BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014E09

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    163   2e-43   Theobroma cacao [chocolate]
gb|KJB16228.1|  hypothetical protein B456_002G218400                    159   4e-42   Gossypium raimondii
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    158   2e-41   Citrus sinensis [apfelsine]
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             157   2e-41   Citrus clementina [clementine]
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    157   3e-41   Vitis vinifera
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     156   5e-41   Populus euphratica
ref|XP_002311458.2|  zinc finger family protein                         155   8e-41   Populus trichocarpa [western balsam poplar]
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              155   1e-40   Gossypium arboreum [tree cotton]
gb|AFX73409.1|  constans-like protein 5                                 155   1e-40   Gossypium hirsutum [American cotton]
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    154   3e-40   Nicotiana sylvestris
emb|CDO98435.1|  unnamed protein product                                153   5e-40   Coffea canephora [robusta coffee]
ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   2e-39   Nicotiana tomentosiformis
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    151   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               150   1e-38   Morus notabilis
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   5e-38   Populus euphratica
ref|XP_002531628.1|  conserved hypothetical protein                     148   6e-38   Ricinus communis
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                146   2e-37   
gb|AHI45078.1|  COL domain class transcription factor                   146   4e-37   Boehmeria nivea [Chinese silk-plant]
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    145   7e-37   Nicotiana tomentosiformis
emb|CDP00619.1|  unnamed protein product                                145   1e-36   Coffea canephora [robusta coffee]
gb|AGM20692.1|  COL6-2                                                  144   1e-36   Populus tomentosa [Chinese white poplar]
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   2e-36   Nicotiana sylvestris
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   2e-36   Solanum lycopersicum
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    139   2e-36   Glycine soja [wild soybean]
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   4e-36   Populus euphratica
ref|XP_002533412.1|  transcription factor, putative                     142   7e-36   Ricinus communis
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          142   7e-36   Glycine max [soybeans]
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             141   8e-36   Citrus clementina [clementine]
ref|NP_001239992.1|  uncharacterized protein LOC100802113               140   9e-36   
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    140   4e-35   Vitis vinifera
emb|CAN73757.1|  hypothetical protein VITISV_026326                     140   5e-35   Vitis vinifera
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   5e-35   Solanum tuberosum [potatoes]
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       140   5e-35   Glycine max [soybeans]
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   6e-35   Eucalyptus grandis [rose gum]
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   7e-35   Citrus sinensis [apfelsine]
ref|XP_004135402.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   7e-35   
gb|KGN52081.1|  hypothetical protein Csa_5G609670                       139   7e-35   Cucumis sativus [cucumbers]
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    138   2e-34   Glycine max [soybeans]
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    138   2e-34   Glycine soja [wild soybean]
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    137   2e-34   Cucumis melo [Oriental melon]
gb|KDP20116.1|  hypothetical protein JCGZ_05885                         137   3e-34   Jatropha curcas
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   3e-34   Nicotiana sylvestris
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    137   3e-34   Phoenix dactylifera
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   3e-34   Nicotiana tomentosiformis
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   4e-34   Elaeis guineensis
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             137   5e-34   Phaseolus vulgaris [French bean]
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein          131   5e-34   
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    137   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   9e-34   
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    136   1e-33   
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    136   1e-33   Solanum lycopersicum
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     134   2e-33   Lagerstroemia indica [crape-myrtle]
gb|KDP29405.1|  hypothetical protein JCGZ_18326                         135   2e-33   Jatropha curcas
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       135   3e-33   Glycine max [soybeans]
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   4e-33   Pyrus x bretschneideri [bai li]
gb|AHI45077.1|  COL domain class transcription factor                   134   5e-33   Boehmeria nivea [Chinese silk-plant]
ref|XP_006829901.1|  hypothetical protein AMTR_s00073p00061640          134   5e-33   Amborella trichopoda
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             134   7e-33   
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             134   7e-33   
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   1e-32   Solanum tuberosum [potatoes]
ref|XP_007036519.1|  Transcription factor, putative                     133   1e-32   
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   1e-32   
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    133   1e-32   Solanum lycopersicum
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    133   2e-32   Prunus mume [ume]
gb|ADK63396.1|  B-box type zinc finger protein                          130   2e-32   Brassica rapa
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     132   2e-32   Malus domestica [apple tree]
gb|KEH44219.1|  zinc finger constans-like protein                       132   3e-32   Medicago truncatula
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              132   3e-32   Gossypium arboreum [tree cotton]
gb|KJB34352.1|  hypothetical protein B456_006G061600                    131   5e-32   Gossypium raimondii
gb|KJB34354.1|  hypothetical protein B456_006G061600                    131   6e-32   Gossypium raimondii
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     130   7e-32   Sesamum indicum [beniseed]
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   8e-32   Populus euphratica
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   9e-32   Pyrus x bretschneideri [bai li]
emb|CDY07383.1|  BnaA07g24620D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   1e-31   
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   1e-31   Fragaria vesca subsp. vesca
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    130   1e-31   Solanum tuberosum [potatoes]
ref|XP_004164163.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   2e-31   
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             129   3e-31   Phaseolus vulgaris [French bean]
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   3e-31   
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   3e-31   
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    129   4e-31   Fragaria vesca subsp. vesca
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   4e-31   Pyrus x bretschneideri [bai li]
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     128   4e-31   Lagerstroemia indica [crape-myrtle]
emb|CDY44890.1|  BnaA02g13920D                                          128   5e-31   Brassica napus [oilseed rape]
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     128   6e-31   Brassica rapa
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    128   6e-31   Tarenaya hassleriana [spider flower]
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             128   8e-31   Eutrema salsugineum [saltwater cress]
emb|CDX81527.1|  BnaC02g18310D                                          127   1e-30   
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-30   Cicer arietinum [garbanzo]
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               127   2e-30   Morus notabilis
ref|XP_002888669.1|  zinc finger (B-box type) family protein            126   3e-30   Arabidopsis lyrata subsp. lyrata
emb|CDY03851.1|  BnaC07g10760D                                          125   3e-30   
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   4e-30   Cucumis melo [Oriental melon]
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   5e-30   
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   125   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    125   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    125   7e-30   Arabis alpina [alpine rockcress]
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   7e-30   Cucumis sativus [cucumbers]
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY53119.1|  BnaCnng24470D                                          125   8e-30   Brassica napus [oilseed rape]
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             125   8e-30   Prunus persica
emb|CDY04230.1|  BnaC06g25850D                                          122   9e-30   
gb|AAM61001.1|  putative B-box zinc finger protein                      124   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   2e-29   Prunus mume [ume]
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             124   2e-29   Capsella rubella
gb|EEE59794.1|  hypothetical protein OsJ_12314                          120   2e-29   Oryza sativa Japonica Group [Japonica rice]
emb|CDX77359.1|  BnaC08g04040D                                          119   2e-29   
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   2e-29   
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     124   2e-29   
gb|KJB23747.1|  hypothetical protein B456_004G113000                    124   3e-29   Gossypium raimondii
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    124   3e-29   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY65591.1|  BnaC05g50730D                                          122   4e-29   Brassica napus [oilseed rape]
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   5e-29   Camelina sativa [gold-of-pleasure]
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                122   7e-29   Erythranthe guttata [common monkey flower]
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             122   1e-28   Capsella rubella
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   1e-28   
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             121   2e-28   Eutrema salsugineum [saltwater cress]
emb|CDY51133.1|  BnaA07g37160D                                          120   2e-28   Brassica napus [oilseed rape]
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    120   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   6e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001051053.1|  Os03g0711100                                       120   6e-28   
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    119   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF98510.1|  CCT motif family protein, expressed                     118   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     119   1e-27   Brachypodium distachyon [annual false brome]
emb|CDY67920.1|  BnaAnng25560D                                          117   2e-27   Brassica napus [oilseed rape]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   3e-27   Brassica rapa
gb|AAM13173.1|  unknown protein                                         117   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 117   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49208.1|  unknown                                                 114   3e-27   Medicago truncatula
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  117   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   4e-27   Brassica rapa
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             117   6e-27   
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   8e-27   Cicer arietinum [garbanzo]
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   9e-27   
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                    115   1e-26   Triticum urartu
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   1e-26   Camelina sativa [gold-of-pleasure]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                          116   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    116   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     115   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420          115   2e-26   Sorghum bicolor [broomcorn]
gb|EMT27110.1|  hypothetical protein F775_43077                         115   2e-26   
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   2e-26   Setaria italica
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    115   3e-26   
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             114   3e-26   Phaseolus vulgaris [French bean]
gb|AFK37106.1|  unknown                                                 115   4e-26   Medicago truncatula
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       114   5e-26   Glycine max [soybeans]
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                114   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  114   7e-26   Medicago truncatula
gb|KGN63817.1|  hypothetical protein Csa_1G023050                       113   8e-26   Cucumis sativus [cucumbers]
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       113   9e-26   Glycine max [soybeans]
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   1e-25   
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                   113   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    113   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg             112   2e-25   Capsella rubella
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    112   2e-25   Cucumis melo [Oriental melon]
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             112   2e-25   Phaseolus vulgaris [French bean]
gb|EAZ00428.1|  hypothetical protein OsI_22452                          112   2e-25   Oryza sativa Indica Group [Indian rice]
dbj|BAK01505.1|  predicted protein                                      112   4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   5e-25   Oryza brachyantha
gb|AFX97569.1|  K                                                       107   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   6e-25   
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   6e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002887511.1|  zinc finger (B-box type) family protein            111   7e-25   
dbj|BAK04456.1|  predicted protein                                      110   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    110   1e-24   Elaeis guineensis
ref|NP_001149548.1|  CCT motif family protein                           110   1e-24   Zea mays [maize]
gb|AFX97570.1|  K                                                       106   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    110   2e-24   Brachypodium distachyon [annual false brome]
gb|EPS73837.1|  hypothetical protein M569_00919                         109   2e-24   Genlisea aurea
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   2e-24   
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   3e-24   
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    109   3e-24   Phoenix dactylifera
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   3e-24   
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                108   6e-24   Erythranthe guttata [common monkey flower]
ref|NP_001048022.1|  Os02g0731700                                       107   7e-24   
gb|EEC73943.1|  hypothetical protein OsI_08813                          107   1e-23   Oryza sativa Indica Group [Indian rice]
gb|ACL53155.1|  unknown                                                 103   1e-23   Zea mays [maize]
emb|CDY24402.1|  BnaCnng04690D                                          106   2e-23   Brassica napus [oilseed rape]
dbj|BAD15937.1|  zinc finger protein-like                               107   2e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AGI62036.1|  CONSTANS-like 12                                        105   3e-23   Erycina pusilla
ref|NP_001057333.2|  Os06g0264200                                       107   3e-23   
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16               106   3e-23   Zea mays [maize]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                    106   3e-23   
gb|ACF84125.1|  unknown                                                 104   3e-23   Zea mays [maize]
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920          107   4e-23   
dbj|BAJ87752.1|  predicted protein                                      106   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   8e-23   
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    105   1e-22   Zea mays [maize]
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480          105   2e-22   Sorghum bicolor [broomcorn]
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             104   2e-22   Selaginella moellendorffii
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             103   3e-22   Selaginella moellendorffii
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   5e-22   Camelina sativa [gold-of-pleasure]
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   1e-21   
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    102   1e-21   Setaria italica
ref|NP_001140584.1|  uncharacterized protein LOC100272654               102   2e-21   Zea mays [maize]
ref|XP_001771896.1|  predicted protein                                  102   2e-21   
ref|XP_001769011.1|  predicted protein                                  102   3e-21   
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.8    1e-20   Tarenaya hassleriana [spider flower]
gb|EMT01944.1|  hypothetical protein F775_21198                       96.7    6e-20   
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.1    8e-20   Tarenaya hassleriana [spider flower]
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    2e-19   
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.6    2e-19   Pyrus x bretschneideri [bai li]
emb|CBI15893.3|  unnamed protein product                              90.5    3e-19   Vitis vinifera
ref|XP_004294775.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   92.4    7e-19   Fragaria vesca subsp. vesca
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    9e-19   Malus domestica [apple tree]
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   91.7    1e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           91.7    1e-18   Citrus clementina [clementine]
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.3    2e-18   Citrus sinensis [apfelsine]
ref|XP_007016977.1|  CCT motif family protein isoform 2               90.9    2e-18   
gb|KDP45740.1|  hypothetical protein JCGZ_17347                       90.1    4e-18   Jatropha curcas
gb|EPS70097.1|  hypothetical protein M569_04667                       86.3    5e-18   Genlisea aurea
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  89.7    6e-18   Phoenix dactylifera
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   89.4    7e-18   Vitis vinifera
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.4    7e-18   
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           89.4    9e-18   Prunus persica
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  89.0    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_001769217.1|  predicted protein                                92.4    1e-17   
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.3    1e-17   Zea mays [maize]
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  89.4    1e-17   Phoenix dactylifera
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   88.2    1e-17   Populus euphratica
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   89.4    1e-17   
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   88.6    1e-17   Prunus mume [ume]
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  89.0    2e-17   Populus euphratica
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                87.8    2e-17   Glycine soja [wild soybean]
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.2    2e-17   Glycine max [soybeans]
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   88.2    3e-17   Triticum urartu
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  87.8    3e-17   Elaeis guineensis
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  87.0    4e-17   
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  87.4    4e-17   
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.8    5e-17   
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   87.0    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        86.7    5e-17   Medicago truncatula
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           88.6    8e-17   Citrus clementina [clementine]
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           87.0    8e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_001765504.1|  predicted protein                                89.0    9e-17   
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   85.1    1e-16   Triticum urartu
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           87.0    1e-16   
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    1e-16   Eucalyptus grandis [rose gum]
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           87.0    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_004138344.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    1e-16   
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  87.8    1e-16   
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  87.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.0    2e-16   
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  85.9    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           87.4    2e-16   
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    2e-16   Cicer arietinum [garbanzo]
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           84.7    2e-16   Phaseolus vulgaris [French bean]
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           85.9    3e-16   
emb|CDP09243.1|  unnamed protein product                              83.2    3e-16   Coffea canephora [robusta coffee]
gb|AGI62031.1|  CONSTANS-like 7                                       85.5    3e-16   Erycina pusilla
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  85.5    3e-16   Arabis alpina [alpine rockcress]
emb|CDX70561.1|  BnaC03g06450D                                        83.2    3e-16   
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  85.5    4e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  85.1    4e-16   Vitis vinifera
ref|XP_002298500.1|  CONSTANS-like family protein                     84.0    4e-16   
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.7    4e-16   Solanum lycopersicum
emb|CBI17712.3|  unnamed protein product                              85.1    4e-16   Vitis vinifera
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  84.7    4e-16   Elaeis guineensis
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    4e-16   Solanum tuberosum [potatoes]
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    4e-16   Elaeis guineensis
ref|NP_568852.2|  chloroplast import apparatus 2 protein              86.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    5e-16   Nelumbo nucifera [Indian lotus]
emb|CDX85600.1|  BnaA02g02130D                                        85.1    5e-16   
ref|XP_001752335.1|  predicted protein                                80.1    5e-16   
gb|KJB56256.1|  hypothetical protein B456_009G113000                  83.6    5e-16   Gossypium raimondii
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    6e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  84.7    6e-16   Prunus mume [ume]
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    6e-16   Vitis vinifera
emb|CAN72725.1|  hypothetical protein VITISV_015092                   85.5    6e-16   Vitis vinifera
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    7e-16   
emb|CAN75558.1|  hypothetical protein VITISV_028190                   84.3    7e-16   
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.9    7e-16   
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    8e-16   
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    8e-16   
emb|CBI40095.3|  unnamed protein product                              85.1    8e-16   
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  84.3    8e-16   
gb|KDP41094.1|  hypothetical protein JCGZ_03224                       85.5    8e-16   
emb|CDY52734.1|  BnaC09g53340D                                        85.1    9e-16   
ref|XP_001759088.1|  predicted protein                                86.3    9e-16   
emb|CDY09849.1|  BnaC09g43120D                                        84.3    1e-15   
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  85.1    1e-15   
emb|CDX78575.1|  BnaA03g04870D                                        83.6    1e-15   
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   84.3    1e-15   
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  84.7    1e-15   
emb|CDX91067.1|  BnaC02g05300D                                        83.6    1e-15   
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           85.1    2e-15   
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    2e-15   
gb|KDP46366.1|  hypothetical protein JCGZ_10206                       83.6    2e-15   
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           83.6    2e-15   
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  83.2    2e-15   
emb|CDX69586.1|  BnaA10g19350D                                        83.2    2e-15   
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                78.2    2e-15   
gb|KGN61175.1|  hypothetical protein Csa_2G061540                     84.3    2e-15   
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    3e-15   
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.3    3e-15   
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           82.8    3e-15   
ref|NP_563778.1|  CCT motif family protein                            81.3    3e-15   
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  83.2    3e-15   
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   81.3    3e-15   
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  82.8    3e-15   
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.0    4e-15   
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           84.0    4e-15   
ref|XP_007016976.1|  CCT motif family protein isoform 1               81.6    4e-15   
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           82.0    4e-15   
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    5e-15   
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           83.6    5e-15   
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           83.6    5e-15   
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    5e-15   
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           82.4    5e-15   
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.6    5e-15   
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  82.0    5e-15   
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    6e-15   
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   82.4    6e-15   
emb|CDP15779.1|  unnamed protein product                              83.2    6e-15   
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    6e-15   
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           80.9    7e-15   
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 81.6    7e-15   
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  80.1    7e-15   
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    7e-15   
emb|CDY38274.1|  BnaA10g11220D                                        82.4    7e-15   
ref|XP_001769056.1|  predicted protein                                77.0    8e-15   
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  82.0    8e-15   
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    8e-15   
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  81.6    8e-15   
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    8e-15   
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  82.4    9e-15   
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   81.6    1e-14   
gb|AAM63153.1|  unknown                                               80.9    1e-14   
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    1e-14   
gb|EMT29986.1|  hypothetical protein F775_13638                       80.5    1e-14   
ref|XP_007031686.1|  CCT motif family protein, putative               81.3    1e-14   
ref|NP_568300.1|  CCT motif family protein                            81.3    1e-14   
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    1e-14   
ref|XP_001754240.1|  predicted protein                                76.3    1e-14   
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           82.4    2e-14   
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  80.5    2e-14   
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                 79.7    2e-14   
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              81.6    2e-14   
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           81.6    2e-14   
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.3    2e-14   
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                79.3    2e-14   
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           75.9    2e-14   
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.3    2e-14   
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  80.1    3e-14   
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           78.6    3e-14   
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            75.5    3e-14   
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.9    3e-14   
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.3    3e-14   
dbj|BAJ85986.1|  predicted protein                                    79.3    3e-14   
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           80.9    3e-14   
gb|KJB33887.1|  hypothetical protein B456_006G036400                  80.1    3e-14   
dbj|BAK01784.1|  predicted protein                                    79.7    3e-14   
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           79.7    4e-14   
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  80.9    4e-14   
ref|XP_002892377.1|  predicted protein                                77.8    5e-14   
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           79.0    5e-14   
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.5    5e-14   
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.5    5e-14   
gb|KJB33888.1|  hypothetical protein B456_006G036400                  79.3    5e-14   
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           78.2    6e-14   
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  80.1    7e-14   
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  77.4    7e-14   
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    8e-14   
emb|CDY66177.1|  BnaC08g46470D                                        77.0    9e-14   
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    9e-14   
emb|CDY42238.1|  BnaC02g11770D                                        79.3    1e-13   
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    1e-13   
emb|CDY47926.1|  BnaA02g08300D                                        79.0    1e-13   
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    1e-13   
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    1e-13   
ref|XP_001751672.1|  predicted protein                                79.7    1e-13   
emb|CDY10244.1|  BnaC05g04870D                                        76.3    2e-13   
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        79.3    2e-13   
ref|NP_567737.1|  CIA2-like transcription factor                      78.6    2e-13   
gb|ABF00989.1|  putative stress resistance-related protein            79.3    2e-13   
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.0    2e-13   
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    2e-13   
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             77.4    2e-13   
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    2e-13   
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           78.2    3e-13   
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           77.8    3e-13   
ref|XP_011467357.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.2    3e-13   
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  77.8    3e-13   
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.9    3e-13   
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           77.8    3e-13   
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  76.6    3e-13   
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                77.8    4e-13   
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  77.8    4e-13   
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                77.8    4e-13   
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  77.4    4e-13   
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           76.6    5e-13   
dbj|BAJ92256.1|  predicted protein                                    77.4    5e-13   
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  76.6    7e-13   
ref|NP_001147813.1|  LOC100281423                                     77.0    8e-13   
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               77.0    8e-13   
ref|XP_004142772.1|  PREDICTED: uncharacterized protein LOC101217596  75.9    8e-13   
emb|CDY06672.1|  BnaA10g04510D                                        74.3    8e-13   
ref|XP_004156700.1|  PREDICTED: uncharacterized LOC101217596          75.9    8e-13   
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              76.3    9e-13   
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   76.3    9e-13   
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.3    9e-13   
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           76.3    1e-12   
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.9    1e-12   
ref|XP_006850881.1|  hypothetical protein AMTR_s00025p00156240        76.6    1e-12   
ref|XP_001758440.1|  predicted protein                                76.6    1e-12   
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   75.5    1e-12   
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.3    1e-12   
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.9    2e-12   
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  75.1    2e-12   
ref|NP_851201.1|  chloroplast import apparatus 2 protein              75.5    2e-12   
emb|CDP16632.1|  unnamed protein product                              75.5    2e-12   
ref|NP_001169082.1|  uncharacterized protein LOC100382924             75.5    2e-12   
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.5    2e-12   
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  75.5    3e-12   
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g           72.8    3e-12   
emb|CDX94392.1|  BnaC01g17920D                                        74.7    3e-12   
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                74.3    3e-12   
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           74.7    4e-12   
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  74.7    4e-12   
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.7    5e-12   
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.2    5e-12   
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                72.8    6e-12   
gb|AAF69700.1|AC016041_5  F27J15.10                                   73.2    6e-12   
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              73.2    7e-12   
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 73.2    7e-12   
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  73.6    7e-12   
emb|CDX89377.1|  BnaA01g15160D                                        73.6    9e-12   
ref|XP_004149511.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    1e-11   
ref|XP_008451210.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    1e-11   
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  73.6    1e-11   
ref|XP_001776067.1|  predicted protein                                67.8    1e-11   
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              72.8    1e-11   
gb|KJB56255.1|  hypothetical protein B456_009G113000                  70.9    1e-11   
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   72.4    2e-11   
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   72.4    2e-11   
gb|KJB53720.1|  hypothetical protein B456_009G002400                  72.4    2e-11   
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  71.2    3e-11   
gb|EMT06010.1|  hypothetical protein F775_08552                       72.0    3e-11   
ref|XP_002518229.1|  CIL, putative                                    72.0    3e-11   
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           71.6    4e-11   
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          72.0    4e-11   
ref|XP_011462373.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.0    4e-11   
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg           69.3    4e-11   
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    4e-11   
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    6e-11   
ref|XP_011020039.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  70.9    9e-11   
emb|CAB87776.1|  putative protein                                     70.1    9e-11   
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           70.1    1e-10   
gb|EPS64862.1|  hypothetical protein M569_09916                       65.5    1e-10   
ref|XP_004145240.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  67.0    2e-10   
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  69.7    2e-10   
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 68.2    5e-10   
ref|NP_849445.1|  CIA2-like transcription factor                      68.2    6e-10   
emb|CAB39664.1|  putative protein                                     67.8    7e-10   
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  67.0    1e-09   
ref|XP_011467358.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  67.4    1e-09   
emb|CDY36106.1|  BnaA08g19420D                                        67.4    1e-09   
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  66.6    2e-09   
gb|ABG57263.1|  CONSTANS-like 1                                       66.2    2e-09   
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                64.3    2e-09   
gb|AFK31575.1|  Hd1                                                   66.6    2e-09   
ref|XP_009126854.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  66.2    3e-09   
gb|AFV78277.1|  constans-like 1                                       66.2    3e-09   
emb|CDY42769.1|  BnaA03g47700D                                        64.7    3e-09   
ref|NP_001046074.2|  Os02g0178100                                     63.9    3e-09   
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           65.9    3e-09   
gb|AAX20015.1|  CONSTANS-like b                                       65.5    3e-09   
gb|AAX47173.1|  CONSTANS-LIKE b                                       65.5    3e-09   
gb|ACF79190.1|  unknown                                               62.4    4e-09   
gb|AFW86339.1|  constans1                                             62.0    4e-09   
dbj|BAD36814.1|  zinc finger protein-like                             62.4    4e-09   
gb|ACF81408.1|  unknown                                               62.8    4e-09   
emb|CAK26123.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26129.1|  constans-like 1                                      65.9    4e-09   
gb|AFV79556.1|  constans-like 1                                       65.9    4e-09   
gb|EEC84137.1|  hypothetical protein OsI_30489                        62.4    4e-09   
emb|CAK26149.1|  constans-like 1                                      65.9    4e-09   
ref|XP_008348263.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  62.0    4e-09   
emb|CAK26107.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26108.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26110.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26141.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26151.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26106.1|  constans-like 1                                      65.9    4e-09   
gb|AAD22518.1|AF001136_1  zinc finger protein                         65.9    4e-09   
emb|CAK26112.1|  constans-like 1                                      65.9    4e-09   
emb|CAK26147.1|  constans-like 1                                      65.5    4e-09   
emb|CAK26109.1|  constans-like 1                                      65.5    4e-09   
emb|CAK26119.1|  constans-like 1                                      65.5    4e-09   
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  65.5    4e-09   



