BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014E05

Length=788
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010094777.1|  hypothetical protein L484_019987                   372   3e-122   
gb|KDO41976.1|  hypothetical protein CISIN_1g007863mg                   360   1e-120   Citrus sinensis [apfelsine]
gb|KDO41975.1|  hypothetical protein CISIN_1g007863mg                   361   7e-120   Citrus sinensis [apfelsine]
ref|XP_006440946.1|  hypothetical protein CICLE_v100194172mg            360   8e-120   
gb|KJB39318.1|  hypothetical protein B456_007G006100                    359   3e-119   Gossypium raimondii
ref|XP_002511958.1|  serine/threonine protein phosphatase 2a regu...    365   3e-119   Ricinus communis
ref|XP_010102837.1|  Serine/threonine-protein phosphatase 2A 65 k...    353   5e-119   
ref|XP_010681587.1|  PREDICTED: serine/threonine-protein phosphat...    364   5e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010263329.1|  PREDICTED: serine/threonine-protein phosphat...    363   2e-118   Nelumbo nucifera [Indian lotus]
gb|AAM94368.1|  protein phosphatase 2A regulatory A subunit             353   2e-118   Lolium perenne [perennial ryegrass]
gb|KDP20104.1|  hypothetical protein JCGZ_05873                         363   2e-118   Jatropha curcas
ref|XP_006485775.1|  PREDICTED: serine/threonine-protein phosphat...    363   2e-118   Citrus sinensis [apfelsine]
ref|XP_002276180.1|  PREDICTED: serine/threonine-protein phosphat...    362   6e-118   Vitis vinifera
ref|XP_011006221.1|  PREDICTED: serine/threonine-protein phosphat...    361   9e-118   Populus euphratica
gb|KDO41972.1|  hypothetical protein CISIN_1g007863mg                   361   1e-117   Citrus sinensis [apfelsine]
gb|EYU29958.1|  hypothetical protein MIMGU_mgv1a005777mg                357   2e-117   Erythranthe guttata [common monkey flower]
gb|KHG03474.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    360   3e-117   Gossypium arboreum [tree cotton]
gb|KJB39317.1|  hypothetical protein B456_007G006100                    360   3e-117   Gossypium raimondii
gb|KJB39313.1|  hypothetical protein B456_007G006100                    360   4e-117   Gossypium raimondii
emb|CBI15438.3|  unnamed protein product                                361   4e-117   Vitis vinifera
gb|AFY06655.1|  protein phosphatase 2A regulatory subunit               352   6e-117   Carica papaya [mamon]
emb|CDO98444.1|  unnamed protein product                                358   8e-117   Coffea canephora [robusta coffee]
ref|XP_008374745.1|  PREDICTED: serine/threonine-protein phosphat...    358   9e-117   Malus domestica [apple tree]
emb|CAA10285.1|  protein phosphatase                                    357   1e-116   Cicer arietinum [garbanzo]
ref|XP_007036502.1|  Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1     358   1e-116   Theobroma cacao [chocolate]
gb|KJB52972.1|  hypothetical protein B456_008G286100                    358   1e-116   Gossypium raimondii
gb|KDP29385.1|  hypothetical protein JCGZ_18306                         358   1e-116   Jatropha curcas
ref|XP_002876929.1|  hypothetical protein ARALYDRAFT_904748             358   1e-116   Arabidopsis lyrata subsp. lyrata
emb|CAA57528.1|  protein phosphatase 2A 65 kDa regulatory subunit       358   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189208.1|  protein phosphatase 2A subunit A2                     358   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AFW75384.1|  hypothetical protein ZEAMMB73_324274                    352   3e-116   
gb|AEQ75494.1|  serine/threonine protein phosphatase 2a regulator...    357   3e-116   Rosa multiflora [Japanese rose]
ref|XP_006395624.1|  hypothetical protein EUTSA_v10003886mg             357   3e-116   Eutrema salsugineum [saltwater cress]
ref|XP_004512939.1|  PREDICTED: serine/threonine-protein phosphat...    357   4e-116   Cicer arietinum [garbanzo]
ref|XP_006437703.1|  hypothetical protein CICLE_v10031047mg             357   6e-116   Citrus clementina [clementine]
ref|XP_007225550.1|  hypothetical protein PRUPE_ppa003299m2g            357   6e-116   Prunus persica
ref|XP_011077133.1|  PREDICTED: serine/threonine-protein phosphat...    356   7e-116   Sesamum indicum [beniseed]
ref|XP_009347000.1|  PREDICTED: serine/threonine-protein phosphat...    356   8e-116   Pyrus x bretschneideri [bai li]
ref|XP_010528048.1|  PREDICTED: serine/threonine-protein phosphat...    356   1e-115   Tarenaya hassleriana [spider flower]
gb|AFW86036.1|  hypothetical protein ZEAMMB73_179225                    350   1e-115   
ref|XP_009152111.1|  PREDICTED: serine/threonine-protein phosphat...    355   2e-115   Brassica rapa
ref|XP_008243199.1|  PREDICTED: serine/threonine-protein phosphat...    355   3e-115   Prunus mume [ume]
ref|XP_006484434.1|  PREDICTED: serine/threonine-protein phosphat...    355   3e-115   Citrus sinensis [apfelsine]
ref|XP_009621929.1|  PREDICTED: serine/threonine-protein phosphat...    355   3e-115   
ref|XP_004135105.1|  PREDICTED: serine/threonine-protein phosphat...    354   5e-115   
ref|XP_006307029.1|  hypothetical protein CARUB_v10008615mg             355   6e-115   
ref|XP_002529138.1|  serine/threonine protein phosphatase 2a regu...    354   6e-115   Ricinus communis
ref|XP_010476330.1|  PREDICTED: serine/threonine-protein phosphat...    354   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010458784.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    354   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_007210261.1|  hypothetical protein PRUPE_ppa003291mg             354   7e-115   Prunus persica
ref|XP_010495219.1|  PREDICTED: serine/threonine-protein phosphat...    353   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010476329.1|  PREDICTED: serine/threonine-protein phosphat...    353   7e-115   Camelina sativa [gold-of-pleasure]
ref|XP_007046273.1|  Phosphatase 2A subunit A2, 65,PP2AA2               353   9e-115   
ref|XP_008339694.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   
ref|XP_008361732.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   
ref|XP_009606530.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   Nicotiana tomentosiformis
ref|XP_009766514.1|  PREDICTED: serine/threonine-protein phosphat...    353   1e-114   Nicotiana sylvestris
gb|AFW75383.1|  hypothetical protein ZEAMMB73_324274                    351   2e-114   
gb|ACN41352.2|  protein phosphatase 2A regulatory subunit A             350   2e-114   Betula pendula [white birch]
emb|CDP00596.1|  unnamed protein product                                354   2e-114   Coffea canephora [robusta coffee]
ref|XP_002892742.1|  hypothetical protein ARALYDRAFT_888699             352   2e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_006583401.1|  PREDICTED: serine/threonine-protein phosphat...    352   2e-114   Glycine max [soybeans]
ref|XP_009356482.1|  PREDICTED: serine/threonine-protein phosphat...    352   2e-114   Pyrus x bretschneideri [bai li]
ref|XP_011070821.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Sesamum indicum [beniseed]
ref|XP_010458785.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Camelina sativa [gold-of-pleasure]
emb|CAA57529.1|  protein phosphatase 2A 65 kDa regulatory subunit       350   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|KEH27050.1|  serine/threonine protein phosphatase 2A regulator...    352   3e-114   Medicago truncatula
gb|AAG29594.1|AF196287_1  Ser/Thr specific protein phosphatase 2A...    352   3e-114   Medicago sativa subsp. x varia
ref|XP_004956389.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Setaria italica
ref|XP_008240282.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Prunus mume [ume]
ref|XP_004297127.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Fragaria vesca subsp. vesca
ref|XP_004300534.1|  PREDICTED: serine/threonine-protein phosphat...    352   3e-114   Fragaria vesca subsp. vesca
ref|XP_011021847.1|  PREDICTED: serine/threonine-protein phosphat...    352   4e-114   Populus euphratica
ref|XP_006417131.1|  hypothetical protein EUTSA_v10007164mg             352   5e-114   Eutrema salsugineum [saltwater cress]
gb|KJB23732.1|  hypothetical protein B456_004G112500                    352   5e-114   Gossypium raimondii
ref|XP_010495228.1|  PREDICTED: serine/threonine-protein phosphat...    352   5e-114   Camelina sativa [gold-of-pleasure]
gb|KHN20717.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    349   5e-114   Glycine soja [wild soybean]
ref|XP_009776620.1|  PREDICTED: serine/threonine-protein phosphat...    351   6e-114   Nicotiana sylvestris
ref|XP_002314877.1|  hypothetical protein POPTR_0010s13760g             351   6e-114   
ref|XP_004241625.1|  PREDICTED: serine/threonine-protein phosphat...    351   6e-114   
sp|P36875.1|2AAA_PEA  RecName: Full=Protein phosphatase PP2A regu...    345   6e-114   Pisum sativum [garden pea]
ref|XP_006354729.1|  PREDICTED: serine/threonine-protein phosphat...    351   7e-114   Solanum tuberosum [potatoes]
emb|CAA66487.1|  protein phosphatase 2A                                 351   7e-114   Nicotiana tabacum [American tobacco]
gb|AEB40165.1|  protein phosphatase 2A structural subunit               351   8e-114   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008648330.1|  PREDICTED: LOC732740 isoform X1                    351   8e-114   Zea mays [maize]
ref|XP_004497109.1|  PREDICTED: serine/threonine-protein phosphat...    351   9e-114   Cicer arietinum [garbanzo]
ref|XP_010942275.1|  PREDICTED: serine/threonine-protein phosphat...    351   9e-114   Elaeis guineensis
ref|XP_003577041.1|  PREDICTED: serine/threonine-protein phosphat...    350   1e-113   Brachypodium distachyon [annual false brome]
ref|XP_007152779.1|  hypothetical protein PHAVU_004G159000g             350   1e-113   Phaseolus vulgaris [French bean]
ref|XP_009336593.1|  PREDICTED: serine/threonine-protein phosphat...    350   2e-113   Pyrus x bretschneideri [bai li]
ref|NP_172790.2|  protein phosphatase 2A subunit A3                     350   2e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062674.1|  Os09g0249700                                       350   2e-113   
ref|XP_008350866.1|  PREDICTED: serine/threonine-protein phosphat...    350   3e-113   
ref|XP_010265183.1|  PREDICTED: serine/threonine-protein phosphat...    350   3e-113   Nelumbo nucifera [Indian lotus]
gb|AAG29593.1|AF196286_1  Ser/Thr specific protein phosphatase 2A...    349   3e-113   Medicago sativa subsp. x varia
gb|KEH44250.1|  serine/threonine protein phosphatase 2A regulator...    349   3e-113   Medicago truncatula
ref|XP_008659343.1|  PREDICTED: serine/threonine-protein phosphat...    349   4e-113   
gb|ACL54598.1|  unknown                                                 349   4e-113   Zea mays [maize]
ref|XP_007142893.1|  hypothetical protein PHAVU_007G0258001g            347   4e-113   Phaseolus vulgaris [French bean]
ref|XP_011008279.1|  PREDICTED: serine/threonine-protein phosphat...    349   5e-113   Populus euphratica
ref|XP_007142892.1|  hypothetical protein PHAVU_007G0258001g            347   7e-113   Phaseolus vulgaris [French bean]
gb|KHN32028.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    347   8e-113   Glycine soja [wild soybean]
ref|XP_010554238.1|  PREDICTED: serine/threonine-protein phosphat...    348   8e-113   Tarenaya hassleriana [spider flower]
gb|EYU40874.1|  hypothetical protein MIMGU_mgv1a003588mg                348   9e-113   Erythranthe guttata [common monkey flower]
ref|XP_008393303.1|  PREDICTED: serine/threonine-protein phosphat...    348   1e-112   
ref|XP_006660451.1|  PREDICTED: serine/threonine-protein phosphat...    348   1e-112   Oryza brachyantha
gb|KGN52064.1|  hypothetical protein Csa_5G608520                       354   1e-112   Cucumis sativus [cucumbers]
ref|XP_004238945.1|  PREDICTED: serine/threonine-protein phosphat...    348   1e-112   Solanum lycopersicum
ref|XP_010044277.1|  PREDICTED: serine/threonine-protein phosphat...    348   1e-112   Eucalyptus grandis [rose gum]
ref|XP_007153361.1|  hypothetical protein PHAVU_003G029000g             347   2e-112   Phaseolus vulgaris [French bean]
ref|XP_003577085.1|  PREDICTED: serine/threonine-protein phosphat...    347   2e-112   Brachypodium distachyon [annual false brome]
emb|CDY13586.1|  BnaA06g33370D                                          347   2e-112   Brassica napus [oilseed rape]
ref|XP_006362557.1|  PREDICTED: serine/threonine-protein phosphat...    347   3e-112   Solanum tuberosum [potatoes]
ref|XP_008797605.1|  PREDICTED: serine/threonine-protein phosphat...    347   3e-112   Phoenix dactylifera
ref|XP_003534171.1|  PREDICTED: serine/threonine-protein phosphat...    347   4e-112   Glycine max [soybeans]
ref|XP_003536691.1|  PREDICTED: serine/threonine-protein phosphat...    346   7e-112   Glycine max [soybeans]
ref|XP_010929062.1|  PREDICTED: serine/threonine-protein phosphat...    346   7e-112   Elaeis guineensis
ref|XP_010677978.1|  PREDICTED: serine/threonine-protein phosphat...    346   7e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS62738.1|  hypothetical protein M569_12049                         345   2e-111   Genlisea aurea
gb|KJB23731.1|  hypothetical protein B456_004G112500                    345   4e-111   Gossypium raimondii
gb|KJB23730.1|  hypothetical protein B456_004G112500                    343   1e-110   Gossypium raimondii
ref|XP_009396282.1|  PREDICTED: serine/threonine-protein phosphat...    343   1e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003518674.1|  PREDICTED: serine/threonine-protein phosphat...    342   2e-110   Glycine max [soybeans]
gb|KHN27183.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    342   2e-110   Glycine soja [wild soybean]
ref|XP_003555890.1|  PREDICTED: serine/threonine-protein phosphat...    342   2e-110   Glycine max [soybeans]
ref|XP_002312385.1|  hypothetical protein POPTR_0008s11730g             342   2e-110   
ref|XP_010036877.1|  PREDICTED: serine/threonine-protein phosphat...    342   3e-110   Eucalyptus grandis [rose gum]
ref|XP_009415447.1|  PREDICTED: serine/threonine-protein phosphat...    341   5e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004972370.1|  PREDICTED: serine/threonine-protein phosphat...    340   1e-109   Setaria italica
ref|XP_010237331.1|  PREDICTED: serine/threonine-protein phosphat...    340   2e-109   
ref|XP_004956390.1|  PREDICTED: serine/threonine-protein phosphat...    340   2e-109   Setaria italica
gb|KJB80118.1|  hypothetical protein B456_013G081300                    338   3e-109   Gossypium raimondii
ref|XP_006367043.1|  PREDICTED: serine/threonine-protein phosphat...    339   4e-109   Solanum tuberosum [potatoes]
ref|NP_001105839.1|  LOC732740                                          338   5e-109   Zea mays [maize]
ref|XP_002282096.2|  PREDICTED: serine/threonine-protein phosphat...    338   9e-109   Vitis vinifera
gb|KJB80117.1|  hypothetical protein B456_013G081300                    338   1e-108   Gossypium raimondii
gb|KJB80114.1|  hypothetical protein B456_013G081300                    338   1e-108   Gossypium raimondii
ref|XP_006854054.1|  hypothetical protein AMTR_s00048p00082810          338   1e-108   Amborella trichopoda
gb|KHG15336.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    337   2e-108   Gossypium arboreum [tree cotton]
emb|CBI27044.3|  unnamed protein product                                338   3e-108   Vitis vinifera
ref|XP_010237336.1|  PREDICTED: serine/threonine-protein phosphat...    337   3e-108   Brachypodium distachyon [annual false brome]
ref|XP_008659344.1|  PREDICTED: serine/threonine-protein phosphat...    337   3e-108   Zea mays [maize]
