothetical protein B456_009G292700 [Gossypium raimondii]
 gb|KJB60174.1| hypothetical protein B456_009G292700 [Gossypium raimondii]
Length=858

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 94/152 (62%), Gaps = 27/152 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP----KSQVSIS-RPKSISKMNTD-  621
            +++KDGWDD+EPL+ P P  ALANIQAAQKRPVSQP    K Q S S RPKS  K   D 
Sbjct  722  DSDKDGWDDIEPLDEPKPSPALANIQAAQKRPVSQPVSQPKPQASTSLRPKSTVKAAKDE  781

Query  620  DDDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPE  441
            DDDLWGS AAP PK+     +   +   D                   DDD W +IAAP 
Sbjct  782  DDDLWGSIAAPPPKSASRPLNVKTAGAVD-------------------DDDPWAAIAAPP  822

Query  440  PTTASRP-SVGRGR-SKPAAPKLGAQRINRTS  351
            PTT ++P S GRGR ++ AAPKLGAQRINRTS
Sbjct  823  PTTKAKPLSAGRGRGNRAAAPKLGAQRINRTS  854



>ref|XP_010508814.1| PREDICTED: N-terminal kinase-like protein isoform X1 [Camelina 
sativa]
 ref|XP_010508816.1| PREDICTED: N-terminal kinase-like protein isoform X2 [Camelina 
sativa]
Length=799

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 91/153 (59%), Gaps = 25/153 (16%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP-KSQVSISRPK---SISKMNTDDD  615
            E++KDGWD +EPL+ P P  ALANIQAAQKRPVSQ  +   + SRPK   + + + T+DD
Sbjct  666  ESDKDGWD-LEPLDEPKPSPALANIQAAQKRPVSQSSRPAATSSRPKITAAKAAVKTEDD  724

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWG                  S    P  + +           + D+D W +IAAP PT
Sbjct  725  DLWG------------------SIAAPPPATTSRPLNLKKTTVQSDDEDPWAAIAAPPPT  766

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T ++P S GRGR +KPAAP+LGAQRINRTS GM
Sbjct  767  TRAKPLSSGRGRGAKPAAPRLGAQRINRTSSGM  799



>ref|XP_010517510.1| PREDICTED: N-terminal kinase-like protein [Camelina sativa]
Length=797

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 97/154 (63%), Gaps = 28/154 (18%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP-KSQVSISRPKSISKMN----TDD  618
            E++KDGWD +EPL+ P P  ALANIQAAQKRPVSQ  +   + SRPK IS +     T+D
Sbjct  665  ESDKDGWD-LEPLDEPKPSPALANIQAAQKRPVSQSSRPTATSSRPK-ISAVKAAAKTED  722

Query  617  DDLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEP  438
            DDLWGS AAP P TT    +   +  +D                   D+D W +IAAP P
Sbjct  723  DDLWGSIAAPPPATTSRPLNLKKTVQSD-------------------DEDPWAAIAAPPP  763

Query  437  TTASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            TT ++P S GRGR +KPAAP+LGAQRINRTS GM
Sbjct  764  TTRAKPLSSGRGRGAKPAAPRLGAQRINRTSSGM  797



>ref|XP_009141929.1| PREDICTED: N-terminal kinase-like protein [Brassica rapa]
Length=796

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 73/126 (58%), Gaps = 29/126 (23%)
 Frame = -3

Query  695  KRPVSQPK------SQVSISRPKSISKMNTDDDDLWGsaaapvpkttkaaSSRGASFDND  534
            KRPVSQP       S+  IS  K+ +K  ++DDDLWGS AAP P TT    +   +  +D
Sbjct  692  KRPVSQPSRPPATSSRPKISTAKAAAK--SEDDDLWGSLAAPQPATTSRPLNLKKTVQSD  749

Query  533  PWDSVapapkttakkaaTVDDDLWGSIAAPEPTTASRP-SVGRGR-SKPAAPKLGAQRIN  360
                               D+D W +IAAP PTT ++P + GRGR +KPAAPKLGAQRIN
Sbjct  750  -------------------DEDPWAAIAAPPPTTRAKPLASGRGRAAKPAAPKLGAQRIN  790

Query  359  RTSPGM  342
            RTS GM
Sbjct  791  RTSSGM  796



>ref|XP_010505824.1| PREDICTED: N-terminal kinase-like protein [Camelina sativa]
Length=798

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 96/153 (63%), Gaps = 26/153 (17%)
 Frame = -3

Query  782  ENEKDGWDDMepleapippaalaniqaaQKRPVSQP-KSQVSISRPK---SISKMNTDDD  615
            E++KDGWD +EPL+ P P  ALANIQAAQKRPVSQ  +   + SRPK   + + + T+DD
Sbjct  666  ESDKDGWD-LEPLDEPKPSPALANIQAAQKRPVSQSSRPAATSSRPKITAAKAAVKTEDD  724

Query  614  DLWGsaaapvpkttkaaSSRGASFDNDPWDSVapapkttakkaaTVDDDLWGSIAAPEPT  435
            DLWGS AAP P TT    +   +  +D                    +D W +IAAP PT
Sbjct  725  DLWGSIAAPPPATTSRPLNSKKTVQSD-------------------GEDPWAAIAAPPPT  765

Query  434  TASRP-SVGRGR-SKPAAPKLGAQRINRTSPGM  342
            T ++P S GRGR +KPAAP+LGAQRINRTS GM
Sbjct  766  TRAKPLSSGRGRGAKPAAPRLGAQRINRTSSGM  798



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360