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 92/126 (73%), Gaps = 6/126 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMMM  515
            KK ++LLSLNYE VI+A ASQG PWT G RP FDP+ CWPD MG G    HH Y   + M
Sbjct  314  KKRKILLSLNYESVITAWASQGSPWTSGGRPDFDPDECWPDCMGTGGTEVHHTYSDLIGM  373

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  374  GAHQALGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFLAGP  433

Query  346  P-PFPN  332
              PF N
Sbjct  434  AFPFVN  439



>gb|KJB16228.1| hypothetical protein B456_002G218400 [Gossypium raimondii]
Length=421

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 97/141 (69%), Gaps = 11/141 (8%)
 Frame = -3

Query  715  GSCKEEVAKKSR--MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHH  545
            G C+E  AKK +   LLSL+YE VI+A A+QG PWT G +P  DP+ CWPD MG G    
Sbjct  284  GECQENTAKKKKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMGNGGTEV  343

Query  544  HHPYGSAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
               Y   M M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  344  QQSYSGLMGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  403

Query  379  FVKRSSLFQPPPPFPNYLLNR  317
            FVKR+S F   P FP  LLN+
Sbjct  404  FVKRAS-FLTGPAFP--LLNK  421



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 90/124 (73%), Gaps = 9/124 (7%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-----GDHHHHHPYGSAMMM  515
            +LLSL+YE VI+  ASQG PWT G RP+FDP+ CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYEAVINTWASQGSPWTTGDRPNFDPDECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  346  PPFP  335
            P FP
Sbjct  452  PAFP  455



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 91/126 (72%), Gaps = 9/126 (7%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-----GDHHHHHPYGSAMMM  515
            +LLSL+YE VI + ASQG PWT+G RP+FDP  CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYESVIKSWASQGSPWTNGDRPNFDPEECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  346  PPFPNY  329
            P FP +
Sbjct  452  PAFPLF  457



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 96/131 (73%), Gaps = 9/131 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMMM  515
            KK+++LL L+YE +I+A ASQG PWT+G RP  DP+ CWPD +G      HHPYG    M
Sbjct  305  KKNKILLRLDYEAIITAWASQGSPWTNGHRPELDPDDCWPDCLGTCGIQVHHPYGEFGGM  364

Query  514  RR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
                    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  
Sbjct  365  GEQQAAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FGG  423

Query  349  PPPFPNYLLNR  317
            P  FP  LLN+
Sbjct  424  PAAFP--LLNK  432



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 95/129 (74%), Gaps = 14/129 (11%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHH  539
            G  +++   K ++LLSL+YE V++A ASQG PWT+G RP FDP+ CWPD MG      HH
Sbjct  313  GEYEDDDGAKRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHH  372

Query  538  PYGS---------AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
            PYG          AMM    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  373  PYGDMISGLGAHPAMM----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  428

Query  385  GRFVKRSSL  359
            GRFVKR++L
Sbjct  429  GRFVKRTTL  437



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHH  539
            G  +++   K ++LLSL+YE V++A ASQG PWT+G RP FDP+ CWPD MG      HH
Sbjct  317  GEYEDDDGAKRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHH  376

Query  538  PYGSAMMMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
            PYG  +    +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  377  PYGDMISGLGAHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  436

Query  373  KRSSL  359
            KR++L
Sbjct  437  KRTTL  441



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 96/141 (68%), Gaps = 11/141 (8%)
 Frame = -3

Query  715  GSCKEEVAKKSR--MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM-GGDHHH  545
            G C+E  AKK +   LLSL+YE VI+A A+QG PWT G +P  DP+ CWPD M  G    
Sbjct  280  GECQESTAKKKKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEV  339

Query  544  HHPYGSAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
               Y   + M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  340  QQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  399

Query  379  FVKRSSLFQPPPPFPNYLLNR  317
            FVKR+S F   P FP  LLN+
Sbjct  400  FVKRAS-FLAGPAFP--LLNK  417



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 96/141 (68%), Gaps = 11/141 (8%)
 Frame = -3

Query  715  GSCKEEVAKKSR--MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM-GGDHHH  545
            G C+E  AKK +   LLSL+YE VI+A A+QG PWT G +P  DP+ CWPD M  G    
Sbjct  286  GECQENTAKKKKRKTLLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEV  345

Query  544  HHPYGSAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
               Y   + M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  346  QQSYSGLIGMGGQQQAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  405

Query  379  FVKRSSLFQPPPPFPNYLLNR  317
            FVKR+S F   P FP  LLN+
Sbjct  406  FVKRAS-FLAGPAFP--LLNK  423



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 96/130 (74%), Gaps = 13/130 (10%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM------GGDHHHHHPYGS  527
            K RMLL LNYEEVISA  +Q  PWT+G RPHF+P+ CWPDF+      GG    H PYG 
Sbjct  294  KRRMLLRLNYEEVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETCIGEGG----HQPYGG  349

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
              +      GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR++ F   
Sbjct  350  GNVRGGD-GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRTTSFS-A  407

Query  346  PPFPNYLLNR  317
            P FP YL+N+
Sbjct  408  PGFP-YLMNK  416



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 88/116 (76%), Gaps = 2/116 (2%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHH-HHPYGSAMMMRRS-  506
            M L LNYEEVI+A ASQG PW DGT+P F+   CWPDFMG   +  HHP G+      S 
Sbjct  312  MHLKLNYEEVITAWASQGSPWADGTKPEFNLGDCWPDFMGMSLNELHHPNGAGGGRVSSH  371

Query  505  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  338
            DE REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  P+
Sbjct  372  DEEREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFAGPSFPY  427



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 95/127 (75%), Gaps = 6/127 (5%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG---GDHHHHHPYGSAMM  518
            K R+LL LNYE VISA  +Q  PWT+G RPHF+P+ CWPDF+    G+   H PYG   +
Sbjct  296  KRRLLLRLNYEAVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETCIGEGGVHQPYGGGKV  355

Query  517  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  338
                  GRE RVSRYREKRRTRLFSKKIRY+VRKLNAEKRPRLKGRFVKR++ F  PP F
Sbjct  356  RGGD-GGREERVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRLKGRFVKRTTSFS-PPGF  413

Query  337  PNYLLNR  317
            P YL+N+
Sbjct  414  P-YLMNK  419



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 11/132 (8%)
 Frame = -3

Query  718  SGSCK-EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG----D  554
            +G CK EE  +K+   L L+YE +ISA A++G PWT G RP F+P+ CWPD MG     +
Sbjct  305  NGGCKAEETTRKTS--LKLDYEAIISAWANKGLPWTTGDRPLFNPDDCWPDCMGTCPMTE  362

Query  553  HHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
             HH+HPYG        +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  363  VHHYHPYGEMGGVGGHVTAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  422

Query  385  GRFVKRSSLFQP  350
            GRFVKR+S   P
Sbjct  423  GRFVKRASCTGP  434



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 96/136 (71%), Gaps = 8/136 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX-CWPDFMGG---DH  551
            SG   ++++ K  + L LNYE VI A AS+G PWT G RP F+P+  CWPD MG    + 
Sbjct  315  SGYKGDKMSSKISLRLRLNYEGVICAWASKGSPWTTGERPQFNPDDDCWPDCMGTYPMEV  374

Query  550  HHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
            +HHHPYG        +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  375  YHHHPYGEMGGVGGHVTMGNGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  434

Query  382  RFVKRSSLFQPPPPFP  335
            RFVKR+SL     PFP
Sbjct  435  RFVKRTSLMGVAAPFP  450



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 89/129 (69%), Gaps = 10/129 (8%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG---DHHHHHPYGSAMMMRR  509
            +LL L+YE VI+A ASQG PWT G RP FDP+ CWPD MG       HHH Y     +  
Sbjct  338  ILLRLDYEAVITAWASQGSPWTTGDRPDFDPDACWPDCMGTYYPTQLHHHQYMDLSGVEL  397

Query  508  -----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  344
                 +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV R+S     P
Sbjct  398  NPAILADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVNRASF--AGP  455

Query  343  PFPNYLLNR  317
             FP  L+ +
Sbjct  456  TFPAMLITK  464



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 87/117 (74%), Gaps = 6/117 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYG-----  530
            KK R LLSL+Y+ V++A ASQG PWT+G RP FD + CWPD MG      H PYG     
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDCMGICGAQLHQPYGDVSGL  385

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  AAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  442



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 92/135 (68%), Gaps = 11/135 (8%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGG-DHHHHHPY  533
            K +  KK ++LLSL+YE VI+A A+QG  PWTDGTR   DP+ CW D MG      HHPY
Sbjct  330  KNDNKKKRKILLSLDYEAVITAWATQGTSPWTDGTRRDVDPDECWQDCMGTCGAEFHHPY  389