dbj|BAD94840.1|  phosphoprotein phosphatase 2A regulatory subunit A     328   3e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    346   4e-108   
ref|XP_009391301.1|  PREDICTED: serine/threonine-protein phosphat...    336   6e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010551283.1|  PREDICTED: serine/threonine-protein phosphat...    335   8e-108   Tarenaya hassleriana [spider flower]
ref|XP_006660452.1|  PREDICTED: serine/threonine-protein phosphat...    335   9e-108   Oryza brachyantha
ref|NP_001150156.1|  LOC100283785                                       335   1e-107   Zea mays [maize]
ref|XP_008783038.1|  PREDICTED: serine/threonine-protein phosphat...    335   2e-107   Phoenix dactylifera
gb|AAG09551.1|AC011810_10  Putative protein phosphotase 2a 65kd r...    333   7e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415878.1|  hypothetical protein EUTSA_v10007162mg             332   2e-106   Eutrema salsugineum [saltwater cress]
ref|XP_010477897.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_010499103.1|  PREDICTED: serine/threonine-protein phosphat...    330   2e-105   Camelina sativa [gold-of-pleasure]
gb|AFW75382.1|  hypothetical protein ZEAMMB73_324274                    330   2e-105   
ref|XP_002893420.1|  serine/threonine protein phosphatase type 2A...    329   2e-105   
ref|XP_006307078.1|  hypothetical protein CARUB_v10008664mg             329   2e-105   Capsella rubella
ref|XP_010460344.1|  PREDICTED: serine/threonine-protein phosphat...    329   2e-105   Camelina sativa [gold-of-pleasure]
ref|NP_173920.1|  serine/threonine-protein phosphatase 2A regulat...    329   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001777048.1|  predicted protein                                  329   3e-105   
emb|CDY24397.1|  BnaCnng04640D                                          323   4e-105   Brassica napus [oilseed rape]
ref|XP_004236962.1|  PREDICTED: serine/threonine-protein phosphat...    328   4e-105   Solanum lycopersicum
ref|XP_009115632.1|  PREDICTED: serine/threonine-protein phosphat...    320   1e-104   
emb|CDY42101.1|  BnaA09g28590D                                          327   2e-104   Brassica napus [oilseed rape]
emb|CDY39185.1|  BnaC09g21590D                                          322   6e-104   Brassica napus [oilseed rape]
emb|CDY36104.1|  BnaA08g19440D                                          324   2e-103   Brassica napus [oilseed rape]
ref|XP_009109883.1|  PREDICTED: serine/threonine-protein phosphat...    324   2e-103   Brassica rapa
gb|AAB60713.1|  serine/threonine protein phosphatase type 2A regu...    324   2e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50734.1|  hypothetical protein B456_008G184500                    324   2e-103   Gossypium raimondii
emb|CDY51132.1|  BnaA07g37150D                                          323   3e-103   Brassica napus [oilseed rape]
ref|XP_001775815.1|  predicted protein                                  322   2e-102   
ref|XP_009103071.1|  PREDICTED: serine/threonine-protein phosphat...    321   3e-102   Brassica rapa
emb|CAA57527.1|  65 kDa regulatory subunit of protein phosphatase 2A    321   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001769725.1|  predicted protein                                  320   9e-102   
ref|XP_002988290.1|  hypothetical protein SELMODRAFT_447252             313   5e-99    
ref|XP_002963887.1|  hypothetical protein SELMODRAFT_166330             313   5e-99    Selaginella moellendorffii
ref|XP_002973833.1|  hypothetical protein SELMODRAFT_232183             310   3e-98    
ref|XP_007036503.1|  Serine/threonine-protein phosphatase 2A 65 k...    303   3e-97    
ref|XP_006845686.1|  hypothetical protein AMTR_s00019p00236090          306   4e-96    
emb|CAN68660.1|  hypothetical protein VITISV_002162                     295   4e-92    Vitis vinifera
gb|KHG29905.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    283   2e-89    Gossypium arboreum [tree cotton]
ref|XP_006297363.1|  hypothetical protein CARUB_v10013383mg             285   8e-89    
gb|KHG29904.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    283   2e-88    Gossypium arboreum [tree cotton]
ref|XP_008659342.1|  PREDICTED: serine/threonine-protein phosphat...    281   6e-87    Zea mays [maize]
ref|XP_010319425.1|  PREDICTED: serine/threonine-protein phosphat...    271   3e-83    Solanum lycopersicum
ref|XP_006279159.1|  hypothetical protein CARUB_v100079671mg            256   8e-83    
ref|XP_009616233.1|  PREDICTED: serine/threonine-protein phosphat...    268   6e-82    Nicotiana tomentosiformis
ref|XP_009419803.1|  PREDICTED: serine/threonine-protein phosphat...    254   8e-82    
emb|CDY03849.1|  BnaC07g10740D                                          261   1e-79    
gb|ABR14732.1|  protein phosphatase                                     250   6e-79    Gossypium hirsutum [American cotton]
gb|AFB74194.1|  protein phosphatase 2A                                  247   7e-77    Halocnemum strobilaceum
gb|KJB39314.1|  hypothetical protein B456_007G006100                    251   7e-76    Gossypium raimondii
emb|CDY04181.1|  BnaA09g19590D                                          245   1e-75    
ref|NP_001030769.1|  protein phosphatase 2A subunit A2                  249   4e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764796.1|  PREDICTED: serine/threonine-protein phosphat...    250   7e-75    Nicotiana sylvestris
gb|KDO41973.1|  hypothetical protein CISIN_1g007863mg                   248   1e-74    Citrus sinensis [apfelsine]
ref|NP_001031035.1|  protein phosphatase 2A subunit A3                  245   1e-73    Arabidopsis thaliana [mouse-ear cress]
emb|CDY69424.1|  BnaAnng30450D                                          245   2e-73    Brassica napus [oilseed rape]
ref|XP_005644559.1|  ARM repeat-containing protein                      243   3e-72    Coccomyxa subellipsoidea C-169
emb|CDX84995.1|  BnaC05g20600D                                          224   2e-69    
ref|XP_002954993.1|  hypothetical protein VOLCADRAFT_83018              232   5e-68    Volvox carteri f. nagariensis
ref|XP_001697300.1|  protein phosphatase 2A regulatory subunit          232   7e-68    Chlamydomonas reinhardtii
ref|XP_004363241.1|  protein phosphatase 2A scaffold subunit            232   9e-68    Cavenderia fasciculata
gb|EFA85153.1|  protein phosphatase 2A scaffold subunit                 232   1e-67    Heterostelium album PN500
ref|XP_006376761.1|  hypothetical protein POPTR_0012s06200g             211   2e-65    
ref|XP_638954.1|  protein phosphatase 2A scaffold subunit               225   3e-65    Dictyostelium discoideum AX4
ref|XP_004358064.1|  HEAT repeat containing protein                     224   4e-65    Acanthamoeba castellanii str. Neff
dbj|GAM25934.1|  hypothetical protein SAMD00019534_091090               225   8e-65    Acytostelium subglobosum LB1
emb|CDX87453.1|  BnaA07g34200D                                          211   1e-64    
ref|XP_004671588.1|  PREDICTED: serine/threonine-protein phosphat...    214   1e-64    
gb|AAB03670.1|  phosphoprotein phosphatase A                            223   2e-64    Dictyostelium discoideum
pdb|3C5W|A  Chain A, Complex Between Pp2a-Specific Methylesterase...    213   2e-64    Homo sapiens [man]
emb|CDY70440.1|  BnaAnng33670D                                          209   3e-64    Brassica napus [oilseed rape]
dbj|GAM23034.1|  hypothetical protein SAMD00019534_062090               221   6e-64    Acytostelium subglobosum LB1
ref|XP_006746607.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-64    Leptonychotes weddellii
pdb|4LAC|A  Chain A, Crystal Structure Of Protein Phosphatase 2a ...    211   1e-63    Homo sapiens [man]
gb|KFM75065.1|  Serine/threonine-protein phosphatase 2A regulator...    214   4e-63    Stegodyphus mimosarum
ref|XP_003290313.1|  phosphoprotein phosphatase A                       219   4e-63    Dictyostelium purpureum
ref|XP_001625764.1|  predicted protein                                  219   5e-63    Nematostella vectensis
gb|ETE63053.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    218   6e-63    Ophiophagus hannah
ref|XP_007441284.1|  PREDICTED: serine/threonine-protein phosphat...    218   6e-63    Python bivittatus
gb|ACN58639.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    209   8e-63    Salmo salar
gb|KFO36119.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    218   1e-62    Fukomys damarensis [Damara mole rat]
ref|XP_005404518.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-62    
dbj|BAG52168.1|  unnamed protein product                                212   4e-62    Homo sapiens [man]
ref|XP_008969519.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-62    Pan paniscus [bonobo]
ref|XP_004316880.1|  PREDICTED: serine/threonine-protein phosphat...    212   4e-62    
ref|NP_001272048.1|  uncharacterized protein LOC101865435               212   5e-62    
ref|XP_008174129.1|  PREDICTED: serine/threonine-protein phosphat...    215   5e-62    Chrysemys picta bellii
ref|XP_008969515.1|  PREDICTED: serine/threonine-protein phosphat...    211   8e-62    Pan paniscus [bonobo]
ref|XP_002162841.2|  PREDICTED: serine/threonine-protein phosphat...    215   9e-62    Hydra vulgaris
ref|XP_005404517.1|  PREDICTED: serine/threonine-protein phosphat...    214   1e-61    
ref|XP_007173032.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-61    Balaenoptera acutorostrata scammoni
ref|XP_003225135.2|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
gb|ELT97469.1|  hypothetical protein CAPTEDRAFT_152474                  214   2e-61    Capitella teleta
ref|XP_001418916.1|  predicted protein                                  215   2e-61    Ostreococcus lucimarinus CCE9901
ref|XP_005987322.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-61    
ref|XP_006114916.1|  PREDICTED: serine/threonine-protein phosphat...    210   2e-61    
ref|NP_001171792.1|  protein phosphatase 2, regulatory subunit A,...    214   2e-61    Saccoglossus kowalevskii
ref|XP_007054025.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-61    
ref|XP_005404516.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-61    
ref|XP_006190431.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-61    
ref|XP_004273471.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-61    
ref|NP_998541.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    211   3e-61    
gb|KFH64368.1|  protein phosphatase PP2A regulatory subunit A           214   3e-61    Mortierella verticillata NRRL 6337
ref|XP_004709032.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-61    Echinops telfairi [lesser hedgehog tenrec]
dbj|BAH11499.1|  unnamed protein product                                211   3e-61    Homo sapiens [man]
ref|XP_004413638.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-61    
ref|XP_003253172.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-61    
ref|XP_004326180.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-61    
ref|XP_006868186.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-61    Chrysochloris asiatica
ref|XP_009005022.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-61    Callithrix jacchus [common marmoset]
ref|XP_004382552.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-61    
ref|XP_002682119.1|  phosphoprotein phosphatase A                       214   4e-61    Naegleria gruberi strain NEG-M
ref|XP_004689333.1|  PREDICTED: serine/threonine-protein phosphat...    209   4e-61    Condylura cristata
ref|NP_001080135.1|  protein phosphatase 2, regulatory subunit A,...    214   4e-61    Xenopus laevis [clawed frog]
ref|XP_004016060.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-61    
ref|XP_004671593.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-61    
gb|KDR23265.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    214   5e-61    Zootermopsis nevadensis
ref|NP_001171034.1|  serine/threonine-protein phosphatase 2A 65 k...    211   5e-61    Homo sapiens [man]
ref|XP_003055021.1|  protein phosphatase 2A regulatory subunit          213   5e-61    Micromonas pusilla CCMP1545
ref|XP_005334305.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-61    
ref|XP_005347390.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-61    
ref|XP_006868185.1|  PREDICTED: serine/threonine-protein phosphat...    213   6e-61    Chrysochloris asiatica
ref|XP_006034569.1|  PREDICTED: serine/threonine-protein phosphat...    213   6e-61    Alligator sinensis
ref|XP_004015455.1|  PREDICTED: serine/threonine-protein phosphat...    213   6e-61    
ref|XP_004427401.1|  PREDICTED: serine/threonine-protein phosphat...    210   7e-61    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFH64334.1|  protein phosphatase PP2A regulatory subunit A           213   8e-61    Mortierella verticillata NRRL 6337
dbj|BAG61093.1|  unnamed protein product                                212   8e-61    Homo sapiens [man]
ref|NP_989405.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    213   8e-61    Xenopus tropicalis [western clawed frog]
ref|XP_004715719.1|  PREDICTED: serine/threonine-protein phosphat...    212   8e-61    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005984733.1|  PREDICTED: serine/threonine-protein phosphat...    211   9e-61    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004381784.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-60    
ref|XP_007455955.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-60    Lipotes vexillifer [baiji]
ref|XP_004413635.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    Odobenus rosmarus divergens
gb|EFB14368.1|  hypothetical protein PANDA_009987                       213   1e-60    Ailuropoda melanoleuca
ref|XP_007955412.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    Orycteropus afer afer
dbj|BAG56980.1|  unnamed protein product                                211   1e-60    Homo sapiens [man]
ref|XP_004061384.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-60    
ref|XP_001371292.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    Monodelphis domestica
ref|XP_010829830.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    
ref|XP_006157809.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    
dbj|BAC03652.1|  unnamed protein product                                211   1e-60    
ref|XP_004286527.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-60    
ref|NP_001032554.1|  serine/threonine-protein phosphatase 2A 65 k...    212   1e-60    
ref|XP_005069580.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-60    
ref|XP_005069578.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    
ref|XP_008683000.1|  PREDICTED: serine/threonine-protein phosphat...    212   1e-60    
pdb|2PKG|A  Chain A, Structure Of A Complex Between The A Subunit...    212   1e-60    
dbj|BAE87562.1|  unnamed protein product                                212   1e-60    
ref|XP_005984732.1|  PREDICTED: serine/threonine-protein phosphat...    212   1e-60    
dbj|BAG56718.1|  unnamed protein product                                212   1e-60    
ref|XP_005689486.1|  PREDICTED: serine/threonine-protein phosphat...    213   1e-60    
pdb|3DW8|A  Chain A, Structure Of A Protein Phosphatase 2a Holoen...    212   1e-60    
ref|XP_007538017.1|  PREDICTED: serine/threonine-protein phosphat...    208   2e-60    
pdb|4I5L|A  Chain A, Structural Mechanism Of Trimeric Pp2a Holoen...    212   2e-60    
ref|XP_005165604.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
gb|AAA35531.1|  medium tumor antigen-associated 61-kD protein           212   2e-60    
ref|XP_005901601.1|  PREDICTED: serine/threonine-protein phosphat...    213   2e-60    