Query  532  GSAMMMRR---------SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
            G    +           +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  390  GDTNGLGGVGGGGNPAMAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  449

Query  379  FVKRSSLFQPPPPFP  335
            FVKR++    P  FP
Sbjct  450  FVKRATFAGGPSAFP  464



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDF--MG-GDHHHHHPYGSAM  521
            KK R LLSL+YE V++A ASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMTAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  520  MM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
             +        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 85/116 (73%), Gaps = 9/116 (8%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG----DHHHHHPYGSAMMM-  515
            +LL LNYE VI+  ASQG PWT G RP FDP+ CWP+ MG      HHHHH    + ++ 
Sbjct  339  ILLRLNYEAVITEWASQGSPWTTGDRPDFDPDTCWPNCMGTFDTQLHHHHHYMDLSGLVG  398

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                  +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  399  GNPAALADGGREARVSRYREKRRNRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  454



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 92/128 (72%), Gaps = 16/128 (13%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYG-----S  527
            +K ++LL+L+YE V++A A Q  PWT+G RP  D N CWPD MG +    HPYG     +
Sbjct  328  EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYGIMNGHT  386

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
             M+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L    
Sbjct  387  TMI----DRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL----  438

Query  346  PPFPNYLL  323
               PNY L
Sbjct  439  --VPNYPL  444



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = -3

Query  718  SGSCKEE---VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHH  548
            S  CK E   +    ++LLSL+YE VISA A Q  PWT G RP  D N CWPD +G    
Sbjct  309  SEDCKVEDAGINTNKKILLSLDYEGVISAWADQRSPWTTGERPELDSNDCWPDCLGTCGT  368

Query  547  HHHPYGSAMMM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
             H+ YG   M       D GREARVSRYREKRRTRLF KKIRYEVRKLNAEKRPR+KGRF
Sbjct  369  IHNLYGEVGMFGHPAMMDGGREARVSRYREKRRTRLFCKKIRYEVRKLNAEKRPRMKGRF  428

Query  376  VKRSSLFQPPPPFP  335
            VKR++       FP
Sbjct  429  VKRATFSAAAAAFP  442



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 86/119 (72%), Gaps = 8/119 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDF--MG-GDHHHHHPYGSAM  521
            KK R LLSL+YE V+SA ASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMSAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  520  MMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
             +        D  REARVSRYREKRRTRLFSKK+RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGADPAALVDGAREARVSRYREKRRTRLFSKKLRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 92/126 (73%), Gaps = 12/126 (10%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            +K ++LL+L+YE V++A A Q  PWT+G RP  D N CWPD MG +    HPYG  +M  
Sbjct  329  EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYG--IMNG  385

Query  511  RS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  341
             +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L      
Sbjct  386  HTTIIDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL------  439

Query  340  FPNYLL  323
             PNY L
Sbjct  440  VPNYPL  445



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 93/129 (72%), Gaps = 13/129 (10%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG----GDHHHHHPYGSA  524
            +K+R+ LSLN+E VISA  +Q  PWT+G RPHF+P+  WPDF      G++  H      
Sbjct  288  EKNRLFLSLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFFSETSVGNYGGH------  341

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  344
              +R  D GREARVSRYREKR+ RLFSKKIRYEVRKLNAEKRPRLKGRF+KRSS     P
Sbjct  342  --VRCGDGGREARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGRFIKRSSSLFSVP  399

Query  343  PFPNYLLNR  317
             F +Y++N+
Sbjct  400  GF-SYMMNK  407



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 90/131 (69%), Gaps = 9/131 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGS---  527
             K+ ++ L L+YE +I A ASQ  PWT   +P+ DP+ CW   MG  +  +HHP G    
Sbjct  116  VKRKKVSLQLDYEAIIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGG  175

Query  526  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
              +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    
Sbjct  176  FGIHPVIIDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--A  233

Query  349  PPPFPNYLLNR  317
            PP FP  LLN+
Sbjct  234  PPTFP--LLNK  242



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 85/118 (72%), Gaps = 5/118 (4%)
 Frame = -3

Query  700  EVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFM----GGDHHHHHP  536
            E A K R +L L+YE VI+A +S GC PWTDG RP FDP+  W DF+    GG       
Sbjct  282  EAATKRRPILRLDYEAVIAAWSSNGCSPWTDGERPQFDPSDAWADFLVAEAGGGGEVQGM  341

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            Y  A  M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK+++
Sbjct  342  YQQAGHMAAVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKQAA  399



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPD--FMG-GDHHHHHPYG---  530
            KK R LLSL+Y+ V++A ASQG PWT+G RP FD + CWPD   MG      H PYG   
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDPDCMGICGAQLHQPYGDVS  385

Query  529  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
              +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLAAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   142 bits (358),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHHPYGSAM  521
             K +  LL LNYE+VI+A ASQG PWT G+RP  + + CWPD M       HHHPYG   
Sbjct  306  TKSTASLLRLNYEDVINAWASQGSPWTSGSRPELNSDDCWPDCMDICLKDGHHHPYGGMG  365

Query  520  MMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  344
               R   G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S      
Sbjct  366  GHTRGGNGAREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGNGF  425

Query  343  PFPN  332
            P+ N
Sbjct  426  PYMN  429



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 93/134 (69%), Gaps = 9/134 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGS  527
            ++  KK+++ L L+YE VI A ASQ  PWT   +P+ DP+ CW   MG  +  +HHP G 
Sbjct  290  DDEVKKNKISLQLDYEAVIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGE  349

Query  526  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  350  MGGFGIHPVIIDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  409

Query  358  FQPPPPFPNYLLNR  317
               PP FP  LLN+
Sbjct  410  --APPTFP--LLNK  419



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 89/127 (70%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG---GDHH  548
            S  CK ++ +   + L LNY+ VI+A ASQGCPWT G+RP  + N CWP   G    D H
Sbjct  269  STECKPKLMRN--VCLKLNYDAVITAWASQGCPWTAGSRPEINLNHCWPHCTGLCCKDVH  326

Query  547  HHHPYGSAMM---MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
            HH   G A++      +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  327  HHTCGGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  386

Query  376  VKRSSLF  356
            VKR+S  
Sbjct  387  VKRTSFM  393



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score =   140 bits (353),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRP-HFDPNXCWPDFMGGDHHHHHP-YGSA  524
            V  K  + L LNYEEVI+A ASQG PWT+GT P  F+ + CW DF+G +  +    YG+ 
Sbjct  227  VGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFLGSNGGNVQCCYGAV  286

Query  523  MMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
              +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  287  GSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  340



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMMMRRS-  506
            + L L+YE VISA A QG PWT G RP F P+ CWPDFMG       + YG A +     
Sbjct  339  IFLRLDYEAVISAWAGQGSPWTTGERPDFSPDNCWPDFMGMSGLEFQNLYGEAGVHGGHV  398

Query  505  ---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-SSLFQPPPPF  338
               D GREA+VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR SS     P F
Sbjct  399  GMGDAGREAKVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASSASSSAPAF  458

Query  337  PNYLLNR  317
            P  LLN+
Sbjct  459  P--LLNK  463



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMM  518
            V  + ++ LSLNYE+VI+A ASQG PWT G RP FDPN  WPD+MG    + H     + 
Sbjct  281  VEMRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVG  340

Query  517  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  353
                + G     REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F 
Sbjct  341  GVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FA  399

Query  352  PPPPFPNYLLN  320
              P FP  +LN
Sbjct  400  AGPCFP--ILN  408



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 91/131 (69%), Gaps = 8/131 (6%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMM  518
            V  + ++ LSLNYE+VI+A ASQG PWT G RP FDPN  WPD+MG    + H     + 
Sbjct  346  VEMRRKISLSLNYEDVITAWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVG  405

Query  517  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  353
                + G     REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F 
Sbjct  406  GVGGNFGGRDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FA  464

Query  352  PPPPFPNYLLN  320
              P FP  +LN
Sbjct  465  AGPCFP--ILN  473



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 10/129 (8%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDF---MGGDHHHHHPYGSAM  521
            +K+R+ L LN+E VISA  +Q  PWT+G RPHF+P+  WPDF    GG+  ++  +    
Sbjct  279  EKNRLFLRLNHEAVISAWPNQSSPWTNGIRPHFNPDDYWPDFSETCGGNLGYYGGH----  334

Query  520  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-SSLFQPPP  344
             +R  D GREARV RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF+KR SS     P
Sbjct  335  -VRSGDGGREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFIKRNSSSSFSVP  393

Query  343  PFPNYLLNR  317
             FP Y++N+
Sbjct  394  GFP-YMMNK  401



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRP-HFDPNXCWPDFMGGDHHHHHP-YGSA  524
            V  K  + L LNYEEVI+A ASQG PWT+GT P  F+ + CW DF+G +  +    YG+ 
Sbjct  304  VGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLDFLGSNGGNVQCCYGAV  363

Query  523  MMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
              +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  364  GSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  417



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 92/131 (70%), Gaps = 10/131 (8%)
 Frame = -3

Query  718  SGSCKEEVA--KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDF-MGGDHH  548
            SG  +E+    KK +MLL LNYE V++A ASQG PWT G RP F+ +  WP+  MG   H
Sbjct  331  SGDAEEQATMKKKRKMLLRLNYEGVMAAWASQGSPWTTGDRPDFELDEGWPNSNMGTASH  390

Query  547  ---HHHPYGSAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
               +H P+  AM +R      D GREARVSRYREKRRTR+FSKKIRY+VRKLNAEKRPR+
Sbjct  391  SLKYHLPFAEAMGLRAHVGAEDGGREARVSRYREKRRTRMFSKKIRYQVRKLNAEKRPRM  450

Query  388  KGRFVKRSSLF  356
            KGRFVKR S  
Sbjct  451  KGRFVKRMSFI  461



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 88/127 (69%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHH  545
            S  CK ++ +   + L LNY+ VI+A ASQGCPWT G+RP  + N CWP   G      H
Sbjct  269  STECKPKLMRN--VSLKLNYDAVITAWASQGCPWTAGSRPEINLNHCWPYCTGLCCKGVH  326

Query  544  HHPYGSAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
            HH  G   ++R     +  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  327  HHTCGGGAVLRGCHLGAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  386

Query  376  VKRSSLF  356
            VKR+S  
Sbjct  387  VKRTSFM  393



>ref|XP_004135402.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=403

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHHPYG--  530
            V  K ++ LSL+ E VI A  S+G PWT G RP+ D +  WPD+MG      ++ PYG  
Sbjct  272  VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEF  331

Query  529  SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
             + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  332  GSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSS  391

Query  361  LFQPPP  344
             F PPP
Sbjct  392  CFAPPP  397



>gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 90/126 (71%), Gaps = 8/126 (6%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHHPYG--  530
            V  K ++ LSL+ E VI A  S+G PWT G RP+ D +  WPD+MG      ++ PYG  
Sbjct  272  VKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPYGEF  331

Query  529  SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
             + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  332  GSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRSS  391

Query  361  LFQPPP  344
             F PPP
Sbjct  392  CFAPPP  397



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 90/134 (67%), Gaps = 9/134 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGS  527
            ++  K+ ++ L L+YE +I A ASQ  PWT   + + DP+ CW   MG      HHPYG 
Sbjct  289  DDEVKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGE  348

Query  526  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  349  LGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  408

Query  358  FQPPPPFPNYLLNR  317
               PP FP  LLN+
Sbjct  409  --APPTFP--LLNK  418



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 90/134 (67%), Gaps = 9/134 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGS  527
            ++  K+ ++ L L+YE +I A ASQ  PWT   + + DP+ CW   MG      HHPYG 
Sbjct  288  DDEVKRKKVSLQLDYEAIIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGE  347

Query  526  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  348  LGGFGIHSVIVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  407

Query  358  FQPPPPFPNYLLNR  317
               PP FP  LLN+
Sbjct  408  --APPTFP--LLNK  417



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 92/129 (71%), Gaps = 8/129 (6%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHHPY  533
            +++  K+ ++ LSL+ E VI A  S+G PWT G RP+ D +  WPD+MG      ++ PY
Sbjct  268  EKDCXKQKKISLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQPY  327

Query  532  G--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
            G   + + R +  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  328  GEFGSGIGRHAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVK  387

Query  370  RSSLFQPPP  344
            RSS F PPP
Sbjct  388  RSSCFAPPP  396



>gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 81/118 (69%), Gaps = 4/118 (3%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHHPYGSAMMM  515
            K  + L LNYE VI+A AS G PWT GTRP  +P+ CWPD +G      HHHPY      
Sbjct  316  KRDVSLRLNYEAVITAWASHGSPWTTGTRPELNPDDCWPDCLGTCPKDGHHHPYRGHNGG  375

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  341
                 GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRL+GRFVKR+S      P
Sbjct  376  GNG--GREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRLQGRFVKRTSFMGATFP  431



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 90/130 (69%), Gaps = 9/130 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            +K +++LL+L+Y  V++A A Q  PWT G RP  D N CWP  MG +    H YG   +M
Sbjct  281  SKNNKILLNLDYGGVLNAWADQRSPWTTGERPQVDSNDCWPVCMG-NCGQIHAYGDMEIM  339

Query  514  R----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                   DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAE RPR+KGRFVKR++    P
Sbjct  340  TGHGPMIDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEMRPRMKGRFVKRTNF--AP  397

Query  346  PPFPNYLLNR  317
             PFP+  LNR
Sbjct  398  TPFPS--LNR  405



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 89/138 (64%), Gaps = 15/138 (11%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHH  542
             G   E VA   RM L L+YE VI+A + +GC PWTDG RP F+P+ CWPDF G      
Sbjct  287  GGCVTEAVAAGRRMTLRLDYEAVIAAWSCKGCSPWTDGERPQFNPDDCWPDFAGMMWGGA  346

Query  541  H---------PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
                      P    + M   + GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  347  GGGGGGGEVAPVYGEVGMVAGNGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  406

Query  388  KGRFVKRSSLFQPPPPFP  335
            KGRFVKR++      PFP
Sbjct  407  KGRFVKRAAA-----PFP  419



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 90/130 (69%), Gaps = 9/130 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
             K +++LL+L+Y  V++A A Q  PWT G RP  D N CWP  MG +   +H YG    M
Sbjct  270  TKNNKILLNLDYGGVLNAWADQRSPWTTGERPEVDFNDCWPVCMG-NCGKNHLYGDMGTM  328

Query  514  R----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                   DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P
Sbjct  329  TGHGPTVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--AP  386

Query  346  PPFPNYLLNR  317
             PFP+  LNR
Sbjct  387  TPFPS--LNR  394



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 86/127 (68%), Gaps = 8/127 (6%)
 Frame = -3

Query  715  GSC-KEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHH  542
            G C  E VA   RM L L+YE VI+A + + C PWTDG RP F+P+ CWPDF G      
Sbjct  286  GGCGTEAVAAGRRMTLRLDYEAVIAAWSCKDCSPWTDGERPQFNPDDCWPDFTGMMWGGA  345

Query  541  H------PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
                   P    + M   D GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  346  GGGREVAPVYGELGMVAGDGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  405

Query  379  FVKRSSL  359
            FVKR++ 
Sbjct  406  FVKRAAF  412



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP-YGSAMMMR  512
            K  M L LNYE+VI+A ASQGCPWT GT P+F+ +   P F+G +       YG    +R
Sbjct  287  KKEMFLRLNYEDVIAAWASQGCPWTTGTPPNFNSDDFLPGFLGSNGEDVLCCYGEMRSLR  346

Query  511  -RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  356
              +D GREARV RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  347  GHADGGREARVLRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTSFL  399



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 9/124 (7%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHH-----PYG  530
            K ++ L L+Y+ VI A  SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  43   KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  102

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
               +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  103  CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  160

Query  349  PPPF  338
              P 
Sbjct  161  TFPL  164



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   137 bits (344),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 83/119 (70%), Gaps = 4/119 (3%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG----GDHHHHH  539
            K+ V K+  + L L+YE VI+A ASQG PWT GTRP  +P+  W D MG      H  H 
Sbjct  298  KQIVMKRKNICLKLDYEAVITAWASQGSPWTTGTRPELNPDEGWLDCMGMWPTEIHQAHG  357

Query  538  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                 +  R  D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  358  DSAGCVSGRGDDPRREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  416



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 11/124 (9%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR  509
            K ++LL+L+YE V+ A A Q CPWT+G RP  D N  WPD MG        Y   M    
Sbjct  308  KKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENV  360

Query  508  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  335
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  361  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--P  418

Query  334  NYLL  323
            NY L
Sbjct  419  NYPL  422



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 81/127 (64%), Gaps = 6/127 (5%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMM  518
            V    R+ L L+YE V+SA   Q  PWT G RP  D   CWPD MG      H YG   M
Sbjct  313  VHDSKRIFLRLDYEGVLSAWDDQKSPWTTGERPDLDSAGCWPDCMG-TCGTVHVYGEMGM  371

Query  517  M-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  353
            M        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L  
Sbjct  372  MIGHAVAVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANLVA  431

Query  352  PPPPFPN  332
            P     N
Sbjct  432  PAFSLLN  438



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 11/124 (9%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR  509
            K ++LL+L+YE V+ A A Q CPWT+G RP  D N  WPD MG        Y   M    
Sbjct  321  KKKILLNLDYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENV  373

Query  508  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  335
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  374  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--P  431

Query  334  NYLL  323
            NY L
Sbjct  432  NYPL  435



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 88/130 (68%), Gaps = 6/130 (5%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGS  527
            ++E   K RMLL LNYE VI++ A+QG PWTDG RP F+ +      +GG       Y  
Sbjct  253  EKESQVKKRMLLRLNYEAVIASWATQGSPWTDGIRPQFNLDEFMVACLGG-----SCYEL  307

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
              + R    GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+ F   
Sbjct  308  GGLSRAKIGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSTTFS-G  366

Query  346  PPFPNYLLNR  317
               P  L+N+
Sbjct  367  SSLPYQLINK  376



>gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 80/116 (69%), Gaps = 7/116 (6%)
 Frame = -3

Query  664  NYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHHPYGS-----AMMMRRS  506
            +YE VI+A ASQG PW  G +P  +P+ CW D MG  G    HH YG       +    +
Sbjct  320  DYEAVITAWASQGSPWITGNQPDINPDDCWLDCMGIYGAEVLHHSYGDHNGGIGIQPAMT  379

Query  505  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  338
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++   P  P 
Sbjct  380  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFAAPVFPL  435



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 88/132 (67%), Gaps = 6/132 (5%)
 Frame = -3

Query  706  KEEVAK----KSRMLLSLNYEEVISAXASQGCPWTDGTRP-HFDPNXCWPDFMGGDHHHH  542
            ++EV+K    K  + L LNYEEVI+A ASQG PWT GT P  F+ + CW D         
Sbjct  293  EDEVSKVGTNKKDIFLRLNYEEVITAWASQGSPWTTGTPPKFFNSDDCWLDLGSNGGGVQ  352

Query  541  HPYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
              YG    +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK  
Sbjct  353  CYYGEVRSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKSV  412

Query  364  SLFQPPPPFPNY  329
             L +P     NY
Sbjct  413  PLLEPLLCQLNY  424



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 82/114 (72%), Gaps = 4/114 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG----GDHHHHHPYGSA  524
            K+ ++ L L+YE VI+A ASQG PWT+GTRP  +P+  W D MG         H      
Sbjct  309  KRKKICLRLDYETVITAWASQGSPWTNGTRPELNPDDGWLDCMGMWPTEIPQPHGDTAGC  368

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            +  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  369  VSGRGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  422



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 83/125 (66%), Gaps = 5/125 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDH----HHHHPYGSA  524
            KK  +LL LNYE VI+A ASQG PWT G RP   P   WPD M   H      +  +   
Sbjct  311  KKRDILLRLNYEAVIAAWASQGSPWTTGIRPEVKPEHGWPDCMDMCHPDFSQINGDWRGL  370

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PP  347
            +   R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S      
Sbjct  371  VGSGRRDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGINN  430

Query  346  PPFPN  332
              FPN
Sbjct  431  STFPN  435



>ref|XP_006829901.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 82/122 (67%), Gaps = 5/122 (4%)
 Frame = -3

Query  697  VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPD-FMGGDHHHHHPYGSAM  521
            +  +  + L L+YE VISA      PWT G RP F+P+ CWPD F G        Y    
Sbjct  272  IVLEKSISLRLDYEAVISAWGRS--PWTTGQRPEFNPDDCWPDPFTGNCVPEMSTYSEVG  329

Query  520  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  341
                SD GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   PP P
Sbjct  330  NATASDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF--PPTP  387

Query  340  FP  335
            +P
Sbjct  388  YP  389



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 82/113 (73%), Gaps = 2/113 (2%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMMMR  512
            K  + L L+YE VI A A+QGCPWT G+RP  +P+  W D MG      ++PYG      
Sbjct  307  KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNPDDSWTDSMGACPKDVNNPYGGLGSHT  366

Query  511  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  356
            R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL 
Sbjct  367  RGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLM  419



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 14/113 (12%)
 Frame = -3

Query  700  EVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAM  521
            ++  K ++ L L+YE +I+A A+QG PWT GTRP  +P+  W D MGG            
Sbjct  335  QMMMKRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGG------------  382

Query  520  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  383  --RGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  433



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 8/122 (7%)
 Frame = -3

Query  685  SRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR-  509
            ++++L+L+YE V+ + A +  PWT G RP  D N CWP  MG +    H YG   ++ R 
Sbjct  306  NKIMLNLDYESVLKSWADKRSPWTMGERPEVDFNDCWPVCMG-NCGKIHSYGDIGIVNRH  364

Query  508  ----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  341
                 DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P P
Sbjct  365  GGGGVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTP  422

Query  340  FP  335
            FP
Sbjct  423  FP  424



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 90/136 (66%), Gaps = 13/136 (10%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGD----H  551
            +G  K E+  K  MLL LNYE VI+A A QG PWT G+RP F+P+    DFMG +    H
Sbjct  302  NGESKAEM--KRNMLLRLNYESVITAWARQGSPWTAGSRPEFNPD----DFMGSNLKEGH  355

Query  550  HHHHPYGSAMMMR---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
            H     G    ++    +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  356  HLSGGIGGIYSLQGRGNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  415

Query  379  FVKRSSLFQPPPPFPN  332
            FVKR+S       + N
Sbjct  416  FVKRTSFVGTAFTYIN  431



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 87/135 (64%), Gaps = 4/135 (3%)
 Frame = -3

Query  718  SGSCK-EEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHH  545
             G C  E VA    M+L L+YE VI+A +  GC PWTDG RP F+P+ C P F G     
Sbjct  288  GGGCGVETVAAGRGMILKLDYEAVIAAWSCNGCSPWTDGERPQFNPDDCCPIFTGMMWSG  347

Query  544  HHPYGSA--MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                G A  + M     GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  348  GVGEGDAGEVGMMAGGGGREARVARYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  407

Query  370  RSSLFQPPPPFPNYL  326
            R++     P    ++
Sbjct  408  RTAFSAAGPAASPFI  422



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 84/122 (69%), Gaps = 8/122 (7%)
 Frame = -3

Query  685  SRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR--  512
            ++++L+L+YE V+ +   +  PWT G RP  D N CWP  MG +    H YG   +M   
Sbjct  306  NKIMLNLDYESVLKSWGDKRFPWTTGVRPEVDFNDCWPVCMG-NCGKIHSYGDIAIMNGH  364

Query  511  ---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  341
                 DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P P
Sbjct  365  GGGVVDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTP  422

Query  340  FP  335
            FP
Sbjct  423  FP  424



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 7/119 (6%)
 Frame = -3

Query  700  EVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHHPYG-  530
            ++  K ++ L L+YE +I+A A+QG PWT GTRP  +P+  W D MG  G    H  +G 
Sbjct  335  QMMMKRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGMWGSDQIHQSHGH  394

Query  529  ----SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                  +  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  395  GESAGCVGGRGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  453



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFM--GGDH  551
            S S KEE  +K  ML  L+YE VIS    QG PWT    P  D N   C  D M   G  
Sbjct  139  SCSIKEEKNEKVHML-RLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGE  197

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
             HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  198  AHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  257

Query  370  RSSL  359
            RSS+
Sbjct  258  RSSI  261



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYG  530
            K+ V K+  + L L+YE VI+A ASQG  WT GTRP  + +  W D MG      H P+G
Sbjct  298  KQIVMKRKNICLKLDYEAVITAWASQGSQWTTGTRPELNADEGWLDCMGMWPTEIHQPHG  357

Query  529  -SAMMMRR---SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
             SA  + R    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  358  DSAGCVSRGKGDDPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  417



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 9/124 (7%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHH-----PYG  530
            K ++ L L+Y+ VI A  SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  313  KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  372

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
               +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  373  CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  430

Query  349  PPPF  338
              P 
Sbjct  431  TFPL  434



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            KK  MLL L+YE VI+A A+QG PWT GTRP F+P+    DFMG + +       +   R
Sbjct  298  KKRSMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPNEGIGGICSQGKR  353

Query  511  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  354  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  405



>gb|KJB34352.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=414

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            KK  MLL L+YE VI+A A+QG PWT GTRP F+P+    DFMG +         +   R
Sbjct  296  KKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQGKR  351

Query  511  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  352  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  403



>gb|KJB34354.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=404

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 82/112 (73%), Gaps = 5/112 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            KK  MLL L+YE VI+A A+QG PWT GTRP F+P+    DFMG +         +   R
Sbjct  286  KKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQGKR  341

Query  511  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
               +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  342  NITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  393



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR  509
            K+RM L LNYE VI+A A+QG PWT+G RPHF+ +      + GD H      S      
Sbjct  276  KTRMFLRLNYEAVIAAWAAQGSPWTNGVRPHFNLDDFMVTCLEGDSHPSCGGRSGA----  331

Query  508  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  329
            +D  REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ F      P Y
Sbjct  332  NDAEREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN-FSGSSSLP-Y  389

Query  328  LLNR  317
            L+N+
Sbjct  390  LINK  393



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 2/113 (2%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHH-HHPYGSAMMMR  512
            K  + L L+YE VI A A+QGCPWT G+RP  + +  W D MG      ++PYG      
Sbjct  308  KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNADDSWTDSMGTSPKDVNNPYGGLGSHT  367

Query  511  RSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  356
            R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL 
Sbjct  368  RGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLM  420



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 84/117 (72%), Gaps = 8/117 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMM  518
            +KK +M+L L+YE VI+A    G PWT G RP FD + C PD+MG      H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGACGAELHYPYGEMNG  387

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            +       D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKR+S 
Sbjct  388  LGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAQKRPRMKGRFVKRASF  444



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 89/127 (70%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFM---GGD  554
            +G  KEE  K+  ++L L+YE VIS   SQG PWT       D +   C  + M   GG+
Sbjct  101  TGRIKEE-KKEKVLMLRLDYETVISTWGSQGTPWTALKPSEIDLDMLCCQTNSMCESGGE  159

Query  553  -HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
             HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  160  AHHHNHFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  219

Query  379  FVKRSSL  359
            FVKRSS+
Sbjct  220  FVKRSSI  226



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 82/125 (66%), Gaps = 7/125 (6%)
 Frame = -3

Query  712  SCKEE--VAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            SC +E  +   S+  L L+YE V+SA   +  PWT G RP+ D   CWPD   G     H
Sbjct  320  SCFQECKMGDSSKTFLRLDYEGVLSAWDDKKSPWTTGERPNLDSCDCWPDHCLGTSGAMH  379

Query  538  PYG-----SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
             YG     S      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  380  VYGEMGRMSGHAAAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  439

Query  373  KRSSL  359
            KRS+ 
Sbjct  440  KRSNF  444



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 85/124 (69%), Gaps = 13/124 (10%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHHPYGSA--  524
            K+ ++ L LN+E VISA AS+G PWT G +P  +P+  WPD MG  G +   +  G    
Sbjct  308  KRKKICLRLNHEAVISAWASKGSPWTTGVKPELNPDDGWPDCMGVWGTNQIMNLQGHGDS  367

Query  523  ------MMMRRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                  M MR   E   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  368  SAAAHRMGMRGDTEQRPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  427

Query  370  RSSL  359
            R+S 
Sbjct  428  RTSF  431



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 83/124 (67%), Gaps = 11/124 (9%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR  509
            K ++LL+L+YE V++A A Q  PWT+G RP  D N  WP  MG        Y   M    
Sbjct  331  KKKILLNLDYEGVLTAWADQRSPWTNGERPELDSNDSWPHCMGN-------YMGIMNENV  383

Query  508  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  335
            +  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        P
Sbjct  384  TIVDRGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNFVTTTT--P  441

Query  334  NYLL  323
            NY L
Sbjct  442  NYPL  445



>ref|XP_004164163.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
Length=375

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 90/131 (69%), Gaps = 12/131 (9%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG--DHHHHH  539
            +C EE  K    ++++    V +A  S+G PWT G RP+ D +  WPD+MG      ++ 
Sbjct  243  TCSEEDDKMMMEVMAV----VKNAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQ  298

Query  538  PYG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
            PYG   + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRF
Sbjct  299  PYGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  358

Query  376  VKRSSLFQPPP  344
            VKRSS F PPP
Sbjct  359  VKRSSCFAPPP  369



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 84/123 (68%), Gaps = 9/123 (7%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM-----GGDHHHHHPYGSAMMMRR  509
            L L+YE VI+A ASQ  PWT   +P+ DP+ CW   M     G D  +    G  +    
Sbjct  290  LQLDYESVITAWASQKSPWTTPHKPNLDPDECWHHCMESCGTGMDDPYGEVGGFGIHPMI  349

Query  508  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  329
            +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  
Sbjct  350  NDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--  405

Query  328  LLN  320
            LLN
Sbjct  406  LLN  408



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMM  518
            +KK +M+L L+YE VI+A    G PWT G RP FD + C PD+M       H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYGDXNG  387

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S    
Sbjct  388  LGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGS  447

Query  349  PPPFP  335
              P P
Sbjct  448  AFPVP  452



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMM  518
            +KK +M+L L+YE VI+A    G PWT G RP FD + C PD+M       H+PYG    
Sbjct  331  SKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYGDXNG  387

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S    
Sbjct  388  LGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKASFAGS  447

Query  349  PPPFP  335
              P P
Sbjct  448  AFPVP  452



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 91/137 (66%), Gaps = 12/137 (9%)
 Frame = -3

Query  712  SCKE-EVAKKSRMLLSLNYEEVISAXASQ--GCPWTDGTRPHFDPNXCWPDFMG---GDH  551
            SC+E +  KK ++ L L+Y+EVI+   SQ  G P+  G RP  D + C PDFMG   G  
Sbjct  311  SCQEHKSCKKRKIFLRLDYDEVITKWDSQSNGSPFAFGDRPDIDYD-CLPDFMGTASGAE  369

Query  550  HHHHPYGS-----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
              H+PYG       +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  370  LLHYPYGDLNRVIGLHPTMTDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  429

Query  385  GRFVKRSSLFQPPPPFP  335
            GRFVKR+S       FP
Sbjct  430  GRFVKRASFAATGSTFP  446



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 83/117 (71%), Gaps = 8/117 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMM  518
            +KK + +L L+YE VI+A    G PWT G RP FD + C PD+MG      H+PYG    
Sbjct  330  SKKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGVCGPGLHYPYGDLNG  386

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            +       D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  387  IGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 73/109 (67%), Gaps = 0/109 (0%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEG  497
             L L+YE V+S+   +  PWT G RP F+   CWPD +         YG   M+     G
Sbjct  271  FLKLDYEGVMSSWDDRKSPWTTGERPEFNSADCWPDSLVSASGAMQAYGGMAMVSGDARG  330

Query  496  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ L  P
Sbjct  331  REARVMRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRACLVAP  379



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFM--GGDH  551
            S S KEE  +K  ML  L+YE VIS    QG PWT    P  D N   C  D M   G  
Sbjct  275  SCSIKEEKNEKVHML-RLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGE  333

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
             HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  334  AHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  393

Query  370  RSSL  359
            RSS+
Sbjct  394  RSSI  397



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFM--GGDH  551
            S S KEE  +K  ML  L+YE VIS    QG PWT    P  D N   C  D M   G  
Sbjct  275  SCSIKEEKNEKVHML-RLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGE  333

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
             HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  334  AHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  393

Query  370  RSSL  359
            RSS+
Sbjct  394  RSSI  397



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 77/111 (69%), Gaps = 4/111 (4%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFD-PNXCWPDFMG---GDHHHHHPYGSAMMMR  512
            ++L L+YE VIS+   QG PWT G  P  D  N  WP  MG   G  +     G  + M 
Sbjct  303  LMLRLDYESVISSWGGQGPPWTAGEPPELDLKNDSWPISMGEVNGGQYGSGICGVGLTMA  362

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
              D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363  MGDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  413



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 83/128 (65%), Gaps = 9/128 (7%)
 Frame = -3

Query  715  GSC--KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFM----GG  557
            G C   EE  +K+ ++L LNY+ VIS    QG PWT G  P  D +   WP       GG
Sbjct  293  GECIKVEEEEQKNVLMLRLNYDSVISTWGGQGPPWTSGDPPELDIDISGWPAISMVGNGG  352

Query  556  DHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
            + HH   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  353  ESHHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  412

Query  382  RFVKRSSL  359
            RFVKR+SL
Sbjct  413  RFVKRASL  420



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 82/124 (66%), Gaps = 5/124 (4%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFM--GGDH  551
            S S KEE  +K  ML  L+YE VIS    QG PWT    P  D N   C  D M   G  
Sbjct  275  SCSIKEEKNEKVHML-RLDYESVISTWGGQGTPWTAREPPQIDLNMLCCPTDSMVESGGE  333

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
             HHH Y   + +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  334  AHHHNYVRGLGLHMGEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  393

Query  370  RSSL  359
            RSS+
Sbjct  394  RSSI  397



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 5/122 (4%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-DHHHHHPYGSAMMMR  512
            K ++ L L+Y+ VI A   + CPWT G +P+ D +  WPD  G       +PYG      
Sbjct  322  KRKISLQLDYDAVIIAWDGRKCPWTTGDKPNLDADETWPDCTGSCGTEVLYPYGELGGYE  381