ref|XP_003269757.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_008845654.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_006772968.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_004415541.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|NP_001126285.1|  serine/threonine-protein phosphatase 2A 65 k...    212   2e-60    
gb|EHH59859.1|  hypothetical protein EGM_10070                          212   2e-60    
ref|NP_055040.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    212   2e-60    
pdb|3FGA|A  Chain A, Structural Basis Of Pp2a And Sgo Interaction       212   2e-60    
ref|XP_005341840.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
pdb|1B3U|A  Chain A, Crystal Structure Of Constant Regulatory Dom...    212   2e-60    
ref|XP_004381783.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|NP_058587.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    212   2e-60    
ref|XP_004016063.1|  PREDICTED: serine/threonine-protein phosphat...    213   2e-60    
ref|XP_007179922.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
dbj|BAC40565.1|  unnamed protein product                                212   2e-60    
gb|EFB14807.1|  hypothetical protein PANDA_017429                       212   2e-60    
ref|XP_004439076.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-60    
gb|AAA36399.1|  phosphatase 2A regulatory subunit                       212   2e-60    
ref|XP_004273470.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-60    
ref|XP_005616279.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
dbj|BAF83282.1|  unnamed protein product                                212   2e-60    
ref|XP_008148378.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-60    
gb|AAP36766.1|  Homo sapiens protein phosphatase 2 (formerly 2A),...    212   2e-60    
ref|XP_007173031.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_010615283.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_007905484.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_004597182.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|XP_004413634.1|  PREDICTED: serine/threonine-protein phosphat...    213   2e-60    
ref|XP_006510705.1|  PREDICTED: serine/threonine-protein phosphat...    214   2e-60    
ref|XP_005069579.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-60    
ref|NP_001080408.1|  protein phosphatase 2, regulatory subunit A,...    211   2e-60    
ref|NP_001006775.1|  platelet-derived growth factor subunit B           211   3e-60    
ref|NP_001082552.1|  serine/threonine-protein phosphatase 2A 65 k...    211   3e-60    
ref|XP_005856968.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_005901603.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004623246.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_005804169.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004413637.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004382551.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004619940.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_006093582.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004791695.1|  PREDICTED: serine/threonine-protein phosphat...    213   3e-60    
ref|XP_006151036.1|  PREDICTED: serine/threonine-protein phosphat...    213   3e-60    
ref|XP_004326179.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_003253170.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|NP_001171033.1|  serine/threonine-protein phosphatase 2A 65 k...    211   3e-60    
ref|XP_004543776.1|  PREDICTED: serine/threonine-protein phosphat...    210   3e-60    
ref|XP_010584891.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
gb|ELR52221.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    213   3e-60    
ref|XP_008148377.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_004016061.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_005347387.1|  PREDICTED: serine/threonine-protein phosphat...    211   3e-60    
ref|XP_006151040.1|  PREDICTED: serine/threonine-protein phosphat...    213   3e-60    
gb|AAH44120.1|  LOC398563 protein                                       211   3e-60    
ref|XP_005667374.1|  PREDICTED: serine/threonine-protein phosphat...    212   3e-60    
ref|XP_005347389.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_005967560.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-60    
ref|XP_006151035.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-60    
ref|XP_005901599.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-60    
ref|XP_010967202.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_003764291.1|  PREDICTED: serine/threonine-protein phosphat...    212   4e-60    
ref|XP_004016062.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-60    
ref|XP_005901602.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_003357333.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_005619845.1|  PREDICTED: serine/threonine-protein phosphat...    212   4e-60    
ref|XP_004481189.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
sp|P54613.1|2AAB_PIG  RecName: Full=Serine/threonine-protein phos...    211   4e-60    
ref|XP_005901600.1|  PREDICTED: serine/threonine-protein phosphat...    212   4e-60    
ref|XP_004273468.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_006194472.1|  PREDICTED: serine/threonine-protein phosphat...    210   4e-60    
gb|AAA59983.1|  protein phosphatase-2A regulatory subunit-beta          211   4e-60    
ref|XP_005579656.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_005619844.1|  PREDICTED: serine/threonine-protein phosphat...    213   4e-60    
ref|XP_003253169.1|  PREDICTED: serine/threonine-protein phosphat...    211   4e-60    
ref|XP_002754423.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_007491798.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_007934752.1|  PREDICTED: serine/threonine-protein phosphat...    210   5e-60    
ref|XP_008248017.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    211   5e-60    
ref|XP_004273469.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_010869843.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_006761636.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_004604739.1|  PREDICTED: serine/threonine-protein phosphat...    207   5e-60    
ref|XP_005194631.1|  PREDICTED: serine/threonine-protein phosphat...    212   5e-60    
ref|XP_010984268.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_005880804.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
emb|CAH92879.1|  hypothetical protein                                   211   5e-60    
ref|XP_005334304.1|  PREDICTED: serine/threonine-protein phosphat...    210   5e-60    
ref|XP_010380630.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
gb|AAC63525.1|  protein phosphatase 2A regulatory subunit A, beta...    211   5e-60    
ref|XP_004481188.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_006194471.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_006151037.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_007173033.1|  PREDICTED: serine/threonine-protein phosphat...    212   5e-60    
ref|XP_004326178.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_005579657.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_004016059.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|NP_002707.3|  serine/threonine-protein phosphatase 2A 65 kDa ...    211   5e-60    
ref|XP_004413636.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_004382550.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_003583134.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_003357337.1|  PREDICTED: serine/threonine-protein phosphat...    211   5e-60    
ref|XP_004481190.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_009005020.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_004543775.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_004439075.1|  PREDICTED: serine/threonine-protein phosphat...    212   6e-60    
ref|XP_007934750.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_008259779.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_005347388.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_010861232.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
ref|XP_005347385.1|  PREDICTED: serine/threonine-protein phosphat...    212   6e-60    
ref|XP_004326177.1|  PREDICTED: serine/threonine-protein phosphat...    211   6e-60    
emb|CAG29336.1|  PPP2R1A                                                211   6e-60    
ref|XP_010821052.1|  PREDICTED: serine/threonine-protein phosphat...    212   6e-60    
ref|NP_082890.2|  serine/threonine-protein phosphatase 2A 65 kDa ...    211   7e-60    
ref|XP_008538780.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    212   7e-60    
ref|XP_010380631.1|  PREDICTED: serine/threonine-protein phosphat...    211   7e-60    
gb|AAH56218.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    211   7e-60    
ref|XP_004382549.1|  PREDICTED: serine/threonine-protein phosphat...    211   7e-60    
ref|NP_001020589.1|  serine/threonine-protein phosphatase 2A 65 k...    211   7e-60    
ref|XP_005334303.1|  PREDICTED: serine/threonine-protein phosphat...    211   7e-60    
ref|XP_862393.2|  PREDICTED: serine/threonine-protein phosphatase...    211   7e-60    
ref|XP_005692958.1|  PREDICTED: serine/threonine-protein phosphat...    211   7e-60    
ref|NP_859051.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    211   7e-60    
gb|EPQ16739.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    217   7e-60    
gb|EGW03807.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    211   8e-60    
ref|XP_007934749.1|  PREDICTED: serine/threonine-protein phosphat...    211   8e-60    
ref|XP_004585107.1|  PREDICTED: serine/threonine-protein phosphat...    209   8e-60    
ref|XP_001496310.2|  PREDICTED: serine/threonine-protein phosphat...    211   8e-60    
ref|XP_002613476.1|  hypothetical protein BRAFLDRAFT_119854             210   8e-60    
ref|XP_010793348.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_008307967.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_006151038.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_006151039.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_003478333.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_005334302.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-60    
ref|XP_004273467.1|  PREDICTED: serine/threonine-protein phosphat...    211   9e-60    
ref|XP_006833878.1|  PREDICTED: serine/threonine-protein phosphat...    209   9e-60    
ref|XP_008831023.1|  PREDICTED: serine/threonine-protein phosphat...    210   9e-60    
ref|XP_008259769.1|  PREDICTED: serine/threonine-protein phosphat...    211   9e-60    
ref|XP_005347386.1|  PREDICTED: serine/threonine-protein phosphat...    211   9e-60    
ref|XP_005579658.1|  PREDICTED: serine/threonine-protein phosphat...    210   1e-59    
ref|XP_004585105.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_008259765.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_007538537.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-59    
ref|XP_004749849.1|  PREDICTED: serine/threonine-protein phosphat...    212   1e-59    
ref|XP_008688435.1|  PREDICTED: serine/threonine-protein phosphat...    212   1e-59    
ref|XP_004481186.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_010380629.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_011225641.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_005667373.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_004585106.1|  PREDICTED: serine/threonine-protein phosphat...    210   1e-59    
ref|XP_003357336.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_005702176.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-59    
ref|XP_004326176.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_009005018.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_009005019.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_006739271.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_009005023.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_004382548.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_004481187.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
ref|XP_006833877.1|  PREDICTED: serine/threonine-protein phosphat...    210   1e-59    
ref|XP_007229440.1|  PREDICTED: serine/threonine-protein phosphat...    210   1e-59    
ref|XP_003794777.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-59    
ref|XP_004075717.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-59    
gb|AAH52678.1|  Protein phosphatase 2 (formerly 2A), regulatory s...    209   1e-59    
gb|EHB03786.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    211   1e-59    
ref|XP_008285219.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-59    
gb|EDL95488.1|  protein phosphatase 2 (formerly 2A), regulatory s...    211   1e-59    
ref|XP_007934748.1|  PREDICTED: serine/threonine-protein phosphat...    211   1e-59    
dbj|BAF84964.1|  unnamed protein product                                211   2e-59    
ref|NP_859050.1|  serine/threonine-protein phosphatase 2A 65 kDa ...    211   2e-59    
ref|XP_002708504.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
ref|NP_001081031.1|  protein phosphatase 2, regulatory subunit A,...    209   2e-59    
emb|CAA56713.1|  phosphorylase phosphatase                              209   2e-59    
ref|XP_004749845.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-59    
ref|NP_001267102.1|  serine/threonine-protein phosphatase 2A 65 k...    211   2e-59    
gb|ERE77081.1|  serine/threonine-protein phosphatase 2A regulator...    211   2e-59    
ref|XP_007245296.1|  PREDICTED: serine/threonine-protein phosphat...    209   2e-59    
ref|XP_006972392.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
ref|XP_005334299.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
dbj|BAC36649.1|  unnamed protein product                                211   2e-59    
ref|XP_010380628.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
ref|XP_006972393.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
ref|XP_005334301.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
ref|XP_004749847.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-59    
dbj|BAG57867.1|  unnamed protein product                                209   2e-59    
ref|XP_005334300.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
gb|EDL25768.1|  protein phosphatase 2 (formerly 2A), regulatory s...    211   2e-59    
ref|XP_006642255.1|  PREDICTED: serine/threonine-protein phosphat...    210   2e-59    
ref|NP_001029257.1|  serine/threonine-protein phosphatase 2A 65 k...    210   2e-59    
ref|XP_004749846.1|  PREDICTED: serine/threonine-protein phosphat...    212   2e-59    
gb|EDL25767.1|  protein phosphatase 2 (formerly 2A), regulatory s...    211   2e-59    
ref|XP_005843961.1|  hypothetical protein CHLNCDRAFT_32938              209   2e-59    
ref|XP_006972396.1|  PREDICTED: serine/threonine-protein phosphat...    211   2e-59    
emb|CDQ62156.1|  unnamed protein product                                209   2e-59    
ref|NP_001273482.1|  serine/threonine-protein phosphatase 2A 65 k...    211   2e-59    
ref|XP_002808132.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    210   2e-59    
ref|XP_007538479.1|  PREDICTED: serine/threonine-protein phosphat...    209   2e-59    
ref|XP_005579655.1|  PREDICTED: serine/threonine-protein phosphat...    210   2e-59    
ref|XP_003794778.1|  PREDICTED: serine/threonine-protein phosphat...    209   2e-59    
ref|XP_009134075.1|  PREDICTED: serine/threonine-protein phosphat...    196   2e-59    
gb|EMC88826.1|  Serine/threonine-protein phosphatase 2A 65 kDa re...    207   2e-59    