Query  511  ----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  344
                 +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  
Sbjct  382  CHPVMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTF  441

Query  343  PF  338
            P 
Sbjct  442  PL  443



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 80/121 (66%), Gaps = 11/121 (9%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM-----------GGDHH  548
             KK  ++L LNYE VI+A ASQG PWT G RP F+P+  WPD +            GD  
Sbjct  301  TKKRDIILRLNYEAVIAAWASQGSPWTTGNRPDFNPDDGWPDCLDVCHTDHVGPANGDSS  360

Query  547  HHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                    +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  361  RGGLGLGGVGGSVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  420

Query  367  S  365
            +
Sbjct  421  T  421



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 87/126 (69%), Gaps = 7/126 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDFMGGD----  554
            SG  KEE  +K+ ++L L+YE VIS    QG PWTD      D +  C P    G+    
Sbjct  284  SGRIKEENKEKA-LMLRLDYESVISTWNGQGIPWTDREPSEIDLDMVCCPTHSLGESGEA  342

Query  553  HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
            HHH+H  G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  343  HHHNHFRGLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  402

Query  376  VKRSSL  359
            VKRSS+
Sbjct  403  VKRSSI  408



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -3

Query  718  SGSC---KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDF-MGGD  554
            SG C   KEE  +K+ ++L LNYE VIS    QG PWT G  P  D +   WP   MGG+
Sbjct  232  SGECITVKEE-EQKNVLMLRLNYESVISTWGGQGPPWTSGEPPERDVDISGWPVVSMGGN  290

Query  553  ----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
                   HH  G        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  291  VRESQQKHHVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  350

Query  385  GRFVKRSSL  359
            GRFVKR+SL
Sbjct  351  GRFVKRASL  359



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 84/130 (65%), Gaps = 10/130 (8%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG------GDHHHHHPYG  530
            K+  + L L+ E VI+A  +   PWT+G RP FDP+  WP+ M       G     H   
Sbjct  210  KRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSMEVCEVRYGQRCGEHGLR  269

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            +A M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+  F P
Sbjct  270  TAAM---GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTP-FPP  325

Query  349  PPPFPNYLLN  320
             P  P   +N
Sbjct  326  QPTLPFITIN  335



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 10/129 (8%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRP---HFDPNXCWPDFM---GG  557
            +G  KEE  K+  ++L L+YE VIS   SQG PWT   +P     D   C  + M   GG
Sbjct  273  TGRIKEE-KKEKVLMLRLDYETVISTWGSQGTPWT-ALKPSEIDLDMLCCQTNSMCESGG  330

Query  556  D-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
            + HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  331  EAHHHNHFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  390

Query  382  RFVKRSSLF  356
            RFVKRSS+ 
Sbjct  391  RFVKRSSIV  399



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX-CWPDFMGGD----  554
            SG  KEE  +K+ ++L L+YE VIS    QG PWT       D +  C+P    G+    
Sbjct  277  SGGIKEEKKEKA-LMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAE  335

Query  553  -HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  336  AHHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  395

Query  379  FVKRSSL  359
            FVKRSS+
Sbjct  396  FVKRSSI  402



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDFMGGD----  554
            SG  KEE  +K+ ++L L+YE VIS    QG PWT       D +  C+P    G+    
Sbjct  276  SGGIKEEKKEKA-LMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAE  334

Query  553  -HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  335  AHHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  394

Query  379  FVKRSSL  359
            FVKRSS+
Sbjct  395  FVKRSSI  401



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = -3

Query  700  EVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN--XCWPDF-MG--GDHHHHHP  536
            E  +K+ ++L LNY+ VIS    QG PW+ G RP  D +    WP   MG  G   H  P
Sbjct  274  EEEQKNVLMLRLNYDSVISTWGGQGPPWSPGERPELDIDIINTWPSVSMGENGGESHQKP  333

Query  535  YGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            +    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS
Sbjct  334  FVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSS  393

Query  361  L  359
            L
Sbjct  394  L  394



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 ref|XP_004172358.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG------GDHHHHHPYG  530
            K+  + L L+ E VI+A  +   PWT+G RP FDP+  WP+ M       G     + + 
Sbjct  209  KRRVLSLRLDCEAVIAAWGNLQSPWTNGQRPDFDPDQPWPNSMDLCEVRYGQRCGEYGFR  268

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            +A +    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+  F P
Sbjct  269  TAAI---GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTP-FAP  324

Query  349  PPPFPNYLLN  320
             P  P   +N
Sbjct  325  QPTLPIITIN  334



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 82/122 (67%), Gaps = 6/122 (5%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFM-----GGDH  551
            + K E   + +  L L+YE +I A +SQG  PWTDG RP  + + CWPD+M      G  
Sbjct  282  AVKVEQGAEKKAKLRLDYESIIMAWSSQGSSPWTDGERPQINVDNCWPDYMDMWTGSGME  341

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                 +G  + +   D  REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  342  TERACHGGEIGVYLGDGKREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  401

Query  370  RS  365
            R+
Sbjct  402  RT  403



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -3

Query  718  SGSC---KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF-MGGD  554
            SG C   KEE  KK+ ++L LNY+ VIS    QG PWT G  P  D +   WP   MGG+
Sbjct  236  SGECVKVKEE-EKKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGN  294

Query  553  ----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
                   HH  G        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  295  VRESQQKHHVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  354

Query  385  GRFVKRSSL  359
            GRFVKR+SL
Sbjct  355  GRFVKRASL  363



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 80/117 (68%), Gaps = 8/117 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMM  518
             KK  + L L+YE VI+A    G PWT G RP F  + C PD MG      H+PYG    
Sbjct  324  GKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDF-SSECLPDCMGVCGTELHYPYGDLNG  380

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            +      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  381  LGVHPAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  437



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 88/132 (67%), Gaps = 18/132 (14%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM--------  563
            SG  KEE  K+  ++L L+YE VISA  S   PWT       +P+    D +        
Sbjct  101  SGRIKEE-EKEKVLMLRLDYENVISAWGSHRTPWTA-----LEPSEIDLDMLRRQTNSVC  154

Query  562  --GGD-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  395
              GG+ HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  155  ESGGEAHHHNHFRGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  214

Query  394  RLKGRFVKRSSL  359
            R+KGRFVKRSS+
Sbjct  215  RMKGRFVKRSSI  226



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDFMGGD----  554
            SG  KEE  +K+ ++L L+YE VIS    QG PWT       D +  C+P    G+    
Sbjct  276  SGGIKEEKKEKA-LMLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAE  334

Query  553  -HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
             HHH+H  G  + +  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGR
Sbjct  335  AHHHNHFRGLGLHLGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGR  394

Query  379  FVKRSSL  359
            FVKRSS+
Sbjct  395  FVKRSSI  401



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMM  518
            +KK  + L L+YE VI+A    G PWT G RP F+ + C PD MG      H PYG    
Sbjct  328  SKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDFN-SECLPDCMGVCGTELHFPYGDLNG  384

Query  517  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            +      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  385  LWVHPAIADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  441



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 86/130 (66%), Gaps = 10/130 (8%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFMGGD---  554
            SG  KEE  +K+ ++L LNYE VIS    QG PWT       D +   C  D MG     
Sbjct  279  SGKIKEENKEKA-LMLRLNYESVISTWGGQGIPWTAQQPSEIDLDMVCCPTDSMGESGVD  337

Query  553  --HHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
              HH++H  G  + M  +  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  338  QAHHYNHFRGLGLRMGEAHGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  397

Query  385  GRFVKRSSLF  356
            GRFVKRSS+ 
Sbjct  398  GRFVKRSSVV  407



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 76/109 (70%), Gaps = 5/109 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            K+  M+L L+YE VI + A  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  22   KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  78

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  79   VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  126



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 79/124 (64%), Gaps = 5/124 (4%)
 Frame = -3

Query  718  SGSC---KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDFMGGDH  551
            SG C   KEE  KK+ ++L LNY+ VIS    QG PWT G  P  D +   WP       
Sbjct  25   SGECVKVKEE-EKKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMRKS  83

Query  550  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                 +         D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  84   AEASRWWMFTFEWVWDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  143

Query  370  RSSL  359
            R+SL
Sbjct  144  RASL  147



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (70%), Gaps = 8/116 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMMM  515
            KK + +L L+YE VI+A    G PWT G RP FD +   PD+MG      H+PYG    +
Sbjct  331  KKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGI  387

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  388  GVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 81/116 (70%), Gaps = 8/116 (7%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-GDHHHHHPYGSAMMM  515
            KK + +L L+YE VI+A    G PWT G RP FD +   PD+MG      H+PYG    +
Sbjct  331  KKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGDLNGI  387

Query  514  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  388  GVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>gb|KJB23747.1| hypothetical protein B456_004G113000 [Gossypium raimondii]
Length=418

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 85/129 (66%), Gaps = 13/129 (10%)
 Frame = -3

Query  697  VAKKSRM-LLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG----DHHHHHPY  533
            VAK  R  LL LNYE VI+A ASQG   T GTRP  +P+    DFMG     +HH +   
Sbjct  292  VAKTKRNKLLRLNYESVITAWASQG-SRTTGTRPELNPD----DFMGSYPKDEHHQNGGI  346

Query  532  GSA---MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            G     +    +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  347  GGINRPVRANNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  406

Query  361  LFQPPPPFP  335
                   FP
Sbjct  407  FVGLGTAFP  415



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 87/128 (68%), Gaps = 11/128 (9%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMG----GDHHHH  542
            +++V +K+R  LSL+YE VI A +S G  PWTDG RP  + + CW D  G    G     
Sbjct  300  QQQVTQKAR--LSLDYEAVIIAWSSHGSSPWTDGERPQINLDSCWHDCTGMWVEGADALG  357

Query  541  HPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              +GS      +D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  358  VGHGSDTGGGYADVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA-  416

Query  361  LFQPPPPF  338
               P P F
Sbjct  417  ---PGPAF  421



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 78/126 (62%), Gaps = 8/126 (6%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--GDHHHHHPYGSAMM  518
            K+ ++LL L+YE +  A AS G PW +G RP  + + CWP  M   G    H  +G   M
Sbjct  302  KRRKILLRLDYEAISDAWASHGSPWINGQRPQINSDDCWPHCMATCGLEGRHPIFGDHQM  361

Query  517  MRRSDEG------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  356
                         REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS  
Sbjct  362  GGMGGNRGIGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSFT  421

Query  355  QPPPPF  338
                 F
Sbjct  422  AATTAF  427



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 81/122 (66%), Gaps = 7/122 (6%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-----XCWPDFMGGDH  551
            G+ KEE  +K+ ++LSLNYE VIS    QG PW  G  P  D +         +  GG+ 
Sbjct  212  GTVKEE-EQKNVLMLSLNYESVISTWGGQGQPWMSGEPPERDIDISDKPVVSMEINGGES  270

Query  550  HHHHPYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
            HH H  G  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  271  HHKHYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  330

Query  373  KR  368
            KR
Sbjct  331  KR  332



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 88/128 (69%), Gaps = 9/128 (7%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWT--DGTRPHFDPNXCWPDFMGGD---  554
            SG+ KEE  +K+ ++L L+YE V+S    QG PWT  + +    D   C  D MG     
Sbjct  297  SGNIKEEKKEKA-LMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGETGAD  355

Query  553  --HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
              HH++H  G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  356  QAHHYNHFRGLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  415

Query  382  RFVKRSSL  359
            RFVKRSS+
Sbjct  416  RFVKRSSI  423



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 80/126 (63%), Gaps = 18/126 (14%)
 Frame = -3

Query  682  RMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG--------GDHHHHHPYG-  530
            ++ L L+Y+ V+S+   +  PWT G RP  D + CWPD  G        G+HHH      
Sbjct  325  KIFLRLDYDGVLSSWDERKSPWTTGERPDLDSDECWPDCSGTCGKMHVYGNHHHDMGMMM  384

Query  529  ---------SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
                     S  ++   D GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  385  MMMGGGGTHSGAVVASVDGGRQARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  444

Query  376  VKRSSL  359
            VKR++ 
Sbjct  445  VKRANF  450



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 87/128 (68%), Gaps = 9/128 (7%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWT--DGTRPHFDPNXCWPDFMGGD---  554
            SG  KEE  +K+ ++L L+YE V+S    QG PWT  + +    D   C  D MG     
Sbjct  283  SGKIKEENKEKA-LMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGESGAD  341

Query  553  --HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
              HH++H  G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  342  QAHHYNHFRGLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  401

Query  382  RFVKRSSL  359
            RFVKRSS+
Sbjct  402  RFVKRSSI  409



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 82/127 (65%), Gaps = 10/127 (8%)
 Frame = -3

Query  718  SGSCKEEVAK---KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF-MG--  560
            SG C  +V +   K+ ++L LNY+ VIS    QG PWT G  P  D +   WP   MG  
Sbjct  281  SGECVVKVKEEEGKNVLMLRLNYDSVISTWGGQGQPWTSGEPPELDIDISSWPPVSMGET  340

Query  559  -GDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
             GD  H   Y S  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  341  KGDLSHQKQYVSVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  400

Query  388  KGRFVKR  368
            KGRFVKR
Sbjct  401  KGRFVKR  407



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 80/119 (67%), Gaps = 10/119 (8%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-DFMG-----GDHHHHHPY  533
            A +S + LSLNYE +I +  S   PWTDG RPH   N  WP D+ G          H   
Sbjct  211  ALQSSLALSLNYEAIIESWGSS--PWTDGERPHVKLNDSWPHDYSGVWMAAAGVFGHGEE  268

Query  532  GSAMM--MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              A+   ++  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  269  QQALTPRLQGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFMGGDHHH  545
            S + KEE  K++  +L L+Y+ VIS    QG PWT    P  D +   C P+     HH+
Sbjct  275  SCTVKEE-KKENVPMLRLDYQAVISTWGGQGTPWTALEPPEIDLDMLCCSPNSTAHQHHN  333

Query  544  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
            H       M    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  334  HFHGLGLRMGDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  393

Query  364  SL  359
            S+
Sbjct  394  SI  395



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = -3

Query  718  SGSC---KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF-MGGD  554
            SG C   KEE  +K+ ++L LNY+ VIS    QG PWT G  P  D +   WP   MGG+
Sbjct  237  SGECVKVKEE-EQKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMGGN  295

Query  553  ----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
                   HH           D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  296  VRESQQKHHVGVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  355

Query  385  GRFVKRSSL  359
            GRFVKR+SL
Sbjct  356  GRFVKRASL  364



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF----MGGDHHHHHPYGSAMMM  515
            ++L LNY+ VIS    QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGPPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  514  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF----MGGDHHHHHPYGSAMMM  515
            ++L LNY+ VIS    QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGPPWTSGEPPKLDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  514  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF----MGGDHHHHHPYGSAMMM  515
            ++L LNY+ VIS    QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  514  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF----MGGDHHHHHPYGSAMMM  515
            ++L LNY+ VIS    QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  301  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  360

Query  514  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  361  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  411



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 72/111 (65%), Gaps = 7/111 (6%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-XCWPDF----MGGDHHHHHPYGSAMMM  515
            ++L LNY+ VIS    QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  514  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 76/109 (70%), Gaps = 5/109 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            K+  M+L L+YE VI + A  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  276  KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  332

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  333  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  380



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 12/124 (10%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHP--  536
            +++V KK++  L L+YE VISA +S G  PWTDG RP  + +  WPD+MG          
Sbjct  294  QQQVTKKAK--LRLDYEAVISAWSSYGSSPWTDGERPQINLDYYWPDYMGVRVEVGGGGR  351

Query  535  -------YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
                   +GS   +   D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRF
Sbjct  352  GETPGTGHGSDTGVGFVDVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRF  411

Query  376  VKRS  365
            VKR+
Sbjct  412  VKRA  415



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 76/109 (70%), Gaps = 5/109 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            K+  M+L L+YE VI + A  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  200  KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  256

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  257  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  304



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 79/117 (68%), Gaps = 7/117 (6%)
 Frame = -3

Query  682  RMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRS  506
            +M+L L+YE VIS+    G  PW  G RPH D +  W DF  G        G+A+     
Sbjct  291  QMILKLDYEGVISSWTHDGASPWFYGERPHLDSSDSWLDFPAGSGRGFG-LGAAVTAVTG  349

Query  505  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  335
             E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++L    PP P
Sbjct  350  GE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAAL----PPLP  401



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-----XCWPDFMGGDHHHHH  539
            EE  +K+ ++LSLNYE VIS    QG PW     P  D +         +  GG+ HH H
Sbjct  215  EEEEQKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKH  274

Query  538  PYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              G  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  275  YVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  332



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPN-----XCWPDFMGGDHHHHH  539
            EE  +K+ ++LSLNYE VIS    QG PW     P  D +         +  GG+ HH H
Sbjct  281  EEEEQKNVLMLSLNYESVISTWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKH  340

Query  538  PYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              G  +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  341  YVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -3