>ref|XP_010094777.1| hypothetical protein L484_019987 [Morus notabilis]
 gb|EXB56942.1| hypothetical protein L484_019987 [Morus notabilis]
Length=579

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/186 (95%), Positives = 185/186 (99%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  394  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  453

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLEMIN+PHYLYRMTILHAVSLLAPV+GSEITC+KLLPV++T
Sbjct  454  RLAEEFGPDWAMQHIIPQVLEMINNPHYLYRMTILHAVSLLAPVIGSEITCSKLLPVVVT  513

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFANQALQ++D
Sbjct  514  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQALQSSD  573

Query  246  QVMMSS  229
            QVMMSS
Sbjct  574  QVMMSS  579


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  238  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  297

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  298  KFCRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  357

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  358  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  407



>gb|KDO41976.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=337

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  152  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  211

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  212  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  271

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+ D
Sbjct  272  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKD  331

Query  246  QVMMSS  229
            QVMMS 
Sbjct  332  QVMMSG  337


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V ++    
Sbjct  2    DKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVTKICRIL  61

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
             PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++  KD  
Sbjct  62   NPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLSLLKDEF  121

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  122  PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  165



>gb|KDO41975.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=412

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  227  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  286

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  287  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  346

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+ D
Sbjct  347  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKD  406

Query  246  QVMMSS  229
            QVMMS 
Sbjct  407  QVMMSG  412


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVT  130

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  131  KICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLS  190

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240



>ref|XP_006440946.1| hypothetical protein CICLE_v100194172mg, partial [Citrus clementina]
 gb|ESR54186.1| hypothetical protein CICLE_v100194172mg, partial [Citrus clementina]
Length=386

 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  201  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  260

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  261  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  320

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+ D
Sbjct  321  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKD  380

Query  246  QVMMSS  229
            QVMMS 
Sbjct  381  QVMMSG  386


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  + 
Sbjct  45   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKIT  104

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  105  KICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLS  164

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  165  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  214



>gb|KJB39318.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=411

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  227  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  286

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  287  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  346

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++ +
Sbjct  347  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALESCN  406

Query  246  QVMMS  232
            QVMMS
Sbjct  407  QVMMS  411


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  130

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  131  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  190

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240



>ref|XP_002511958.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF50627.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   365 bits (936),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+ LLPV++T
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVVGSEITCSSLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQ LIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFA QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQLLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFATQALQSSD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I   ++D+ WRVR  +   +  L   +G       L    ++ L D    +R AAA  V 
Sbjct  246  IANFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQRILPCVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010102837.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
 gb|EXB94197.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Morus notabilis]
Length=254

 Score =   353 bits (905),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  69   IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  128

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQ+I+PQVLEMIN+PHYLYRMT+L A++LLAPV+GSEITC+KLLPV+I 
Sbjct  129  RLAEEFGPDWAMQNIVPQVLEMINNPHYLYRMTVLRAIALLAPVVGSEITCSKLLPVVIN  188

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFANQALQA +
Sbjct  189  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQALQAIE  248

Query  246  QVMMSS  229
            QVMMSS
Sbjct  249  QVMMSS  254



>ref|XP_010681587.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
 ref|XP_010681588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   364 bits (935),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMMNNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSL+PIVD SVVEKTIRPCLVEL+EDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLVPIVDQSVVEKTIRPCLVELNEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 76/181 (42%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L        +  + + + +DK + +R   AN +  L
Sbjct  209  DLTQDDQDSVRLLAVEGCAALGKLLEPQDCVAHILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRILSPELAIQHILPCVKDLS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + P++      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_010263329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nelumbo nucifera]
Length=587

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLEMIN+PHYLYRMTILHA+SLLAPVMGSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEMINNPHYLYRMTILHAISLLAPVMGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRPCLVELSEDPDVDVRFFA+QALQ +D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPCLVELSEDPDVDVRFFASQALQTSD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AAM94368.1| protein phosphatase 2A regulatory A subunit [Lolium perenne]
Length=292

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  107  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIREAAANNLK  166

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+S LAPVMG+EITC KLLPV+I 
Sbjct  167  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISFLAPVMGAEITCQKLLPVVIN  226

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  227  SSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  286

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  287  QIMMSS  292


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = -3

Query  633  RDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITC  454
            R AAA  V +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T 
Sbjct  2    RRAAAGKVTKFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATI  61

Query  453  NKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
             +LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  62   EQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  120



>gb|KDP20104.1| hypothetical protein JCGZ_05873 [Jatropha curcas]
Length=587

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHAVSLLAPVMGSEITC+ LLPV++ 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAVSLLAPVMGSEITCSTLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSL+PIVD SV+EKTIRPCLVELSEDPDVDVRFFA QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLVPIVDQSVMEKTIRPCLVELSEDPDVDVRFFATQALQSSD  581

Query  246  QVMMSS  229
            QVMMS+
Sbjct  582  QVMMST  587


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQRILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006485775.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Citrus sinensis]
Length=587

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002276180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
 ref|XP_010663586.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Vitis vinifera]
Length=587

 Score =   362 bits (928),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+MIN+PHYLYRMTILHA+SLLAPVMG EITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLDMINNPHYLYRMTILHAISLLAPVMGPEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSL PIVD SVV+KTIRPCLVELSEDPDVDVRFFA+QALQA+D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLTPIVDQSVVDKTIRPCLVELSEDPDVDVRFFASQALQASD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011006221.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   361 bits (927),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL++IN+PHYLYRMTILHAVSLL+PVMGSEITC++LLP++I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDLINNPHYLYRMTILHAVSLLSPVMGSEITCSQLLPIVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALQSSD  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V ++  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KDO41972.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=587

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK+IRPCLVELSEDPDVDVRFFA QALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKSIRPCLVELSEDPDVDVRFFATQALQSKD  581

Query  246  QVMMSS  229
            QVMMS 
Sbjct  582  QVMMSG  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|EYU29958.1| hypothetical protein MIMGU_mgv1a005777mg [Erythranthe guttata]
Length=471

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  286  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  345

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI+T
Sbjct  346  RLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAISLLAPVMGSEITCSKLLPVIVT  405

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVELSEDPDVDVRFFAN+ALQ+ D
Sbjct  406  ASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANEALQSID  465

Query  246  QVMMSS  229
             VMMSS
Sbjct  466  NVMMSS  471


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  130  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  189

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  190  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  249

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  250  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  299



>gb|KHG03474.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=586

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++ +
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALESCN  581

Query  246  QVMMS  232
            QVMMS
Sbjct  582  QVMMS  586


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB39317.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=584

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  400  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  460  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++ +
Sbjct  520  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALESCN  579

Query  246  QVMMS  232
            QVMMS
Sbjct  580  QVMMS  584


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 82/163 (50%), Gaps = 0/163 (0%)
 Frame = -3

Query  765  RHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEFG  586
            + WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V +      
Sbjct  251  QSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGKVTKFCRILN  310

Query  585  PEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRVP  406
            PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++  KD  P
Sbjct  311  PELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLSLLKDEFP  370

Query  405  NIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  371  DVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>gb|KJB39313.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=586

 Score =   360 bits (923),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/185 (92%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL++ +
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALESCN  581

Query  246  QVMMS  232
            QVMMS
Sbjct  582  QVMMS  586


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CBI15438.3| unnamed protein product [Vitis vinifera]
Length=642

 Score =   361 bits (927),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 182/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  457  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  516

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+MIN+PHYLYRMTILHA+SLLAPVMG EITC+KLLPV+I 
Sbjct  517  RLAEEFGPDWAMQHIIPQVLDMINNPHYLYRMTILHAISLLAPVMGPEITCSKLLPVVIN  576

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSL PIVD SVV+KTIRPCLVELSEDPDVDVRFFA+QALQA+D
Sbjct  577  AAKDRVPNIKFNVAKVLQSLTPIVDQSVVDKTIRPCLVELSEDPDVDVRFFASQALQASD  636

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  637  QIMMSS  642


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  301  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  360

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  361  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLS  420

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  421  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  470



>gb|AFY06655.1| protein phosphatase 2A regulatory subunit, partial [Carica papaya]
Length=367

 Score =   352 bits (902),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  182  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  241

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAM HIIPQVLEM  +PHYLYRMTIL A+SLLAPVMG EITC KLLPV+I+
Sbjct  242  RLAEEFGPEWAMHHIIPQVLEMTTNPHYLYRMTILRAISLLAPVMGLEITCCKLLPVVIS  301

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSL+PIVD SVVEKTIRPCLVELSEDPDVDVRFFANQA QA D
Sbjct  302  ASKDRVPNIKFNVAKVLQSLVPIVDQSVVEKTIRPCLVELSEDPDVDVRFFANQAFQAID  361

Query  246  QVMMSS  229
             +MMSS
Sbjct  362  HMMMSS  367


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  26   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  85

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  86   KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  145

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  146  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  195



>emb|CDO98444.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   358 bits (920),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKV+SIRDAAA NVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVFSIRDAAATNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPVMGSE+TC+KLLPVI+ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVMGSEVTCSKLLPVIVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             +KDRVPNIKFNVAKVLQSL+PIVD  VVEKTIRPCLVELSEDPDVDVR+FANQ LQA +
Sbjct  522  TAKDRVPNIKFNVAKVLQSLVPIVDQPVVEKTIRPCLVELSEDPDVDVRYFANQGLQAIE  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QH++P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAVQHVLPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008374745.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   358 bits (920),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRPCLVELSEDPDVDVR FA+QALQ+++
Sbjct  522  ASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIRPCLVELSEDPDVDVRSFASQALQSSE  581

Query  246  QVMMSS  229
            QVMM+S
Sbjct  582  QVMMTS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQQILPFVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA10285.1| protein phosphatase [Cicer arietinum]
Length=538

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  353  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  412

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT + LLP+++ 
Sbjct  413  RLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSSNLLPLVVN  472

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  473  AAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQSSD  532

Query  246  QVMMSS  229
            QV MSS
Sbjct  533  QVKMSS  538


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  197  IVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRAELVPAYVRLLRDNEAEVRIAAAGKVT  256

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  257  KFSRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  316

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  317  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  366



>ref|XP_007036502.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
 gb|EOY21003.1| Phosphatase 2A subunit A2, 65,PP2AA2 isoform 1 [Theobroma cacao]
Length=587

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMG EI C+ LLP++I 
Sbjct  462  RLAEEFGPQWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGPEIICSNLLPLVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QAL+++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFAGQALESSD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB52972.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52973.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
 gb|KJB52974.1| hypothetical protein B456_008G286100 [Gossypium raimondii]
Length=588

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHAVSLLAPVMG +ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAVSLLAPVMGKDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVR+FA QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRYFATQALQSSD  581

Query  246  QVMMSS  229
            Q MM S
Sbjct  582  QQMMMS  587


 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +       E A+Q+I+P V E+  D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILNSELAIQNILPCVKELSTDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KDP29385.1| hypothetical protein JCGZ_18306 [Jatropha curcas]
Length=587

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQ LEMIN+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIVPQALEMINNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPALVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002876929.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53188.1| hypothetical protein ARALYDRAFT_904748 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA57528.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=587

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPEIAIQDILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_189208.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 sp|Q38950.2|2AAB_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A beta isoform; Short=AtA beta; Short=PP2A, 
subunit A, beta isoform [Arabidopsis thaliana]
 dbj|BAA95767.1| protein phosphotase 2a 65kd regulatory subunit [Arabidopsis thaliana]
 gb|AAO00848.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
 gb|AAP37715.1| At3g25800 [Arabidopsis thaliana]
 gb|AEE77069.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=587

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW75384.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=412

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  227  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  286

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  287  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  346

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  347  SSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  406

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  407  QMMVSS  412


 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  130

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  131  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  190

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  240



>gb|AEQ75494.1| serine/threonine protein phosphatase 2a regulatory subunit A 
[Rosa multiflora]
Length=587

 Score =   357 bits (917),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMIDNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVELSEDPDVDVRFFA QALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPTLVELSEDPDVDVRFFATQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006395624.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
 gb|ESQ32910.1| hypothetical protein EUTSA_v10003886mg [Eutrema salsugineum]
Length=587

 Score =   357 bits (916),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPGLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004512939.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cicer arietinum]
Length=587

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT + LLP+++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSSNLLPLVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQSSD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRAELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006437703.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 ref|XP_006437704.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50943.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
 gb|ESR50944.1| hypothetical protein CICLE_v10031047mg [Citrus clementina]
Length=587

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD S+VEKTIRPCLVEL+EDPDVDVRFFA QA+Q+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007225550.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 ref|XP_007225551.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26749.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
 gb|EMJ26750.1| hypothetical protein PRUPE_ppa003299m2g [Prunus persica]
Length=587

 Score =   357 bits (915),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/186 (92%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTIL AV LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMIDNPHYLYRMTILRAVCLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011077133.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Sesamum indicum]
Length=587

 Score =   356 bits (914),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+M+ +PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI+T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLDMVTNPHYLYRMTVLQAISLLAPVMGSEITCSKLLPVIVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009347000.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 183/186 (98%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV++T
Sbjct  462  RLAEEFGPDWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRPCLVELSEDPDVDVR FA+QALQ+++
Sbjct  522  ASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIRPCLVELSEDPDVDVRSFASQALQSSE  581

Query  246  QVMMSS  229
            QVMM+S
Sbjct  582  QVMMTS  587


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V ++  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQQILPFVKDLSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010528048.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528049.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528050.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
 ref|XP_010528051.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Tarenaya hassleriana]
Length=587

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+P VLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIVPLVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD S VEKT+RPCLVELSEDPDVDVRF+ANQA+Q+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSAVEKTVRPCLVELSEDPDVDVRFYANQAIQSVD  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRIDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW86036.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=412

 Score =   350 bits (898),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  227  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  286

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  287  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  346

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVL+SL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  347  SSKDRVPNIKFNVAKVLKSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  406

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  407  QMMVSS  412


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  130

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  131  KFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIFLS  190

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  240



>ref|XP_009152111.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Brassica rapa]
Length=587

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFAN+ALQ+ D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFANEALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008243199.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Prunus mume]
Length=587

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/186 (92%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTIL AV LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMIDNPHYLYRMTILRAVCLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             SKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  VSKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006484434.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Citrus sinensis]
 ref|XP_006484435.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Citrus sinensis]
Length=587

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  462  RLAEEFGPEWAMQHITPQVLEMINNPHYLYRMTILRAISLLAPVMGSEITCSRLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD S+VEKTIRPCLVEL+EDPDVDVRFFA QA+Q+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSMVEKTIRPCLVELTEDPDVDVRFFATQAIQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPLLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009621929.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009621930.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=581

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP WAM+HI+PQVL+MINDPHYLYRMTILHA+SLLAPVMGSEITC+KLLPVIIT
Sbjct  462  RLAEEFGPTWAMEHIVPQVLDMINDPHYLYRMTILHAISLLAPVMGSEITCSKLLPVIIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  250
            ASKDRVPNIKFNVAKVLQSLIPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA 
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVEQSVVETTIRPCLVELSEDPDVDVRFFANQALQAT  580


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFAQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004135105.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cucumis sativus]
 ref|XP_004159301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Cucumis sativus]
 ref|XP_008446576.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Cucumis melo]
Length=587

 Score =   354 bits (909),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L AVSLLAPVMGSEITC KLLPV+I+
Sbjct  462  RLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAVSLLAPVMGSEITCTKLLPVVIS  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLIPIVD  VVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLIPIVDQPVVEKTIRPSLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006307029.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
 gb|EOA39927.1| hypothetical protein CARUB_v10008615mg [Capsella rubella]
Length=610

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  425  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  484

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  485  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  544

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  545  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVESMIRPCLVELSEDPDVDVRFFANQALQSID  604

Query  246  QVMMSS  229
             VMMSS
Sbjct  605  TVMMSS  610


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  269  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  328

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  329  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  388

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  389  LLKDEFPDVRLNIISKLDEVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  438



>ref|XP_002529138.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
 gb|EEF33251.1| serine/threonine protein phosphatase 2a regulatory subunit A, 
putative [Ricinus communis]
Length=587

 Score =   354 bits (908),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAM+HIIPQVLEM+ +PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+ T
Sbjct  462  RLAEEFGPEWAMRHIIPQVLEMVTNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVAT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI IVD SVVEKTIRPCL ELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPCLAELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010476330.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   354 bits (908),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010458784.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
2A 65 kDa regulatory subunit A gamma isoform-like [Camelina 
sativa]
Length=587

 Score =   354 bits (908),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q ++P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQRVLPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007210261.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
 gb|EMJ11460.1| hypothetical protein PRUPE_ppa003291mg [Prunus persica]
Length=587

 Score =   354 bits (908),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEK IRPCLVELSEDPDVDVR FA+QALQ+ +
Sbjct  522  ASKDRVPNIKFNVAKVLQSVIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFASQALQSIE  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELATQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010495219.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   353 bits (907),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KVCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010476329.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   353 bits (907),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007046273.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
 gb|EOY02105.1| Phosphatase 2A subunit A2, 65,PP2AA2 [Theobroma cacao]
Length=587

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQW++DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWMQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEM+N+ HYLYRMTIL A+SLLAP+M SEITC+KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMVNNSHYLYRMTILRAISLLAPIMESEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVR+FANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRYFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008339694.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLI IVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008361732.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLI IVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLISIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009606530.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
 ref|XP_009606531.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana tomentosiformis]
Length=587

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+ D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQSID  581

Query  246  QVMMSS  229
             VMMS 
Sbjct  582  NVMMSG  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009766514.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Nicotiana sylvestris]
Length=587

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+ D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQSID  581

Query  246  QVMMSS  229
             VMMS 
Sbjct  582  NVMMSG  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AFW75383.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=521

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  336  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  395

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  396  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  455

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  456  SSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  515

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  516  QMMVSS  521


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  180  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  239

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  240  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  299

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  300  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349



>gb|ACN41352.2| protein phosphatase 2A regulatory subunit A [Betula pendula]
Length=511

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  326  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNLK  385

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEM+N+ HYLYRMTIL A+SLLAPVMGSEIT + LLPV+I 
Sbjct  386  RLAEEFGPEWAMQHIIPQVLEMVNNQHYLYRMTILRAISLLAPVMGSEITNSNLLPVVIN  445

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFN AKV QSLIPIVDHSVVEKTIRPCLVEL EDPDVDVRFFANQAL++ D
Sbjct  446  ASKDRVPNIKFNEAKVFQSLIPIVDHSVVEKTIRPCLVELGEDPDVDVRFFANQALESID  505

Query  246  QVMMSS  229
             VMMSS
Sbjct  506  HVMMSS  511


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  170  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  229

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  230  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  289

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  290  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  339



>emb|CDP00596.1| unnamed protein product [Coffea canephora]
Length=634

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  449  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  508

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M N+PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV++T
Sbjct  509  RLAEEFGPEWAMQHIIPQVLDMTNNPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVVT  568

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI IVD SVVEKTIRPCLVEL+EDPDVDVR++ANQALQ+ D
Sbjct  569  ASKDRVPNIKFNVAKVLQSLIHIVDQSVVEKTIRPCLVELAEDPDVDVRYYANQALQSID  628

Query  246  QVMMSS  229
             VMMSS
Sbjct  629  SVMMSS  634


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  293  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  353  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  413  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  462



>ref|XP_002892742.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69001.1| hypothetical protein ARALYDRAFT_888699 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  V 
Sbjct  246  IVTFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006583401.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006583402.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
Length=587

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNIK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQSSD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009356482.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Pyrus x bretschneideri]
Length=587

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLI +VD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLISLVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEHTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011070821.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Sesamum indicum]
Length=587

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+M+N+PHYLYRMT+L A+SLLAPVMG+EITC+ LLPVI+T
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMVNNPHYLYRMTVLRAISLLAPVMGAEITCSNLLPVIVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTIRP LVEL+EDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSMIPIVDQSVVEKTIRPTLVELTEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010458785.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
 ref|XP_010458786.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAE+FGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEDFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +       E A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNLELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA57529.1| protein phosphatase 2A 65 kDa regulatory subunit [Arabidopsis 
thaliana]
Length=508

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  323  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANNLK  382

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  383  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  442

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQALQ+ D
Sbjct  443  ASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQALQSID  502

Query  246  QVMMSS  229
             VMMSS
Sbjct  503  NVMMSS  508


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  V 
Sbjct  167  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLRDNEAEVRIAAAGKVT  226

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  227  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  286

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  287  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  336



>gb|KEH27050.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA N+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAATNIK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M+NDPHYLYRMTILHA+SLLAPV+GSEIT   LLP+++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMVNDPHYLYRMTILHAISLLAPVLGSEITTTNLLPLVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TI+PCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIKPCLVELSEDPDVDVRFFASQALQSSD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AAG29594.1|AF196287_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
beta isoform [Medicago sativa subsp. x varia]
Length=587

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA N+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAATNIK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M+NDPHYLYRMTILHA+SLLAPV+GSEIT   LLP+++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMVNDPHYLYRMTILHAISLLAPVLGSEITTTNLLPLVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVE TI+PCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLIPIVDESVVESTIKPCLVELSEDPDVDVRFFASQALQSSD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004956389.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Setaria italica]
Length=587

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPVII 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVIIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLIPI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLIPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  582  QMMVSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008240282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Prunus mume]
Length=587

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEK IRPCLVELSEDPDVDVR FA+QA Q+ +
Sbjct  522  ASKDRVPNIKFNVAKVLQSVIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFASQAFQSIE  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004297127.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Fragaria vesca subsp. vesca]
Length=587

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL A+ LLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMIDNPHYLYRMTILRAICLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFA QALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFATQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004300534.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
 ref|XP_011465404.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Fragaria vesca subsp. vesca]
Length=586

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 177/183 (97%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPV+GSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVLGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEK IRPCLVELSEDPDVDVR FA QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKMIRPCLVELSEDPDVDVRSFATQALQSSD  581

Query  246  QVM  238
             +M
Sbjct  582  AMM  584


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILDPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_011021847.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021855.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
 ref|XP_011021865.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Populus euphratica]
Length=587

 Score =   352 bits (902),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWA+QHIIPQVLEM  +PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFN AKVLQSLIPIVD SV EKTIRPCLVELSEDPDVDVR+FANQALQ  D
Sbjct  522  ASKDRVPNIKFNAAKVLQSLIPIVDQSVAEKTIRPCLVELSEDPDVDVRYFANQALQTID  581

Query  246  QVMMSS  229
             VMMS+
Sbjct  582  SVMMST  587


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006417131.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 ref|XP_006417132.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35484.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
 gb|ESQ35485.1| hypothetical protein EUTSA_v10007164mg [Eutrema salsugineum]
Length=587

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLE+I++PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLELIDNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIP VD SVVEK IRPCL+ELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPTVDQSVVEKMIRPCLMELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             V+MSS
Sbjct  582  NVIMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I + ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IGKFSQDKSWRVRYMVANQLYELCEAVGPEPSRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRIVNPELAIQHILPCVKELSSDSSQHVRSALASIIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB23732.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23734.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
 gb|KJB23735.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=586

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/185 (90%), Positives = 181/185 (98%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI IVD SVVEK IRPCLVELSEDPDVDVRFFA+QAL++++
Sbjct  522  ASKDRVPNIKFNVAKVLQSLILIVDQSVVEKKIRPCLVELSEDPDVDVRFFASQALESSN  581

Query  246  QVMMS  232
            QVMMS
Sbjct  582  QVMMS  586


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010495228.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Camelina sativa]
Length=587

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC++LLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSRLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQSVVENMIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             +MMSS
Sbjct  582  NLMMSS  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHN20717.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=521

 Score =   349 bits (896),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  336  IVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANNIK  395

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++I 
Sbjct  396  RLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLVIN  455

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  456  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQSSD  515

Query  246  QVMMSS  229
            QV MSS
Sbjct  516  QVKMSS  521


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R A A  V 
Sbjct  180  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAVAGKVT  239

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  240  KFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  299

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  300  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349



>ref|XP_009776620.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
 ref|XP_009776621.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=581

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLA VMGSEITC+KLLPVIIT
Sbjct  462  RLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAHVMGSEITCSKLLPVIIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  250
            ASKDRVPNIKFNVAKVLQSLIPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA 
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVEQSVVETTIRPCLVELSEDPDVDVRFFANQALQAT  580


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFAQDKSWRVRYMVANQLYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002314877.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 ref|XP_006378496.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
 gb|ABK94060.1| unknown [Populus trichocarpa]
 gb|EEF01048.1| hypothetical protein POPTR_0010s13760g [Populus trichocarpa]
 gb|ERP56293.1| Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Populus trichocarpa]
Length=587