Query  718  SGSCKEEVAK---KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFM----  563
            SG C  +V +   K+ ++L LNY+ VIS    QG PW+ G  P  D +   WP F     
Sbjct  277  SGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVEN  336

Query  562  GGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
            GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  337  GGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  396

Query  388  KGRFVKR  368
            KGRFVKR
Sbjct  397  KGRFVKR  403



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -3

Query  718  SGSCKEEVAK---KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFM----  563
            SG C  +V +   K+ ++L LNY+ VIS    QG PW+ G  P  D +   WP F     
Sbjct  276  SGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVEN  335

Query  562  GGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
            GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  336  GGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  395

Query  388  KGRFVKR  368
            KGRFVKR
Sbjct  396  KGRFVKR  402



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 78/123 (63%), Gaps = 7/123 (6%)
 Frame = -3

Query  709  CKEEVAKKSRMLLSLNYEEVISAXASQGCP--WTDGTRPHFD-PNXCWPDFMG--GDHHH  545
             KEE   K    L LNYEEVI+  + QG P  WT    P F+  +  W + +G  G    
Sbjct  65   TKEET--KRERFLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGE  122

Query  544  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                   +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  123  VRSLRGQLMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  182

Query  364  SLF  356
            + F
Sbjct  183  ACF  185



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -3

Query  718  SGSCKEEVAK---KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFM----  563
            SG C  +V +   K+ ++L LNY+ VIS    QG PW+ G  P  D +   WP F     
Sbjct  277  SGECVVKVKEEEHKNVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVEN  336

Query  562  GGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
            GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  337  GGESTHQKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  396

Query  388  KGRFVKR  368
            KGRFVKR
Sbjct  397  KGRFVKR  403



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 83/129 (64%), Gaps = 10/129 (8%)
 Frame = -3

Query  718  SGSC---KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDF-MGGD  554
            SG C   KEE  +K+ ++L LNY+ VIS    Q  PWT G  P  D +   WP   MGG+
Sbjct  268  SGECVKVKEE-EQKNVLMLRLNYDSVISTWGGQCPPWTSGEPPERDIDISNWPFVSMGGN  326

Query  553  ----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
                   HH           D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  327  VRESQQKHHVGVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  386

Query  385  GRFVKRSSL  359
            GRFVKR+SL
Sbjct  387  GRFVKRASL  395



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 80/127 (63%), Gaps = 10/127 (8%)
 Frame = -3

Query  718  SGSCKEEV---AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFM----  563
            SG C  +V    +K+ +LL LNY+ VIS    QG PW+ G  P  D +   WP       
Sbjct  276  SGECVVKVKEEEQKNVLLLRLNYDSVISTWGGQGPPWSSGVPPERDMDISGWPAVSMGEN  335

Query  562  GGDHHHHHPYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
            GG+  H   Y    +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+
Sbjct  336  GGECTHKKQYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRM  395

Query  388  KGRFVKR  368
            KGRFVKR
Sbjct  396  KGRFVKR  402



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCP--WTDGTRPHFDP-NXCWPDFMG---GD  554
            GS   +   K    L LNYE+VISA   QG P  WT G  P F   + CW +F+G    D
Sbjct  267  GSFDAKEETKRERFLRLNYEDVISAWNIQGSPSPWTTGNPPKFISHDDCWQNFLGPSGVD  326

Query  553  HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
                   G  +     D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  327  EEVRSLRGQLIGNINGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFV  386

Query  373  KR  368
            KR
Sbjct  387  KR  388



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 85/140 (61%), Gaps = 16/140 (11%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFD-PNXCWPDFMG--GDHH  548
            S +    + KK+ ++L LN+E VIS    +G PWT G  P  D  +  W   MG  G+  
Sbjct  304  SSNISHSIKKKNVLMLRLNHEAVISTWGGKGPPWTAGKPPELDLDDNSWHISMGENGNEV  363

Query  547  HHHPYG---------SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  395
                YG         +AMM    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP
Sbjct  364  PLDRYGGRFCGLGLQAAMM----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  419

Query  394  RLKGRFVKRSSLFQPPPPFP  335
            R+KGRFVKR+S+       P
Sbjct  420  RMKGRFVKRASIASITSSLP  439



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 75/121 (62%), Gaps = 23/121 (19%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR----  512
            + L+LNYE ++    S   PW DG RPH   + CWP      H ++     A MM     
Sbjct  154  LALNLNYEAIMENWGSS--PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVG  205

Query  511  -----------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                       R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  206  HGGEGLGTPRLRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  265

Query  364  S  362
            +
Sbjct  266  N  266



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 77/115 (67%), Gaps = 8/115 (7%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFMGGD-----HHHHHPYGSAM  521
            ++L L+YE V+S    QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  520  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  411



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-DFMGGDHHHHHPYG-----  530
            ++S + LSLNYE +I +  +   PWTDG RPH   +  WP D+ G        +G     
Sbjct  321  QQSNLALSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSGVWMAAAGVFGHGGEE  378

Query  529  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             A+  R   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  379  QALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 14/131 (11%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFD--------PNXCWPDFMGG  557
            +C++E  +K+ + L L+YE VISA  + G PW  G +P F+         N C    MGG
Sbjct  267  TCEDE-DRKTTLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGG  325

Query  556  DHHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  392
                    GS    +  D G     REAR+ RYREKRRTRLF+KKIRYEVRKLNAE+RPR
Sbjct  326  FEELASAVGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEVRKLNAEQRPR  385

Query  391  LKGRFVKRSSL  359
            +KGRFVKR+SL
Sbjct  386  IKGRFVKRTSL  396



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 82/131 (63%), Gaps = 14/131 (11%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFD--------PNXCWPDFMGG  557
            +C++E  +K+ + L L+YE VISA  + G PW  G +P F+         N C    MGG
Sbjct  268  TCEDE-DRKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDCCLLGGNNTCPSHVMGG  326

Query  556  DHHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  392
                    GS    +  D G     REARV RYR+KRRTRLF+KKIRYEVRKLNAE+RPR
Sbjct  327  FDELESAVGSVTRQQGRDGGGSDVEREARVLRYRDKRRTRLFAKKIRYEVRKLNAEQRPR  386

Query  391  LKGRFVKRSSL  359
            +KGRFVKR+SL
Sbjct  387  IKGRFVKRTSL  397



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXA-SQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            K+  M+L LNY+ VI++     G PW  G RPH DP   W DF  G        G A+  
Sbjct  275  KRPEMILKLNYDGVIASWVRDGGSPWFHGERPHLDPYELWSDFPAGSRGL---LGGAVTA  331

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                E REARVSRYREKRRTRLF+KKIRYEVRK+NAEKRPR+KGRFVKR++
Sbjct  332  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKVNAEKRPRMKGRFVKRTT  381



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 75/121 (62%), Gaps = 23/121 (19%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR----  512
            + L+LNYE ++    S   PW DG RPH   + CWP      H ++     A MM     
Sbjct  215  LALNLNYEAIMENWGSS--PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVG  266

Query  511  -----------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                       R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  267  HGGEGLGTPRLRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  326

Query  364  S  362
            +
Sbjct  327  N  327



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 5/108 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXA-SQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            K+  M+L LNY+ VI++ A   G PW  G RPH DP+  W DF  G        G  +  
Sbjct  260  KRPEMILKLNYDGVIASWARDGGSPWFHGERPHLDPHESWSDFPAGSRGL---LGGTVTA  316

Query  514  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  317  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVK  363



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 79/123 (64%), Gaps = 17/123 (14%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFM-----------G  560
            E  A    M+L L+YE VI+A +  GC PWTDG RP F+ +    DFM           G
Sbjct  291  ERAAAGRGMMLRLDYEAVIAAWSCNGCSPWTDGERPQFNLD----DFMMMMWSGGSVREG  346

Query  559  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
            G       YG  + M   + GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  347  GGWKVAPVYGE-VGMAAGNGGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGR  405

Query  379  FVK  371
            FVK
Sbjct  406  FVK  408



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 81/131 (62%), Gaps = 9/131 (7%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            G   EE   K  + L LNY+EVISA ++QG  PWT    P F+      DF  G      
Sbjct  245  GGVGEEEGTKRDIFLRLNYDEVISAWSTQGSSPWTTSNPPKFNSGY---DFCLG---LSG  298

Query  538  PYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              G    +R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +
Sbjct  299  VDGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-T  357

Query  361  LFQPPPPFPNY  329
             F     FP Y
Sbjct  358  CFVGVNAFPAY  368



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 79/123 (64%), Gaps = 7/123 (6%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCP--WTDGTRPHFD-PNXCWPDFMG--GDHHHHHPYGSAMMMR  512
             L LNYEEVI+  + QG P  WT  + P F+  +  W + +G  G           +M  
Sbjct  293  FLRLNYEEVITECSRQGSPSPWTTASPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGS  352

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP  335
              D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      FP
Sbjct  353  GGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSFP  412

Query  334  -NY  329
             NY
Sbjct  413  TNY  415



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 82/132 (62%), Gaps = 11/132 (8%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            G   EE   K  + L LNY+EVI+A +SQG  PWT    P F+ +  +   + G      
Sbjct  242  GVGDEEGGTKRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------  295

Query  538  PYGSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
              G  +   R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR 
Sbjct  296  -VGGEVRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-  353

Query  364  SLFQPPPPFPNY  329
            + F     FP Y
Sbjct  354  TCFVGANAFPAY  365



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 79/124 (64%), Gaps = 5/124 (4%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPD-FMGGDHH----  548
            S + E    + M L LNYE VI+A A++GCPWT+GT P FD    + D + GG       
Sbjct  257  SSRSESHNNNNMFLRLNYEAVIAAWATKGCPWTNGTPPQFDNLDQFMDEWSGGSSEWCGG  316

Query  547  HHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                  +      +D  REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPR+KGRFVKR
Sbjct  317  RIGGNNNNNNNNNNDAEREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRFVKR  376

Query  367  SSLF  356
             + F
Sbjct  377  PTAF  380



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 78/123 (63%), Gaps = 7/123 (6%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCP--WTDGTRPHFD-PNXCWPDFMG--GDHHHHHPYGSAMMMR  512
             L LNYEEVI+  + QG P  WT    P F+  +  W + +G  G           +M  
Sbjct  293  FLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGS  352

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFP  335
              D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F      FP
Sbjct  353  GGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACFAGGATSFP  412

Query  334  -NY  329
             NY
Sbjct  413  TNY  415



>gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 15/115 (13%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-----------GDHHHHHPYGS  527
            L LNY+ VI+A  +Q  P+T G RP FD + CW ++ G            D        +
Sbjct  249  LRLNYDAVITAWDAQSSPYTTGNRPQFDLDDCWEEWSGVCSKGGRNVVVDDQEWRGRNNN  308

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
             +    S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  309  GI----SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  359



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            G   E+   K  + L LNY+EVI+A +SQG  PWT    P F+ +  +   + G      
Sbjct  247  GGVSEQGGIKRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------  300

Query  538  PYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              G    +R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +
Sbjct  301  VDGEGRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-T  359

Query  361  LFQPPPPFPNY  329
             F     FP Y
Sbjct  360  CFVGANAFPAY  370



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 82/131 (63%), Gaps = 9/131 (7%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            G   E+   K  + L LNY+EVI+A +SQG  PWT    P F+ +  +   + G      
Sbjct  247  GGVSEQGGIKRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------  300

Query  538  PYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
              G    +R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +
Sbjct  301  VDGEGRSLRGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-T  359

Query  361  LFQPPPPFPNY  329
             F     FP Y
Sbjct  360  CFVGANAFPAY  370



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 75/119 (63%), Gaps = 7/119 (6%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPH--FDPNXCWPDFMGGDHHHHHPYGSAMM  518
            +K+ + L L+Y  VISA  + G PW  G +P      N C P  +GG        GS   
Sbjct  273  RKTSLFLRLDYGAVISAWDNHGSPWKTGIKPECMLGGNTCLPHVVGGYEKLMSSDGSVTR  332

Query  517  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  356
             +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR+SL 
Sbjct  333  QQGRDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTSLL  391



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 81/131 (62%), Gaps = 14/131 (11%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFD--------PNXCWPDFMGG  557
            +C++E  +K+ + L L+YE VISA  + G PW  G +P F+         N C    MGG
Sbjct  269  ACEDE-DRKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGG  327

Query  556  DHHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  392
                     S    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR
Sbjct  328  FEELASAVRSVTRQQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPR  387

Query  391  LKGRFVKRSSL  359
            +KGRFVKR+SL
Sbjct  388  IKGRFVKRTSL  398



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 83/130 (64%), Gaps = 13/130 (10%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC------WPD-FMGGD  554
            +C++E  +K+ + L L+YE VISA  + G PW    +P F+ + C      +P   MGG 
Sbjct  277  ACEDE-DRKTSLFLRLDYEAVISAWDNHGSPWKTEIKPEFNLDDCLLEGNTYPSHVMGGF  335

Query  553  HHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  389
                   GS    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+
Sbjct  336  EEWTSAVGSVTRRQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRI  395

Query  388  KGRFVKRSSL  359
            KGRFVKR+SL
Sbjct  396  KGRFVKRTSL  405



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 78/121 (64%), Gaps = 15/121 (12%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG-----------GDHHH  545
            KK+ + L LNY+ VI+A  +Q  P+T G RP FD + C  ++ G            D   
Sbjct  250  KKNIISLRLNYDAVITAWDAQSSPYTTGNRPQFDLDDCLEEWSGICSKGGRNVAVDDQEW  309

Query  544  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
               Y   +    S+  REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+
Sbjct  310  RRNYNGII----SNGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRT  365

Query  364  S  362
            +
Sbjct  366  T  366



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = -3

Query  664  NYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGG-----DHHHHHPYGSAMMMRRSDE  500
            +YE VI+A  SQ   WT   +P       WP  M       +H     +G    M  +D 
Sbjct  264  DYEAVITAWTSQRSLWTTSHKPDLGTTQFWPHCMRTCGVEFEHRSGELFGCDAAM--ADG  321

Query  499  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  320
            GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR SL   PP FP  LLN
Sbjct  322  GREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSL-ATPPIFP--LLN  378

Query  319  R  317
            +
Sbjct  379  K  379



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-DFMGGDHHHHHPYG-----  530
            ++S + LSLNYE +I +  +   PWTDG RP    +  WP D+ G        +G     
Sbjct  322  QQSSLALSLNYEAIIESWGTS--PWTDGERPRVKLDDSWPRDYSGVWMAAAGVFGHGGEE  379

Query  529  SAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             A+  R   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  380  QALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 80/134 (60%), Gaps = 23/134 (17%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            SG+  +       + L+LNY+ ++    S   PW DG RP+   + CWP      H ++ 
Sbjct  291  SGASADAQFTPRSLALNLNYDAIMENWGSS--PWADGERPNVKLDDCWP------HDYYS  342

Query  538  PYGSAMMMR---------------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  404
             +  A MM                R D GREARVSRYREKRRTRLFSKKIRYEVRKLNAE
Sbjct  343  LHEGAWMMGGVVGHGGEGLGTPRPRMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  402

Query  403  KRPRLKGRFVKRSS  362
            KRPR+KGRFVKR++
Sbjct  403  KRPRMKGRFVKRAN  416



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 72/114 (63%), Gaps = 17/114 (15%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY------------G  530
            L LNYEE+I +  S   PWTDG RPH        DF   DHH+   +             
Sbjct  212  LRLNYEEIIESWGS--SPWTDGRRPH---GHQLDDFWPNDHHYQGLWAAGGGGHGAEAGT  266

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            + M  R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  267  TVMRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  320



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 76/116 (66%), Gaps = 13/116 (11%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYG-------  530
            K  + L LNYE VI++ AS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIASWAS--SPWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  529  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  174



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 79/123 (64%), Gaps = 11/123 (9%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            K  + L LNY+EVI+A +SQG  PWT    P F+ +  +   + G        G  +   
Sbjct  250  KRDIFLRLNYDEVITAWSSQGSSPWTTSNPPKFNSDYDFSLGLSG-------VGGEVRSL  302

Query  511  RS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  338
            R   D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     F
Sbjct  303  RGHLDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAF  361

Query  337  PNY  329
            P Y
Sbjct  362  PAY  364



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 87/143 (61%), Gaps = 21/143 (15%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCP-WTDGTRPHFDPNXCWPDF--------  566
            S + + E A K +M+L L+YE VI+A +S     W DG RP FDPN  WPD         
Sbjct  289  SDNYRAEAAAKRKMILRLDYEAVIAACSSNVLSLWIDGVRPDFDPNDSWPDVPAMAGGAA  348

Query  565  MGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  386
               + H+      A     +DEGREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+K
Sbjct  349  AMKEMHYQQEVAHA-----ADEGREARVSRYREKRRRRLFSKKIRYEVRKLNAEKRPRMK  403

Query  385  GRFVKRSSLFQPPPPFPNYLLNR  317
            GRFVKR       P FP  L  R
Sbjct  404  GRFVKR-------PAFPAALACR  419



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 78/127 (61%), Gaps = 7/127 (6%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPH--FDPNXCWPDFMGGDHHHH  542
            G   ++  +K+ + LSL+YE VI+A  + G PW  G +       N C    +GG     
Sbjct  264  GEASKDEDRKTSLFLSLDYEAVITAWDNHGSPWKTGIKSECLLGGNTCPSHAVGGFDELV  323