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAM+HIIPQVLEM  +PHYLYRMTI+ AVSLLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRV NIKFNVAKVLQSLIPIVD SV EKTIRPCLVELSEDPDVDVRFFANQALQ  D
Sbjct  522  ASKDRVSNIKFNVAKVLQSLIPIVDQSVAEKTIRPCLVELSEDPDVDVRFFANQALQTID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  SVMMSS  587


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPEHAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004241625.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum lycopersicum]
Length=581

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEI C+KLLPVIIT
Sbjct  462  RLAEEFGPKWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEIACSKLLPVIIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  250
            ASKDRVPNIKFNVAKVLQS+IPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA 
Sbjct  522  ASKDRVPNIKFNVAKVLQSVIPIVEQSVVESTIRPCLVELSEDPDVDVRFFANQALQAT  580


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  A+D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFAQDKSWRVRYMVANQLYDLCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>sp|P36875.1|2AAA_PEA RecName: Full=Protein phosphatase PP2A regulatory subunit A; 
AltName: Full=PR65, partial [Pisum sativum]
 emb|CAA81107.1| phosphoprotein phosphatase 2A 65kDa regulatory subunit [Pisum 
sativum]
Length=395

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 177/187 (95%), Gaps = 1/187 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGAL MQWLKDK YSIR+AAANNVK
Sbjct  209  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALIMQWLKDKEYSIRNAAANNVK  268

Query  606  RLA-EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVII  430
            RLA EEFGPEWAMQHIIPQVL+MINDPHYLYRMTILHA+SLLAPV+GSEIT   LLP+++
Sbjct  269  RLAAEEFGPEWAMQHIIPQVLDMINDPHYLYRMTILHAISLLAPVLGSEITSTNLLPLVV  328

Query  429  TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  250
             ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ++
Sbjct  329  NASKDRVPNIKFNVAKVLQSLIPIVDESVVESTIRPCLVELSEDPDVDVRFFASQALQSS  388

Query  249  DQVMMSS  229
            DQV MSS
Sbjct  389  DQVKMSS  395


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D V  +R AAA  V 
Sbjct  53   IVNFSQDKSWRVRYMVANQLYELCEAVGPDSTKTELVPAYVRLLRDNVAEVRIAAAGKVS  112

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  113  KFSRILSPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  172

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  173  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  222



>ref|XP_006354729.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=581

 Score =   351 bits (900),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP WAM+HIIPQVL+MINDPHYLYRMTILHA+SLLAPVMGSEITC+KLLPVII 
Sbjct  462  RLAEEFGPTWAMEHIIPQVLDMINDPHYLYRMTILHAISLLAPVMGSEITCSKLLPVIIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAA  250
            ASKDRVPNIKFNVAKVLQS+IPIV+ SVVE TIRPCLVELSEDPDVDVRFFANQALQA 
Sbjct  522  ASKDRVPNIKFNVAKVLQSVIPIVEQSVVENTIRPCLVELSEDPDVDVRFFANQALQAT  580


 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  A+D+ WRVR  +   +  L   +G       L    +Q L+D    +R AAA  V 
Sbjct  246  IVNFAQDKSWRVRYMVANQLYELCEAVGPEGTRTDLVPAYVQLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CAA66487.1| protein phosphatase 2A [Nicotiana tabacum]
Length=586

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  401  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  461  RLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIT  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+ D
Sbjct  521  ATKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPSLVELAEDPDVDVRFYANQALQSID  580

Query  246  QVMMSS  229
              MMS 
Sbjct  581  NAMMSG  586


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  245  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  304

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  305  KFCRILSPELAIQHILPCVKELSSDSSQYVRSALASVIMGMAPVLGKDATIEHLLPIFLS  364

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  365  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  414



>gb|AEB40165.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40166.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|AEB40167.1| protein phosphatase 2A structural subunit [Triticum aestivum]
 gb|EMT17513.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Aegilops tauschii]
Length=587

 Score =   351 bits (901),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008648330.1| PREDICTED: LOC732740 isoform X1 [Zea mays]
 gb|AFW75380.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=587

 Score =   351 bits (900),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  582  QMMVSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  306  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004497109.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004497110.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Cicer arietinum]
Length=587

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMIN+PHYLYRMTIL A+SLLAPVMG+EITC+KLLP ++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMINNPHYLYRMTILRAISLLAPVMGAEITCSKLLPAVVA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQAID  581

Query  246  QVMMSS  229
             VMM+S
Sbjct  582  YVMMAS  587


 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  306  KFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010942275.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Elaeis guineensis]
Length=587

 Score =   351 bits (900),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+ IN+PHYLYRMTILHA+SLLAPVMG++ITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDKINNPHYLYRMTILHAISLLAPVMGADITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVE TIRPCLVELSEDPDVDVR+FA+QALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVVESTIRPCLVELSEDPDVDVRYFASQALQACD  581

Query  246  QVMMSS  229
            QVMM S
Sbjct  582  QVMMPS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003577041.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=587

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGVEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPIIDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007152779.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
 gb|ESW24773.1| hypothetical protein PHAVU_004G159000g [Phaseolus vulgaris]
Length=587

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNIK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL A+SLLAPV+GSEIT +KLLP++I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQAISLLAPVLGSEITSSKLLPLVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPI+D SVVE +IRPCLVELSEDPDVDVRFFA+QALQ++D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIIDQSVVESSIRPCLVELSEDPDVDVRFFASQALQSSD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 89/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009336593.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
 ref|XP_009336594.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Pyrus x bretschneideri]
Length=587

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MI++PHYLYRMTIL A+ LLAPVMG EITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLQMIDNPHYLYRMTILRAICLLAPVMGPEITCSKLLPVLVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_172790.2| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 ref|NP_001184981.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 sp|Q38951.2|2AAG_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A gamma isoform; Short=AtA gamma; Short=PP2A, 
subunit A, gamma isoform [Arabidopsis thaliana]
 gb|AAM20611.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AAO00961.1| protein phosphatase 2A regulatory subunit, putative [Arabidopsis 
thaliana]
 gb|AEE28998.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE29000.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=587

 Score =   350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/186 (89%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  NVMMSS  587


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001062674.1| Os09g0249700 [Oryza sativa Japonica Group]
 emb|CAB51803.1| phosphatase 2A regulatory A subunit [Oryza sativa]
 emb|CAB51804.1| protein phosphatase 2A A subunit [Oryza sativa]
 dbj|BAD19910.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAD22212.1| phosphatase 2A regulatory A subunit [Oryza sativa Japonica Group]
 dbj|BAF24588.1| Os09g0249700 [Oryza sativa Japonica Group]
 gb|EAZ43900.1| hypothetical protein OsJ_28521 [Oryza sativa Japonica Group]
 dbj|BAG91590.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC84161.1| hypothetical protein OsI_30535 [Oryza sativa Indica Group]
Length=587

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQ+LIPI+D SVVEK ++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQALIPILDQSVVEKNVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 89/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G     ++L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEHSREQLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008350866.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Malus domestica]
Length=587

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/186 (90%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI PQVL+MI++PHYLYRMTIL A+ LLAPVMG EITC+KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIXPQVLQMIDNPHYLYRMTILRAICLLAPVMGPEITCSKLLPVLIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFANQALQA D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPSLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMALVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010265183.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
 ref|XP_010265184.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nelumbo nucifera]
Length=587

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/186 (89%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+W MQHIIPQVLEM N+PHYLYRMTIL+A+SLLAPVMGS+ITC+KLL V+  
Sbjct  462  RLAEEFGPDWTMQHIIPQVLEMANNPHYLYRMTILNAISLLAPVMGSDITCSKLLQVVTN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE+TIRPCLVELSEDPDVDVRFFA QALQ ++
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEQTIRPCLVELSEDPDVDVRFFARQALQTSE  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|AAG29593.1|AF196286_1 Ser/Thr specific protein phosphatase 2A A regulatory subunit 
alpha isoform [Medicago sativa subsp. x varia]
Length=585

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  400  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI +PHYLYRMTIL A+SLLAPVMGSE+TC+KLLP ++ 
Sbjct  460  RLAEEFGPEWAMQHIIPQVLEMITNPHYLYRMTILRAISLLAPVMGSEVTCSKLLPAVVA  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVEL EDPDVDVRFF+NQALQA D
Sbjct  520  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELGEDPDVDVRFFSNQALQAID  579

Query  246  QVMMSS  229
             VMMSS
Sbjct  580  HVMMSS  585


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  244  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGKVT  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LL + ++
Sbjct  304  KFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLHIFLS  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LLKDEFPDVRINIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>gb|KEH44250.1| serine/threonine protein phosphatase 2A regulatory subunit A 
[Medicago truncatula]
Length=587

 Score =   349 bits (896),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI +PHYLYRMTIL A+SLLAPVMGSE+TC+KLLP ++ 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMITNPHYLYRMTILRAISLLAPVMGSEVTCSKLLPAVVA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVEL EDPDVDVRFF+NQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELGEDPDVDVRFFSNQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRAELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  306  KFCRILSPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008659343.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Zea mays]
 gb|AFW86039.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=587

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVL+SL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLKSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  582  QMMVSS  587


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>gb|ACL54598.1| unknown [Zea mays]
Length=587

 Score =   349 bits (896),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVLSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  582  QMMVSS  587


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  306  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007142893.1| hypothetical protein PHAVU_007G0258001g [Phaseolus vulgaris]
 gb|ESW14887.1| hypothetical protein PHAVU_007G0258001g [Phaseolus vulgaris]
Length=521

 Score =   347 bits (890),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  336  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  395

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M ++PHYLYRMTIL A+SLLAPVMG EITC+ LLPV++T
Sbjct  396  RLAEEFGPEWAMQHIIPQVLDMSSNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVVVT  455

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA D
Sbjct  456  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQAID  515

Query  246  QVMMSS  229
             VMMSS
Sbjct  516  HVMMSS  521


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  180  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  239

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  240  KFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  299

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  300  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349



>ref|XP_011008279.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008287.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
 ref|XP_011008294.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Populus euphratica]
Length=587

 Score =   349 bits (895),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 167/186 (90%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAM+HIIPQVLEM  +PHYLYRMTI+ AVSLLAPVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMEHIIPQVLEMSTNPHYLYRMTIIRAVSLLAPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRV NIKFNVAKVLQSLIPIVD  V EKTIRPCLVELSEDPDVDVRFFANQALQ  D
Sbjct  522  ASKDRVSNIKFNVAKVLQSLIPIVDQPVAEKTIRPCLVELSEDPDVDVRFFANQALQTID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  SVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPEHAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007142892.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
 gb|ESW14886.1| hypothetical protein PHAVU_007G0258001g, partial [Phaseolus vulgaris]
Length=545

 Score =   347 bits (891),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  360  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  419

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M ++PHYLYRMTIL A+SLLAPVMG EITC+ LLPV++T
Sbjct  420  RLAEEFGPEWAMQHIIPQVLDMSSNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVVVT  479

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA D
Sbjct  480  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQAID  539

Query  246  QVMMSS  229
             VMMSS
Sbjct  540  HVMMSS  545


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  204  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  263

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  264  KFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  323

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  324  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  373



>gb|KHN32028.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=521

 Score =   347 bits (889),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  336  IVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANNIK  395

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL ++SLLAPV+GSEI+ +KLLP++I 
Sbjct  396  RLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQSISLLAPVLGSEISSSKLLPLVIN  455

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+ D
Sbjct  456  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQSCD  515

Query  246  QVMMSS  229
            QV MSS
Sbjct  516  QVKMSS  521


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  180  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  239

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  240  KFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  299

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  300  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  349



>ref|XP_010554238.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
 ref|XP_010554239.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Tarenaya hassleriana]
Length=586

 Score =   348 bits (894),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 179/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMTIL A+SLLAPVMGSEIT +KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTILRAISLLAPVMGSEITSSKLLPVVMT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIV+ SVVEKTIRPCLVELSEDPDVDVRFFANQALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVEQSVVEKTIRPCLVELSEDPDVDVRFFANQALQSID  581

Query  246  QVMMS  232
             +M S
Sbjct  582  NMMSS  586


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD   +++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFSDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|EYU40874.1| hypothetical protein MIMGU_mgv1a003588mg [Erythranthe guttata]
Length=576

 Score =   348 bits (893),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  391  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  450

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+M+N+PHYLYRMT+L A+SLLAPVMGSEITC+KLLPVI+T
Sbjct  451  RLAEEFGPEWAMQHIVPQVLDMVNNPHYLYRMTVLQAISLLAPVMGSEITCSKLLPVIVT  510

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVE +IRP LVELSED DVDVRFFANQALQ+ D
Sbjct  511  ASKDRVPNIKFNVAKVLQSMIPIVDQSVVETSIRPSLVELSEDADVDVRFFANQALQSID  570

Query  246  QVMMSS  229
              MMS+
Sbjct  571  HSMMST  576


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  235  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  294

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  295  KFSRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  354

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  355  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  404



>ref|XP_008393303.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Malus domestica]
Length=587

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 180/185 (97%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLG+LCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVEFFDDKLGSLCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTILHA+SLLAPV+GSE+TC++L+PVI+T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILHAISLLAPVLGSELTCSRLVPVIVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQS+IPIVD SVVEKTI PCL+ELSEDPDVDVR FA+QALQ+++
Sbjct  522  ASKDRVPNIKFNVAKVLQSIIPIVDQSVVEKTIXPCLLELSEDPDVDVRSFASQALQSSE  581

Query  246  QVMMS  232
            QVMMS
Sbjct  582  QVMMS  586


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+Q I+P V E+  D     R  +   +  +A V+G + T  +LLP+ ++
Sbjct  306  KFCRIVNPELAIQQILPFVKELSTDSSQHVRSALASVIMGMAQVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNEVIGIDMLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006660451.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQ+LIPI+D SVVEK ++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQALIPILDQSVVEKNVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L    G     + L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAAGPEHSREHLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KGN52064.1| hypothetical protein Csa_5G608520 [Cucumis sativus]
Length=796

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  611  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  670

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MIN+PHYLYRMT+L AVSLLAPVMGSEITC KLLPV+I+
Sbjct  671  RLAEEFGPEWAMQHIVPQVLDMINNPHYLYRMTVLRAVSLLAPVMGSEITCTKLLPVVIS  730

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLIPIVD  VVEKTIRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  731  SSKDRVPNIKFNVAKVLQSLIPIVDQPVVEKTIRPSLVELSEDPDVDVRFFANQALQSID  790

Query  246  QVMMSS  229
             VMMSS
Sbjct  791  HVMMSS  796


 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  455  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  514

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  515  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  574

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  575  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  624



>ref|XP_004238945.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Solanum lycopersicum]
Length=587

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL ++SLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRSISLLAPVMGSEITCSKLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSL+PIVD+SVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+ D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLVPIVDNSVVEKTIRPSLVELAEDPDVDVRFYANQALQSID  581

Query  246  QVMMSS  229
             VMMS 
Sbjct  582  NVMMSG  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010044277.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 ref|XP_010044278.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Eucalyptus grandis]
 gb|KCW86343.1| hypothetical protein EUGRSUZ_B03031 [Eucalyptus grandis]
Length=587

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQ LEMI++PHYLYRMTIL A+SLLAPV+G +ITC+KLLP ++ 
Sbjct  462  RLAEEFGPDWAMQHIIPQTLEMISNPHYLYRMTILRAISLLAPVLGPDITCSKLLPAVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSL+PIVD S VEK IRPCLVELSEDPDVDVRFFANQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLMPIVDQSTVEKMIRPCLVELSEDPDVDVRFFANQALQAID  581

Query  246  QVMMSS  229
            QVMM+S
Sbjct  582  QVMMTS  587


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE ++ HI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELSILHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_007153361.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 ref|XP_007153362.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25355.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
 gb|ESW25356.1| hypothetical protein PHAVU_003G029000g [Phaseolus vulgaris]
Length=587

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQV++MI +PHYLYRMTILH++SLLAPVMG EITC+KLLPV+IT
Sbjct  462  RLAEEFGPEWAMQHIIPQVVDMITNPHYLYRMTILHSISLLAPVMGPEITCSKLLPVVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEK+IRP LVELSEDPDVDVRFF+NQALQA D
Sbjct  522  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKSIRPSLVELSEDPDVDVRFFSNQALQAID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPSYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPDLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003577085.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Brachypodium distachyon]
Length=587

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQ+IIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLP++I 
Sbjct  462  RLAEEFGPDWAMQYIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPIVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SV EKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPIIDQSVAEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  582  QIMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY13586.1| BnaA06g33370D [Brassica napus]
Length=595

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 181/194 (93%), Gaps = 8/194 (4%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKD--------RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFA  271
            A+KD        RVPNIKFNVAKVLQSLIPIVD SVVEKTIRP LVELSEDPDVDVRFFA
Sbjct  522  AAKDRQIIFYYHRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPGLVELSEDPDVDVRFFA  581

Query  270  NQALQAADQVMMSS  229
            N+ALQ+ D VMMSS
Sbjct  582  NEALQSIDNVMMSS  595


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006362557.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=587

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+GFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+M   PHYLYRMTIL ++SLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDMTTSPHYLYRMTILRSISLLAPVMGSEITCSKLLPVVVT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPIVD+SVVEKTIRP LVEL+EDPDVDVRF+ANQALQ+ D
Sbjct  522  ATKDRVPNIKFNVAKVLQSLIPIVDNSVVEKTIRPSLVELAEDPDVDVRFYANQALQSID  581

Query  246  QVMMSS  229
              MMS 
Sbjct  582  NAMMSG  587


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008797605.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Phoenix dactylifera]
Length=587

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+ IN+PHYLYRMTILHA+SLLAPVMG++ITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDKINNPHYLYRMTILHAISLLAPVMGADITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+P +  SVVE TIRPCLVELSEDPDVDVR+FA+QALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPTLGQSVVEGTIRPCLVELSEDPDVDVRYFASQALQACD  581

Query  246  QVMMSS  229
            QVMM S
Sbjct  582  QVMMPS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003534171.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLKDKVYSIRDAAANNIK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVL+M+ DPHYLYRMTIL ++SLLAPV+GSEI+ +KLLP++I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLDMVTDPHYLYRMTILQSISLLAPVLGSEISSSKLLPLVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVE TIRPCLVELSEDPDVDVRFFA+QALQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVESTIRPCLVELSEDPDVDVRFFASQALQSCD  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVKMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + +    P+ A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSRILNPDLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003536691.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Glycine max]
 ref|XP_006589702.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Glycine max]
 gb|KHN05580.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  400  IVELAEDRHWRVRLAIIEYIPLLASQLGVSFFDDKLGALCMQWLQDKVHSIREAAANNLK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEM N+PHYLYRMTIL A+SLLAPVMG EITC+ LLPV++ 
Sbjct  460  RLAEEFGPEWAMQHIIPQVLEMNNNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVVVA  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA D
Sbjct  520  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQAID  579

Query  246  QVMMSS  229
             VMMSS
Sbjct  580  HVMMSS  585


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  244  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+  V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  304  KFCRILNPDLSIQHILSCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>ref|XP_010929062.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Elaeis guineensis]
Length=587

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL+ I++PHYLYRMTIL A+SLLAPV+G +ITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLDKISNPHYLYRMTILQAISLLAPVLGVDITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVE TIRPCL+ELSEDPDVDVR+FANQALQA+D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVVENTIRPCLIELSEDPDVDVRYFANQALQASD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +     GP+  +QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  306  KFCRILGPQLPIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010677978.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL DKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLNDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLEM  +PHYLYRMTIL A+SLL PVMG+EITC+KLLPV++ 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEMATNPHYLYRMTILQAISLLGPVMGAEITCSKLLPVVVD  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRV NIKFNVAKVLQSLIPIVD SVVEKTIRPCL+ELSEDPDVDVRFFA QAL+  D
Sbjct  522  ASKDRVANIKFNVAKVLQSLIPIVDQSVVEKTIRPCLIELSEDPDVDVRFFATQALKLTD  581

Query  246  QVMMSS  229
            Q  MSS
Sbjct  582  QAAMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCCILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDEVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|EPS62738.1| hypothetical protein M569_12049 [Genlisea aurea]
Length=587

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVL+MI++PHYLYRMT+L A+SLLAPVMG EITC+KLLPVI+ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLDMISNPHYLYRMTVLQAISLLAPVMGPEITCSKLLPVIVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQS+I IVD SVVEKTIRP LV+L+EDPDVDVRFFANQALQ+ D
Sbjct  522  SSKDRVPNIKFNVAKVLQSIITIVDQSVVEKTIRPTLVDLAEDPDVDVRFFANQALQSID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  SVMMSS  587


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB23731.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/184 (89%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI IVD SVVEK IRPCLVELSEDPDVDVRFFA+QAL++++
Sbjct  522  ASKDRVPNIKFNVAKVLQSLILIVDQSVVEKKIRPCLVELSEDPDVDVRFFASQALESSN  581

Query  246  QVMM  235
            Q  M
Sbjct  582  QKKM  585


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB23730.1| hypothetical protein B456_004G112500 [Gossypium raimondii]
Length=600

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/184 (88%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYL+RMTILH++SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLHRMTILHSISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI IVD SV+EK IRPCLVELSEDPDVDVRFFA+QAL++++
Sbjct  522  ASKDRVPNIKFNVAKVLQSLILIVDQSVMEKKIRPCLVELSEDPDVDVRFFASQALESSN  581

Query  246  QVMM  235
            Q  M
Sbjct  582  QKKM  585


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  +   +G       L    +  L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYEVCEAVGPEPTRSDLVPAYVCLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009396282.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Musa acuminata subsp. malaccensis]
Length=587

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAA N+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAATNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+P+VLE IN+PHYLYRMT+L A+SLLAPVMG++ITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIVPEVLEKINNPHYLYRMTVLRAISLLAPVMGADITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLI ++D SVV+KTIRPCLVELSEDPDVDVR+FA QALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLISVLDQSVVDKTIRPCLVELSEDPDVDVRYFAGQALQACD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRADLMPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+  D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003518674.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
Length=587

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFF DKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFYDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTILHA+SLLAPVMGSEIT ++LLP++IT
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMISNPHYLYRMTILHAISLLAPVMGSEITRSELLPIVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRP LVELSEDPDVDVRFF+NQAL A D
Sbjct  522  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPSLVELSEDPDVDVRFFSNQALHAMD  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPDLSIQHILPCVKELSTDSLQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++  +++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGINLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHN27183.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=587

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFF DKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFYDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEMI++PHYLYRMTILHA+SLLAPVMGSEIT ++LLP++IT
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEMISNPHYLYRMTILHAISLLAPVMGSEITRSELLPIVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRP LVELSEDPDVDVRFF+NQAL A D
Sbjct  522  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPSLVELSEDPDVDVRFFSNQALHAMD  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPDLSIQHILPCVKELSTDSLQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++  +++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGINLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_003555890.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Glycine max]
 gb|KHN11434.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Glycine soja]
Length=585

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  400  IVELAEDRHWRVRLAIIEYIPLLASQLGVRFFDDKLGALCMQWLQDKVHSIREAAANNLK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLEM N+PHYLYRMTIL A+SLLAPVMG EITC+ LLPV++ 
Sbjct  460  RLAEEFGPEWAMQHIIPQVLEMNNNPHYLYRMTILRAISLLAPVMGPEITCSNLLPVVLA  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+S+ PIVD SVVEKTIRPCLVELSEDPDVDVRFF+NQALQA D
Sbjct  520  ASKDRVPNIKFNVAKVLESIFPIVDQSVVEKTIRPCLVELSEDPDVDVRFFSNQALQAID  579

Query  246  QVMMS  232
             VMMS
Sbjct  580  HVMMS  584


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  244  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G E T  +LLP+ ++
Sbjct  304  KFCRILNPDLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEQLLPIFLS  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>ref|XP_002312385.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 ref|XP_002311444.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE89752.1| hypothetical protein POPTR_0008s11730g [Populus trichocarpa]
 gb|EEE88811.2| phosphatase family protein [Populus trichocarpa]
Length=586

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWA+QHIIPQVLEM  +PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+I 
Sbjct  462  RLAEEFGPEWAVQHIIPQVLEMSTNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFN AKVLQSLIPIVD SVVEKTI PCL EL EDPDVDVRFFANQALQ   
Sbjct  522  ASKDRVPNIKFNAAKVLQSLIPIVDQSVVEKTICPCLFELGEDPDVDVRFFANQALQTIA  581

Query  246  QVMMS  232
             VMMS
Sbjct  582  SVMMS  586


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRMDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010036877.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036878.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 ref|XP_010036879.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Eucalyptus grandis]
 gb|KCW48540.1| hypothetical protein EUGRSUZ_K02214 [Eucalyptus grandis]
Length=588

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 179/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWLKDKVYSIRDAAANNV+
Sbjct  403  IVELAEDRHWRVRLAIIEYIPLLASQLGVRFFDDKLGALCMQWLKDKVYSIRDAAANNVR  462

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             LAEEFGPEWAM+H++PQVL+MIN+PHYLYRMT+LH +SLLAPVMGS+ITC+KLLPV+I+
Sbjct  463  CLAEEFGPEWAMEHMVPQVLDMINNPHYLYRMTVLHVISLLAPVMGSDITCSKLLPVVIS  522

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNI+FN AKVLQS+IP+VDHSVVE+ IRPCLVEL+EDPDVDVRFF +QALQ++D
Sbjct  523  SSKDRVPNIRFNAAKVLQSIIPLVDHSVVERIIRPCLVELNEDPDVDVRFFGSQALQSSD  582

Query  246  QVMMSS  229
            QVM+ S
Sbjct  583  QVMVMS  588


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            +V  ++D+ WRVR  + + +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  247  MVNFSQDKSWRVRYMVAQELYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  306

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L     PE A+Q I+P V E+  D     R  +   +  +APV+G + T  +LLP  ++
Sbjct  307  KLCSILNPELAIQQILPCVKELSADSSQHVRSALASVIMGMAPVLGKDATIEQLLPTFLS  366

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  367  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>ref|XP_009415447.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 161/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG++ITC KLLPV+I+
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGADITCQKLLPVVIS  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             SKDRVPNIKFNVAKVLQSL+PIV  S VE TIRPCLVELSEDPDVDVR+FA QALQA D
Sbjct  522  LSKDRVPNIKFNVAKVLQSLVPIVGQSGVEATIRPCLVELSEDPDVDVRYFAGQALQACD  581

Query  246  QVMMSS  229
            QVM+S 
Sbjct  582  QVMVSG  587


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEATRIDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+QHIIP V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCQILSPELAIQHIIPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004972370.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Setaria italica]
Length=587

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 178/186 (96%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEF PEWAMQ+IIPQVLE IN+PHYLYRMT L A+SLLAPVMG++ITC +LLPV+I 
Sbjct  462  RLAEEFSPEWAMQYIIPQVLEKINNPHYLYRMTTLQAISLLAPVMGADITCQQLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPN+KFNVAKVLQSLIPI+D SVVEKT++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNMKFNVAKVLQSLIPILDQSVVEKTVKPCLVELSEDPDVDVRYYANQALQACD  581