Query  541  HPYGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
               GS    +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRF
Sbjct  324  STVGSVTRQQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRF  383

Query  376  VKRSSLF  356
            VKR+SL 
Sbjct  384  VKRTSLL  390



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 75/110 (68%), Gaps = 5/110 (5%)
 Frame = -3

Query  685  SRMLLSLNYEEVISAXA-SQGCPWTDGTRPHFDP-NXCWPDFMGGDHHHHHPYGSAMMMR  512
            S M+L L+YE VI + A   G PW  G RPH DP +  W D   G        G+A+   
Sbjct  277  SGMILKLDYERVIDSWAHDGGSPWFYGERPHIDPTDDSWLDMPAGSRGFG--LGAAVTAV  334

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
               E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  335  TGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  383



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 10/129 (8%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFMGGDHHHHHPYGS  527
            E+   + ++ L L+YE +++A +S   PWT+G RP F+ + C WPD MG           
Sbjct  248  EKAVSRKKVALRLDYEAIMAAWSSS--PWTNGARPQFNLDVCSWPD-MG-----MWAGEG  299

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  347
                    + RE++V+RYREKRRTRLF+KKIRYEVR+LNAEKRPR+KGRFVKR+S+  P 
Sbjct  300  GEDKGGGRQERESKVTRYREKRRTRLFAKKIRYEVRRLNAEKRPRMKGRFVKRASM-APT  358

Query  346  PPFPNYLLN  320
            P F   +L+
Sbjct  359  PAFAGPVLD  367



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 75/112 (67%), Gaps = 6/112 (5%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXA-SQGCPWTDGTRPHFDPNXCWPD-FMGGDHHHHHPYGSAMM  518
            K+  M+L LNYE VI++     G PW  G RPH D +  W D F  G        G A+ 
Sbjct  264  KRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHELWSDDFTTGSREL---LGGAVT  320

Query  517  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                 E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  321  PVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  371



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 75/117 (64%), Gaps = 13/117 (11%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYG-------  530
            K  + L LNYE VI + AS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIESWAS--SPWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  529  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTG  175



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 74/113 (65%), Gaps = 9/113 (8%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-DF------MGGDHHHHHPYGSAM  521
            + L+LNYE +I     +  PW DG RP    + CWP D+      MGG    H       
Sbjct  316  LSLNLNYEAIIDKW--EKSPWADGKRPDVKLDGCWPHDYSMSVWMMGGVLVGHGTEELRT  373

Query  520  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
               + D GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  374  PRTKMDGGRDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  426



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEG  497
             L L+ + ++SA  S+  PW  G +P       WPDF G        + +       D G
Sbjct  299  FLKLDLDGILSAWNSRNTPWITGQKPDSKSIDFWPDFFGTTAARGDVWAAG-----GDGG  353

Query  496  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  354  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  396



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY--------  533
            K  + L LNYE VI +  S   PWTDG RP    +  WP      HH HH          
Sbjct  313  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  364

Query  532  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  365  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY--------  533
            K  + L LNYE VI +  S   PWTDG RP    +  WP      HH HH          
Sbjct  337  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  388

Query  532  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  447



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = -3

Query  682  RMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFMGGDHHHHHPYGSAMMMRRS  506
            ++ L L+YE ++ A +S   PWT+G RP F+ N C WP    GD       G        
Sbjct  269  KVALRLDYEAIMEAWSSS--PWTNGERPQFNLNVCRWP----GDMGMWVGEGGEEDKGGG  322

Query  505  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  338
             +GREA+V+RYREKRRTR+F+KKIRYEVR+LNAE+RPR+KGRFVKR +   P P F
Sbjct  323  RQGREAKVTRYREKRRTRMFAKKIRYEVRRLNAEQRPRMKGRFVKR-AFVTPTPAF  377



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 73/119 (61%), Gaps = 20/119 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY--------  533
            K  + L LNYE VI +  S   PWTDG RP    +  WP      HH HH          
Sbjct  312  KRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGR  363

Query  532  --GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  364  LGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 76/123 (62%), Gaps = 17/123 (14%)
 Frame = -3

Query  682  RMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC-WPDFMG-----------GDHHHHH  539
            + LL L+Y  V+SA      PWT G RP    + C WP+F G           G  + + 
Sbjct  278  KTLLKLDYGGVMSAWDKHKSPWTTGERPPEPISGCHWPEFSGACGTMGVNGETGKINENI  337

Query  538  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
            P  +       D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  338  PAAAT-----GDGGREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANL  392

Query  358  FQP  350
              P
Sbjct  393  EAP  395



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 75/121 (62%), Gaps = 18/121 (15%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA---------M  521
            L LNYE +I +  +   PWTDG  PH   +  WP+    DHH+   + +          M
Sbjct  205  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGM  258

Query  520  MM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            M    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    
Sbjct  259  MTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAA  318

Query  349  P  347
            P
Sbjct  319  P  319



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 74/122 (61%), Gaps = 19/122 (16%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA----------  524
            L LNYE +I +  +   PWTDG  PH   +  WP+    DHH+      A          
Sbjct  205  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSVRVVGAGGGGHGAEVG  258

Query  523  MMM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  353
            MM    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S   
Sbjct  259  MMTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAA  318

Query  352  PP  347
             P
Sbjct  319  AP  320



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 21/122 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDG-TRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            ++ + L+LNYE +I +  S   PWT G  RPH   +  WP      H + + +    ++ 
Sbjct  33   QTSLSLTLNYEAIIQSWGS--SPWTGGGERPHVKLDTRWP------HDYTNMWVVGGVVG  84

Query  511  RS------------DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                          D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  85   HGGEDLPGTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  144

Query  367  SS  362
            ++
Sbjct  145  AT  146



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 78/128 (61%), Gaps = 8/128 (6%)
 Frame = -3

Query  718  SGSCKE--EVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFM----GG  557
            +G C +  E  KK+ ++LSL+Y++VIS    QG PWT G  P  D N      +     G
Sbjct  229  NGECVQAKEEKKKNVLMLSLDYDQVISTWGGQGLPWTSGGPPDIDINISGSPVVSKRDNG  288

Query  556  DHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
                    G   +      D GREARVSRYREK++TR F+K IRYEVRKLNAE +PR+KG
Sbjct  289  RKSRKKRRGGGRLPSSVVGDGGREARVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKG  348

Query  382  RFVKRSSL  359
            RFVKR+SL
Sbjct  349  RFVKRASL  356



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 75/121 (62%), Gaps = 18/121 (15%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA---------M  521
            L LNYE +I +  +   PWTDG  PH   +  WP+    DHH+   + +          M
Sbjct  334  LRLNYEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGM  387

Query  520  MM---RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
            M    R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    
Sbjct  388  MTVRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAA  447

Query  349  P  347
            P
Sbjct  448  P  448



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 76/122 (62%), Gaps = 5/122 (4%)
 Frame = -3

Query  706  KEE--VAKKSRMLLSLNYEEVISAXASQGC-PWTDGTRPHFDPNXCWPDFMG--GDHHHH  542
            KEE  V     M LSL+YE V  A    G  PW  G RP       W + +G  G+    
Sbjct  216  KEEIKVGISKGMGLSLDYEAVKEAWMVTGSSPWMTGERPRMGVEDYWHECLGKFGETGGE  275

Query  541  HPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                   +++  D GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ 
Sbjct  276  FIGSGTGIIQFMDLGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTD  335

Query  361  LF  356
            +F
Sbjct  336  VF  337



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 79/148 (53%), Gaps = 42/148 (28%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-----------DFMGGDHHH  545
            ++S + LSLNYE +I +  +   PWTDG RPH   +  WP            +       
Sbjct  321  QQSNLALSLNYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSVRATPCTPYASSHRIL  378

Query  544  HHPYGSAMMMRR-----------------------------SDEGREARVSRYREKRRTR  452
            H+  G+  ++RR                              D GREARVSRYREKRRTR
Sbjct  379  HNLAGTDDLLRRRAAVQGVWMAAAGVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTR  438

Query  451  LFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            LFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  439  LFSKKIRYEVRKLNAEKRPRMKGRFVKR  466



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 21/124 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGT-RPHFDPNXCWPDFM-------------GGDH  551
            ++ + L+LNYE +I +  S   PWT G  RPH   +  WP                GG+ 
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGED  385

Query  550  HHHHP-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
                P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  386  LLGTPRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  441

Query  373  KRSS  362
            KR++
Sbjct  442  KRAT  445



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 76/124 (61%), Gaps = 21/124 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGT-RPHFDPNXCWPDFM-------------GGDH  551
            ++ + L+LNYE +I +  S   PWT G  RPH   +  WP                GG+ 
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGED  385

Query  550  HHHHP-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  374
                P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  386  LLGTPRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  441

Query  373  KRSS  362
            KR++
Sbjct  442  KRAT  445



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 21/122 (17%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDG-TRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            ++ + L+LNYE +I +  S   PWT G  RPH   +  WP      H + + +    ++ 
Sbjct  102  QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWP------HDYTNMWVVGGVVG  153

Query  511  RS------------DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                          D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  154  HGGEDLPGTPRLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  213

Query  367  SS  362
            ++
Sbjct  214  AT  215



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 71/112 (63%), Gaps = 7/112 (6%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-----DFMGGDHHHHHPYGSA  524
            K  + LSLNYE +I +  S   PWTDG RP+   +  WP      +M G         + 
Sbjct  361  KRSLDLSLNYEAIIESWGSS--PWTDGQRPNVQLDDFWPHAHLTGWMAGGGRLGGEAAAV  418

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
                    GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  419  SPRLGMVGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  470



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 76/116 (66%), Gaps = 13/116 (11%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYG-------  530
            K  + L LNYE VI++ AS   PWTDG RP   P     D +  DH      G       
Sbjct  380  KRSLDLRLNYEAVIASWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  434

Query  529  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  435  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  490



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 77/131 (59%), Gaps = 11/131 (8%)
 Frame = -3

Query  718  SGSCKE--EVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHH  545
            SG C +  E  KK+ ++LSL+Y++VISA   QG PWT G  P  D N      +      
Sbjct  252  SGECVQAKEEKKKNVLMLSLDYDQVISAWGGQGLPWTSGGPPELDINISGSPVVSKVSKR  311

Query  544  HHPYGSAMMMRRS---------DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  392
             +   S    R           D GREA VSRYREK++TR F+K IRYEVRKLNAE +PR
Sbjct  312  DNGRKSRKKRRVGGCLPSSVVGDGGREASVSRYREKKKTRSFTKTIRYEVRKLNAENKPR  371

Query  391  LKGRFVKRSSL  359
            +KGRFVKR+ L
Sbjct  372  MKGRFVKRTPL  382



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 73/114 (64%), Gaps = 12/114 (11%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWP-----DFMGGDHHHHHPYGSA  524
            K  + LSLNYE +I +  S   PWTDG RP    +  WP      +M G        G A
Sbjct  334  KRSLDLSLNYEAIIESWGSS--PWTDGQRPSVQLDDFWPHAHLTGWMAGGGRLG---GEA  388

Query  523  MMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             +  R     GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  AVTPRLGMGGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = -3

Query  718  SGSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWT-DGTRPHFDPNXCWP-DFMGGDHHH  545
            +G   +    ++ + L+LNYE +I +  S   PWT  G RPH   +  WP   M      
Sbjct  340  TGGADDAQFLQTSLSLTLNYEAIIQSWGSS--PWTAGGERPHVKLDDSWPHTNMWVVGGV  397

Query  544  HHPYGSAMMMRRS----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
                G  +++  +    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  398  AGHGGEDLLLGTARLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  457

Query  376  VKRSS  362
            VKR++
Sbjct  458  VKRAT  462



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 83/133 (62%), Gaps = 21/133 (16%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPH-------FDPNXCW-----PDFM  563
            +EEV KK  + L L+YE+V++A + +G  WT+G RP        FDP         PDF 
Sbjct  314  EEEVEKK--ITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFC  371

Query  562  GGDHHHHHPYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  401
              +       G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+
Sbjct  372  M-ESTEVEAVGQVPVVNFGEDRLTPQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAER  430

Query  400  RPRLKGRFVKRSS  362
            RPRLKGRFVKR++
Sbjct  431  RPRLKGRFVKRTN  443



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 83/133 (62%), Gaps = 21/133 (16%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPH-------FDPNXCW-----PDFM  563
            +EEV KK  + L L+YE+V++A + +G  WT+G RP        FDP         PDF 
Sbjct  314  EEEVEKK--ITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFC  371

Query  562  GGDHHHHHPYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  401
              +       G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+
Sbjct  372  M-ESTEVEAVGQVPVVNFGEDRLTPRGGREARVMRYREKRRTRLFSKKIRYEVRKLNAER  430

Query  400  RPRLKGRFVKRSS  362
            RPRLKGRFVKR++
Sbjct  431  RPRLKGRFVKRTN  443



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 69/107 (64%), Gaps = 8/107 (7%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX--CWPDFMGGD-----HHHHHPYGSAM  521
            ++L L+YE V+S    QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  520  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 75/120 (63%), Gaps = 12/120 (10%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY-----GSA  524
            K  + L LNYE VI    S   PWTDG RPH        D +  DH++   +     G  
Sbjct  329  KRSLDLRLNYEAVIEGWGSS--PWTDGRRPH---GGQLDDLLLHDHYYSGMWTAAAGGGR  383

Query  523  MMMRRSDEG--REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  350
                 +D+G  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +   P
Sbjct  384  AARPAADDGGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAGAAP  443



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 77/120 (64%), Gaps = 17/120 (14%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWT-DGTRPHFDPNXCWP-DFMG------GDHHHHHPY  533
            ++ + L+LNYE +I +  S   PWT  G RPH   +  WP D+           H     
Sbjct  321  QTSLSLTLNYEAIIQSWGSS--PWTGSGERPHVKLDGSWPHDYTSMWVVGGMVGHVGEEL  378

Query  532  GS---AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            G+    MM    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  379  GTPRLGMM----DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 76/119 (64%), Gaps = 15/119 (13%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDG-TRPHFDPNXCWP-DFMG--------GDHHHHH  539
            ++ + L+LNYE +I +  S   PWT G  RPH   +  WP D+          G      
Sbjct  328  QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  385

Query  538  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  386  PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  441



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGD----HHHHHPYGSAMMMRR  509
            LL LN+++V+SA + +   WTDG RP   P+       G D       +  Y     +  
Sbjct  365  LLRLNFDDVLSAWSDRSL-WTDGRRPQTVPDDSSEAVGGTDVGLVPDINTQYAQGATLAA  423

Query  508  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
             D+GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK++
Sbjct  424  GDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQT  471



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 74/125 (59%), Gaps = 19/125 (15%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNX-----------CWPDFMGG  557
            EE    +  LL LN+++V+SA + +   WTDG RP   P+              PD   G
Sbjct  376  EEAKPAAPSLLRLNFDDVLSAWSDRSL-WTDGKRPQTVPDDSSEAVGGLDLGLVPDLSKG  434

Query  556  DHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
                    G        D GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRF
Sbjct  435  CAQGQPGTGG-------DRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRF  487

Query  376  VKRSS  362
            VKR++
Sbjct  488  VKRTT  492



>ref|XP_010519197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X2 [Tarenaya 
hassleriana]
Length=448

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 81/127 (64%), Gaps = 11/127 (9%)
 Frame = -3

Query  709  CKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMG----GDHHHH  542
            C +E AKK  + L L+YE V+ A  S+  PWT G  P F P+  W D +G    G     
Sbjct  321  CADEKAKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSNFWLDCLGFVIDGSEEAT  380

Query  541  HPYGSAMMMRR-----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
               GS  M RR     SD  REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRF
Sbjct  381  PAVGS--MPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRF  438

Query  376  VKRSSLF  356
            V+R+S +
Sbjct  439  VRRTSSY  445



>gb|EMT01944.1| hypothetical protein F775_21198 [Aegilops tauschii]
Length=340

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 73/118 (62%), Gaps = 16/118 (14%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR-  512
            K  + L LNYE V+ +  S   PWTDG RP   P     D +  DH      G     R 
Sbjct  217  KRSLDLRLNYEAVMESWGS--SPWTDGRRP---PGQL-DDLLLHDHAGMWTAGGGGGGRH  270

Query  511  ---------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                     R+DE REARVSRYR+KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  271  GEAAWPPRPRTDEWREARVSRYRKKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  328



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 80/127 (63%), Gaps = 9/127 (7%)
 Frame = -3

Query  709  CKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPD-----FMGGDHHH  545
            C +E AKK  + L L+YE V+ A  S+  PWT G  P F P+  W D     F+      
Sbjct  321  CADEKAKKQSLFLRLDYEAVMIAWDSECSPWTTGRCPDFRPSNFWLDCLLQGFVIDGSEE  380

Query  544  HHPYGSAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  377
              P   +M  R+    SD  REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRF
Sbjct  381  ATPAVGSMPRRQGRGGSDGEREARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRF  440

Query  376  VKRSSLF  356
            V+R+S +
Sbjct  441  VRRTSSY  447



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 72/116 (62%), Gaps = 12/116 (10%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK ++ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---  177

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  178  IGEVPVMEEEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK R+ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---  177

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR KGRFVKR
Sbjct  178  IGEVPVMEDEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR  233



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 62/102 (61%), Gaps = 14/102 (14%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W D          C   F    +    P     +M      R
Sbjct  6    LNLNYQEVLEAWSDRGSLWADD---------CSLSFKNTSYMGEVP-----VMEEEKTRR  51

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  52   EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  93



>ref|XP_004294775.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 70/114 (61%), Gaps = 9/114 (8%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            +E  KK ++ L+LNY+EV+ A + +G  W +    H        ++MG            
Sbjct  132  DEDMKKVQLNLNLNYQEVLDAWSDRGSLWAEDCSSHSSMAASNGNYMGE---------VP  182

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            +M       REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  183  VMEEEKSIRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK ++ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNYM--  178

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             G   +M      REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  179  -GEVPVMEEDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK ++ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNYM--  178

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             G   +M      REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  179  -GEVPVMEEDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 66/109 (61%), Gaps = 12/109 (11%)
 Frame = -3

Query  688  KSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRR  509
            K+ + L+LNYEEV+ A +++G  W     P           M  +H+     G    +  
Sbjct  126  KTSLNLNLNYEEVLEAWSNRGSLWAHNHHPSLS--------MSSNHY----MGEVPNLEE  173

Query  508  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                RE  V RY+EKRR+RLFSKKIRYEVRKLNA+KRPRLKGRFVKR S
Sbjct  174  ERTRRETSVLRYKEKRRSRLFSKKIRYEVRKLNADKRPRLKGRFVKRIS  222



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 14/114 (12%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDF-MGGDHHHHHPYG  530
            +E+  + S + L+LNY++V+ A + +G  WTD             DF +     H +  G
Sbjct  143  EEDENRASSLNLNLNYQQVLDAWSDRGPLWTD-------------DFSLSSVPSHGYYMG  189

Query  529  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
               +M      REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  190  EVPVMEEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  243



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 68/112 (61%), Gaps = 12/112 (11%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            E  A   ++ L+LNY++V+ A + +G  WTD       P+            H +  G  
Sbjct  146  ENRASSLKLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPS------------HSYYMGEV  193

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             +M      REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  194  PVMEEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  245



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 71/118 (60%), Gaps = 13/118 (11%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G  +++  K+  + L+LNY++V+ A + +G  W D             D+      + + 
Sbjct  136  GFWEDDDEKRVSLNLNLNYQDVLDAWSDRGSLWAD-------------DYSISKASNGYY  182

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
             G   +M      REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  183  MGEVPVMEEERARREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 64/104 (62%), Gaps = 12/104 (12%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W          N C       + ++    G   +M      R
Sbjct  147  LNLNYQEVLDAWSDRGSLWA---------NDCSASMATSNTYYM---GEVPVMEEEKTRR  194

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  195  EASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>gb|EPS70097.1| hypothetical protein M569_04667, partial [Genlisea aurea]
Length=74

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 51/66 (77%), Gaps = 5/66 (8%)
 Frame = -3

Query  559  GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
            G+    H Y +A     +D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGR
Sbjct  14   GESASIHLYPAA-----ADGGREARVSRYREKRRMRLFSKKIRYEVRKLNAEKRPRIKGR  68

Query  379  FVKRSS  362
            FVKR  
Sbjct  69   FVKRQQ  74



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 69/115 (60%), Gaps = 17/115 (15%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY-----GSAMMM  515
            + L L+YE+V++A + +G  + DG  P   P           HH   P       +   +
Sbjct  126  LSLKLDYEDVLTAWSDRGSLYIDGDGPQVVPEL---------HHTASPVMVEVGSTGWRV  176

Query  514  RRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
              SD     REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPRLKGRFVKR  +
Sbjct  177  PESDREAGNREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 61/102 (60%), Gaps = 14/102 (14%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W D     F               +    G   +M      R
Sbjct  123  LNLNYQEVLEAWSDRGSLWADDCSLSF--------------KNTSYMGEVPVMEEEKTRR  168

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  169  EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  210



>ref|XP_008354834.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Malus domestica]
Length=235

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 13/117 (11%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK ++ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---  177

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  368
             G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLK GRFVKR
Sbjct  178  IGEVPVMEEEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKQGRFVKR  234



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 69/112 (62%), Gaps = 12/112 (11%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            E+  K+  + L+LNY+EV+ A + +G  W D          C    M  + ++    G  
Sbjct  139  EDDEKRVHLNLNLNYQEVLDAWSDRGPLWADD---------CSRSSMASNGNY---MGEV  186

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             +M      REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  187  PIMEEDRTRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  238



>ref|XP_009354286.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009341687.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
Length=235

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 71/117 (61%), Gaps = 13/117 (11%)
 Frame = -3

Query  715  GSCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHP  536
            G   ++  KK R+ L+LNY+EV+ A + +G  W D          C    M  + ++   
Sbjct  130  GFWDDDDEKKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---  177

Query  535  YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  368
             G   +M      REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR K GRFVKR
Sbjct  178  IGEVPVMEDEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKQGRFVKR  234



>ref|XP_001769217.1| predicted protein [Physcomitrella patens]
 gb|EDQ65929.1| predicted protein [Physcomitrella patens]
Length=646

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 72/122 (59%), Gaps = 20/122 (16%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXC----------WPDFM  563
            S + E  K +  LL LNYE+++SA + +   WTDG RP   P+             PDF 
Sbjct  375  SLQGEEVKPAPSLLRLNYEDIMSAWSDRSL-WTDGKRPQTVPDDSNSESTVDLGMVPDF-  432

Query  562  GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  383
             G+     P GS       D GR AR+ RYREKRRTRLFSKKIRYEVRKLNAE+RPR+K 
Sbjct  433  -GNGCQTVPGGS-------DGGRGARIMRYREKRRTRLFSKKIRYEVRKLNAERRPRMKS  484

Query  382  RF  377
            + 
Sbjct  485  QL  486



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXA-SQGCPWTDGTRPHFD-PNXCWPDFMGGDHHHHHPYGSAMM  518
            K++ M+L LNYE VI++     G PW  G RPH D P   W +F          +G  M 
Sbjct  303  KRTDMILKLNYEGVIASWVRDGGSPWYHGERPHLDDPYELWLEFPATGSRGL--FGGTMT  360

Query  517  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                 E REARVSRYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  361  AVTGGE-REARVSRYREKRRRRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTT  411



>ref|XP_008799931.1| PREDICTED: uncharacterized protein LOC103714457 [Phoenix dactylifera]
Length=268

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 66/106 (62%), Gaps = 3/106 (3%)
 Frame = -3

Query  676  LLSLNYEEVISAXASQGCPWTDGTRPHFDPN---XCWPDFMGGDHHHHHPYGSAMMMRRS  506
            LL L+YEEV++A + +G  + DG  P   P       P F+           S  M  + 
Sbjct  160  LLKLDYEEVLTAWSDRGSLYIDGEGPQIVPELHRTASPVFVEVGCTGWRVPESDRMEGKE  219

Query  505  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
               REARV RY+EKRR+R FSK+IRYEVRKLNAEKRPRLKGRFV+R
Sbjct  220  VGNREARVMRYKEKRRSRHFSKQIRYEVRKLNAEKRPRLKGRFVRR  265



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 68/110 (62%), Gaps = 13/110 (12%)
 Frame = -3

Query  691  KKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR  512
            K+  + L+LNY+EV+ A + +G    D           +   MG + ++    G   +M 
Sbjct  111  KRVSLNLNLNYQEVLDAWSDRGSLLADD----------YSLSMGSNCYYK---GEVPVME  157

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
                 REA V RYREKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  158  EDRTRREASVLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>ref|XP_009144991.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Brassica rapa]
 emb|CDY66242.1| BnaA05g36570D [Brassica napus]
Length=314

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            EE AK+  +LL LNYE VI+A   Q  P    T   ++ N    +F    +    P G  
Sbjct  205  EENAKQRNLLLRLNYENVIAAWDKQESP----TTATWNQN----EFSNTSNFQLVPPGIE  256

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                 +   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  257  EEKVSNRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGRFVRRS  309



>ref|XP_008233500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Prunus mume]
Length=241

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 12/112 (11%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            E+  K+ ++ L+LNY+EV+ A + +G  W D          C    M  + ++    G  
Sbjct  139  EDDEKRVQLNLNLNYQEVLDAWSDRGPLWADD---------CSRSSMASNGNY---MGEV  186

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             +M      REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFV+R
Sbjct  187  PIMEEERTRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVRR  238



>ref|XP_011010948.1| PREDICTED: uncharacterized protein LOC105115687 [Populus euphratica]
Length=310

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 68/111 (61%), Gaps = 8/111 (7%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEG-  497
            L L+Y+E+++A + +G  + +G  P   P+ C       D   H      +   ++ EG 
Sbjct  197  LKLDYQEILNAWSDKGPLYIEGESPQTVPDICDGSNQLMDEWGHVWRVPDLCGSKTKEGK  256

Query  496  -------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                   REA V RY+EKR+ RLF+K+IRYEVRKLNAEKRPRLKGRFVKRS
Sbjct  257  EIWKSGLREASVLRYKEKRQNRLFAKRIRYEVRKLNAEKRPRLKGRFVKRS  307



>gb|KHN40106.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=220

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 12/102 (12%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W D     F  N  +  +MG             ++      R
Sbjct  130  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  177

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  178  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  219



>ref|XP_003544900.2| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Glycine max]
Length=240

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 12/102 (12%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W D     F  N  +  +MG             ++      R
Sbjct  150  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  197

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  198  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  239



>gb|EMS51379.1| Zinc finger protein CONSTANS-LIKE 6 [Triticum urartu]
Length=254

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -3

Query  511  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
            R+DE REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  193  RTDEWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  241



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 68/115 (59%), Gaps = 17/115 (15%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY----GSAMMMR  512
            + L L+YEEV++A + +G  + DG  P   P+          +H   P     GS     
Sbjct  127  LSLKLDYEEVLTAWSDRGSLYIDGDGPQVVPDL---------YHTTSPVLVEVGSTGWTV  177

Query  511  RSDE----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
               E     REARV RY+EKRR+RLFSK+IRYEVRKLNAEKRPR KGRFV+R  +
Sbjct  178  PESELEVGNREARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRRKDV  232



>ref|XP_006574444.1| PREDICTED: uncharacterized protein LOC100803772 isoform X1 [Glycine 
max]
Length=217

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 12/102 (12%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A + +G  W D     F  N            + +  G   ++      R
Sbjct  127  LNLNYQEVLDAWSDRGSLWADDCSLSFATN------------NAYYMGEVPVLEEERARR  174

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EACVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_010927568.1| PREDICTED: uncharacterized protein LOC105049568 [Elaeis guineensis]
Length=231

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 68/118 (58%), Gaps = 23/118 (19%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDE  500
            + L L+YEEV++A + +G  + DG  P   P+             HH     ++  RS  
Sbjct  125  LSLKLDYEEVLTAWSGRGSFYIDGDGPQVVPDL------------HHTTSPVLVEVRSTG  172

Query  499  -----------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  359
                        REARV RY+EKRR+RLFSK+IRYEVRKL+AEKRPR KGRFVKR  +
Sbjct  173  WRVPESEREVGNREARVMRYKEKRRSRLFSKRIRYEVRKLDAEKRPRSKGRFVKRKDV  230



>ref|XP_009383142.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 29/123 (24%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMR----  512
            + L L+YEE+++  + +G  + DG  P   P               HP  SAM++     
Sbjct  208  LALKLDYEEILAVWSDRGPLYMDGEGPQVVPQL------------QHPCDSAMLVEVGCR  255

Query  511  -------------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  371
                         RS   REARV RY+EKRR RLF+K+IRYEVRK NAEKRPR+KGRFV+
Sbjct  256  SWKVPEQPAEGKERSGMSREARVMRYKEKRRNRLFAKRIRYEVRKFNAEKRPRVKGRFVR  315

Query  370  RSS  362
            R+ 
Sbjct  316  RND  318



>ref|XP_010264549.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Nelumbo nucifera]
Length=239

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 14/114 (12%)
 Frame = -3

Query  706  KEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGS  527
            +E+  K   + L+LNY+ V+ A + +G  W D T                   +H+  G 
Sbjct  132  EEDEEKLMSLNLNLNYQNVLDAWSDRGSLWADDTSLSM--------------VNHNFIGE  177

Query  526  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
              +M      REARV RY+EKR+ RLFSKKIRY+VRKLNAEKRPRLKGRFVKR+
Sbjct  178  VPVMEEERLRREARVLRYKEKRQNRLFSKKIRYQVRKLNAEKRPRLKGRFVKRT  231



>ref|XP_003615824.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
 gb|ACJ84105.1| unknown [Medicago truncatula]
 gb|AES98782.1| CCT motif protein [Medicago truncatula]
 gb|AFK39776.1| unknown [Medicago truncatula]
Length=217

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 64/102 (63%), Gaps = 11/102 (11%)
 Frame = -3

Query  673  LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  494
            L+LNY+EV+ A +++G  W          N C   F   ++  +   G   ++      R
Sbjct  126  LNLNYQEVLDAWSNRGSLWA---------NDCSLSFSSSNNGSYM--GEVPILEEERARR  174

Query  493  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
 ref|XP_006474272.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR66486.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
Length=442

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 13/110 (12%)
 Frame = -3

Query  694  AKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMM  515
            A    +LL L Y++V++A + +G P+ D +          PD  G D         A + 
Sbjct  325  ANSGELLLKLQYDDVLNAWSGKGSPFLDES--------LAPDGQGNDVSARL----AQID  372

Query  514  RRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
              SD G REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  373  LFSDGGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  422



>ref|XP_002894160.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70419.1| hypothetical protein ARALYDRAFT_891757 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 67/116 (58%), Gaps = 10/116 (9%)
 Frame = -3

Query  712  SCKEEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPY  533
             C E  A++  MLL LNYE VI+A   Q  P       +       P   G +       
Sbjct  216  DCYENKARQRNMLLKLNYENVIAAWDKQESPINQTEFNNTSNLQLVPPLQGIEEKR----  271

Query  532  GSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                +  RS+  REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  272  ----VSNRSE--REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGRFVRRS  321



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 77/126 (61%), Gaps = 27/126 (21%)
 Frame = -3

Query  709  CKEEVAKKSRML---LSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHH  539
            C+E +++ +  L   L LNYE+VI+A + +G PW       F P+ C  D          
Sbjct  365  CREGLSEVNLGLAPTLRLNYEDVITAWSDRGEPW-------FYPHDCTSD----------  407

Query  538  PYGSAMMMRRSDEG-------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGR  380
               + ++   + EG       REA V R++EKRR+RLFSK+IRYEVRKLNAEKRPR+KGR
Sbjct  408  ATDAGLVPDMAQEGADDCQGSREASVMRFKEKRRSRLFSKRIRYEVRKLNAEKRPRMKGR  467

Query  379  FVKRSS  362
            FVK++S
Sbjct  468  FVKKNS  473



>gb|EMS59726.1| Zinc finger protein CONSTANS-LIKE 6 [Triticum urartu]
Length=168

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = -3

Query  496  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  98   REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTA  142



>ref|XP_006393307.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 gb|ESQ30593.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=326

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            E  AK+  MLL LNYE VI+A       W     P   P     +F         P G+ 
Sbjct  217  ESNAKQMNMLLRLNYENVIAA-------WDKQESPRGAP-INETEFNNISTFQLVPPGTE  268

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                 S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  269  EKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS  321



>ref|XP_010046933.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Eucalyptus 
grandis]
 gb|KCW78650.1| hypothetical protein EUGRSUZ_C00112 [Eucalyptus grandis]
Length=397

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 64/104 (62%), Gaps = 13/104 (13%)
 Frame = -3

Query  679  MLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSAMMMRRSDE  500
            +LL LNY+EV+ A + +G P+ D +           D  G D           +   S  
Sbjct  295  LLLKLNYDEVVDAWSGKGSPFPDDS-----------DGAGNDVSAR--LAQIDLFLESGG  341

Query  499  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  368
             REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  342  LREASVQRYKEKRRTRLFSKKIRYQVRKVNADQRPRMKGRFVRR  385



>ref|XP_006393308.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 dbj|BAJ34092.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30594.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=339

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 65/113 (58%), Gaps = 8/113 (7%)
 Frame = -3

Query  703  EEVAKKSRMLLSLNYEEVISAXASQGCPWTDGTRPHFDPNXCWPDFMGGDHHHHHPYGSA  524
            E  AK+  MLL LNYE VI+A       W     P   P     +F         P G+ 
Sbjct  230  ESNAKQMNMLLRLNYENVIAA-------WDKQESPRGAP-INETEFNNISTFQLVPPGTE  281

Query  523  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  365
                 S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  282  EKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS  334



>ref|XP_004138344.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cucumis 
sativus]
Length=273

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -3

Query  508  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  362
            S+E REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  224  SNEEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425