Query  246  QVMMSS  229
            Q++MS+
Sbjct  582  QMVMST  587


 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 89/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G     D L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRDDLVQAYVRVLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCKILSPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010237331.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=583

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGVEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPIIDQS----TVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  578  QIMMSS  583


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRVDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_004956390.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Setaria italica]
Length=583

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 176/186 (95%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPVII 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVIIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSLIPI+D S    T++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLIPILDQS----TVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  578  QMMVSS  583


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB80118.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=528

 Score =   338 bits (866),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN+K
Sbjct  343  IVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANNLK  402

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV++ 
Sbjct  403  RLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVVVN  462

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+ D
Sbjct  463  ASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQSID  522

Query  246  QVMMSS  229
            QV MSS
Sbjct  523  QVTMSS  528


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/182 (25%), Positives = 80/182 (44%), Gaps = 19/182 (10%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIP-------------------QVLEMINDPHYLYRMTILHAVSLL  484
            +  +   PE A+QHI+P                    ++E+  D H+  R+ I+  + LL
Sbjct  306  KFCQILSPELAIQHILPCVKVHTVIGIDLLSQSLLPAIVELAEDRHWRVRLAIIEYIPLL  365

Query  483  APVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELS  304
            A  +G     +KL  + +   +D+V +I+   A  L+ L          + I P ++E++
Sbjct  366  ANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANNLKRLAEEFGPDWAMQHIIPQVLEIA  425

Query  303  ED  298
             D
Sbjct  426  ND  427



>ref|XP_006367043.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Solanum tuberosum]
Length=585

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAAN++K
Sbjct  400  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANSLK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVL++IN+ HYLYRMTIL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  460  RLAEEFGPEWAMQHIIPQVLDVINNSHYLYRMTILRAISLLAPVMGSEITCSKLLPVVIT  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPN+KFNVAKVLQSLIP+VD SV EKTIR  L+EL+EDPDVDVRF+A+QALQ+ D
Sbjct  520  AAKDRVPNVKFNVAKVLQSLIPVVDQSVAEKTIRSSLIELAEDPDVDVRFYASQALQSID  579

Query  246  QVMMSS  229
             VMMSS
Sbjct  580  DVMMSS  585


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA    
Sbjct  244  IVNFSQDKSWRVRYMVANQLYELCEAVGPETSRTDLVPAYVRLLRDNEAEVRIAAAGKTT  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  304  KFSQILSPELSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  364  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  413



>ref|NP_001105839.1| LOC732740 [Zea mays]
 gb|AAY24685.1| protein phosphatase 2A regulatory subunit A [Zea mays]
 gb|AFW75381.1| protein phosphatase 2A regulatory subunit A [Zea mays]
Length=583

 Score =   338 bits (868),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 176/186 (95%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQS----TVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  578  QMMVSS  583


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  306  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002282096.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
 ref|XP_010647838.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Vitis vinifera]
Length=587

 Score =   338 bits (867),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+I+
Sbjct  462  RLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVVIS  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            AS DRVPN+KFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+   D
Sbjct  522  ASNDRVPNVKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHVID  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  HVMMSS  587


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  V 
Sbjct  246  IISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  306  KFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KJB80117.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=589

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN+K
Sbjct  404  IVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANNLK  463

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV++ 
Sbjct  464  RLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVVVN  523

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+ D
Sbjct  524  ASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQSID  583

Query  246  QVMMSS  229
            QV MSS
Sbjct  584  QVTMSS  589


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 83/164 (51%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V +  +  
Sbjct  254  DKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGKVTKFCQIL  313

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
             PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LLP+ ++  KD  
Sbjct  314  SPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLPIFLSLLKDEF  373

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  374  PDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  417



>gb|KJB80114.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80115.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
 gb|KJB80116.1| hypothetical protein B456_013G081300 [Gossypium raimondii]
Length=587

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PV+GSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVLGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQSID  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVTMSS  587


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LLP+ ++
Sbjct  306  KFCQILSPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006854054.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
 gb|ERN15521.1| hypothetical protein AMTR_s00048p00082810 [Amborella trichopoda]
Length=587

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 177/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+D+V+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDQVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAM HI+PQVLEMIN+ HYL+RMTILHA++LLAPVMGS+ITC KLLPV+I 
Sbjct  462  RLAEEFGPDWAMLHIVPQVLEMINNQHYLHRMTILHAIALLAPVMGSDITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAKVLQSLIPI+D SVVE+T+RPCL +LSEDPDVDVRFF+  ALQA D
Sbjct  522  AAKDRVPNIKFNVAKVLQSLIPILDQSVVEQTVRPCLADLSEDPDVDVRFFSGLALQACD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  306  KFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIDQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG15336.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta-like protein [Gossypium arboreum]
Length=587

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 173/186 (93%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLA+QLGVGFFDDKLG LCMQWL+DKVYSIRDAAA N+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLANQLGVGFFDDKLGGLCMQWLQDKVYSIRDAAAKNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE+ ND HYL+RMT+L A+SLL PVMGSEITC+KLLPV++ 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEIANDSHYLHRMTLLRAISLLGPVMGSEITCSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLI +VD SVVEKTIRPCLVELSEDPDVDVR+FA Q LQ+ D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLISVVDQSVVEKTIRPCLVELSEDPDVDVRYFAVQGLQSID  581

Query  246  QVMMSS  229
            QV MSS
Sbjct  582  QVTMSS  587


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   LG       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEALGPEPIRTDLLPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+QHI+P V E+  D     R  +   V  +APV+G + T  +LL + ++
Sbjct  306  KFCQILSPELAIQHILPCVKELSLDSSQHVRAALASVVMGMAPVLGKDATIEQLLLIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CBI27044.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   338 bits (867),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/186 (86%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN+K
Sbjct  451  IVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANNLK  510

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+I+
Sbjct  511  RLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVVIS  570

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            AS DRVPN+KFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+   D
Sbjct  571  ASNDRVPNVKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHVID  630

Query  246  QVMMSS  229
             VMMSS
Sbjct  631  HVMMSS  636


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  V 
Sbjct  295  IISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGKVT  354

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  355  KFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIFLS  414

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  415  LLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  464



>ref|XP_010237336.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Brachypodium distachyon]
Length=583

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 176/186 (95%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQ+IIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLP++I 
Sbjct  462  RLAEEFGPDWAMQYIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPIVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPIIDQS----TVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  578  QIMMSS  583


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_008659344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X3 [Zea mays]
 gb|AFW86038.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=583

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 176/186 (95%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVL+SL+PI+D S    T++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLKSLVPILDQS----TVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+M+SS
Sbjct  578  QMMVSS  583


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>dbj|BAD94840.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
Length=324

 Score =   328 bits (840),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  138  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  197

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  198  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  257

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  258  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  317


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 70/130 (54%), Gaps = 0/130 (0%)
 Frame = -3

Query  666  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  487
            ++ L+D    +R AAA  V +      PE A+QHI+P V E+ +D     R  +   +  
Sbjct  22   VRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMG  81

Query  486  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  307
            +AP++G + T   LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL
Sbjct  82   MAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVEL  141

Query  306  SEDPDVDVRF  277
            +ED    VR 
Sbjct  142  AEDRHWRVRL  151



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score =   346 bits (888),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/186 (88%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG+LCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGSLCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             LAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SL+APVMG++ITC KLLPV+I 
Sbjct  462  LLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLIAPVMGADITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             SKDRVPNIKFNVAKVLQ LIPIVD SVVEKTIRPCLVEL EDPDVDVR+FA QALQA D
Sbjct  522  FSKDRVPNIKFNVAKVLQLLIPIVDQSVVEKTIRPCLVELGEDPDVDVRYFAGQALQACD  581

Query  246  QVMMSS  229
            QVMMSS
Sbjct  582  QVMMSS  587


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +      L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQFYELCEAVGPEATRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V ++ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCHISSPQLAVQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009391301.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
 ref|XP_009391302.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=587

 Score =   336 bits (861),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQ GVGFF+DKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQFGVGFFNDKLGALCMQWLEDKVFSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQ+I+PQ+LE I++PHYL+RMTIL ++SLLAPV+GSE TC KLLPVIIT
Sbjct  462  RLAEEFGPEWAMQNIVPQLLEKISNPHYLHRMTILQSISLLAPVLGSESTCQKLLPVIIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVLQSLIPI DHSVVE+ +RPCLVELSEDPDVDVR+FA+QA+Q  D
Sbjct  522  ASKDRVPNIKFNVAKVLQSLIPIFDHSVVEQAVRPCLVELSEDPDVDVRYFASQAIQTCD  581

Query  246  QVMMSS  229
             VMMSS
Sbjct  582  SVMMSS  587


 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTCSDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P  A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPHLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEELLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_010551283.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
 ref|XP_010551284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Tarenaya hassleriana]
Length=587

 Score =   335 bits (860),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 174/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+ + HYL+RM +L A+SL+APV+GS+ITC+KLLPV++ 
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMVANSHYLHRMMVLRAISLMAPVLGSDITCSKLLPVVVD  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVVEKTIRPCLV+LSEDPDVDVRFFANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVEKTIRPCLVDLSEDPDVDVRFFANQALHSID  581

Query  246  QVMMSS  229
               M S
Sbjct  582  TTTMES  587


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I++ ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IIDFSQDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE ++QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLSPEISIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCASLGKLLEPNDCVARILPVIIDFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  EI+   +LP +   S
Sbjct  269  CEAVGPDSTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLSPEISIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  TDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_006660452.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Oryza brachyantha]
Length=583

 Score =   335 bits (860),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 175/186 (94%), Gaps = 4/186 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC +LLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQQLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQ+LIPI+D S     ++PCLVELSEDPDVDVR++ANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQALIPILDQS----NVKPCLVELSEDPDVDVRYYANQALQACD  577

Query  246  QVMMSS  229
            Q+MMSS
Sbjct  578  QIMMSS  583


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L    G     + L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAAGPEHSREHLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILSPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001150156.1| LOC100283785 [Zea mays]
 gb|ACG38064.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
Abeta isoform [Zea mays]
 gb|ACR36218.1| unknown [Zea mays]
 gb|AFW87186.1| Serine/threonine-protein phosphatase regulatory subunit Abeta 
isoform [Zea mays]
Length=587

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 176/186 (95%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVEL+EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDA ANN+K
Sbjct  402  IVELSEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAGANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RL EEFGPEWAMQHIIPQVLE IN+PHYLYRMT L A+SLLAPVMG +ITC +LLPV+I 
Sbjct  462  RLTEEFGPEWAMQHIIPQVLEKINNPHYLYRMTTLQAISLLAPVMGPDITCQQLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPN+KFNVAKVLQSL+PI+D SVVEKT++PCLVELSEDPDVDVR++A+QAL+A D
Sbjct  522  SSKDRVPNMKFNVAKVLQSLVPILDQSVVEKTVKPCLVELSEDPDVDVRYYAHQALRACD  581

Query  246  QVMMSS  229
            Q+++SS
Sbjct  582  QMVISS  587


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L +  ++ L D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGTEPTRGDLVSAYVRLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   P+ A++HI+P + E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCKILNPQIAIEHILPCIKELSSDSSQHVRSALASVIMGMAPVLGKDATLEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VELSED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELSEDRHWRVRL  415



>ref|XP_008783038.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783039.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
 ref|XP_008783040.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Phoenix dactylifera]
Length=587

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+ELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IMELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             LAEEFGPEWAMQHIIPQV + I++PHYLYRMTILHA+SLLA VMG +ITC KLLPV+I 
Sbjct  462  HLAEEFGPEWAMQHIIPQVPDKISNPHYLYRMTILHAISLLAHVMGIDITCQKLLPVVIA  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            +SKDRVPNIKFNVAKVLQSL+PI+D SVVE  IRPCLVELSEDPDVDVR+FANQALQA D
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVVENMIRPCLVELSEDPDVDVRYFANQALQACD  581

Query  246  QVMMSS  229
            QVM+SS
Sbjct  582  QVMVSS  587


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  + D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSRDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+  +QHI+P + E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLPIQHILPCLKELSSDSSQHVRSALASVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P ++EL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQINQVIGIDLLSQSLLPAIMELAEDRHWRVRL  415



>gb|AAG09551.1|AC011810_10 Putative protein phosphotase 2a 65kd regulatory subunit [Arabidopsis 
thaliana]
Length=591

 Score =   333 bits (854),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 175/190 (92%), Gaps = 4/190 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +  
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPALTK  521

Query  426  ----ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
                +S  RVPNIKFNVAK++QSLIPIVD +VVE  IRPCLVELSEDPDVDVR+FANQAL
Sbjct  522  RTTLSSSFRVPNIKFNVAKMMQSLIPIVDQAVVENMIRPCLVELSEDPDVDVRYFANQAL  581

Query  258  QAADQVMMSS  229
            Q+ D VMMSS
Sbjct  582  QSIDNVMMSS  591


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_006415878.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
 dbj|BAJ33743.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34231.1| hypothetical protein EUTSA_v10007162mg [Eutrema salsugineum]
Length=588

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLVELSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVELSEDPDVDVRYFANQALHSID  581

Query  246  QVMMS  232
               +S
Sbjct  582  GAAVS  586


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_010477897.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Camelina sativa]
Length=588

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_010499103.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>gb|AFW75382.1| hypothetical protein ZEAMMB73_324274 [Zea mays]
Length=623

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 179/222 (81%), Gaps = 36/222 (16%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDH----------------------------------  349
            +SKDRVPNIKFNVAKVLQSL+PI+D                                   
Sbjct  522  SSKDRVPNIKFNVAKVLQSLVPILDQSVSSSSYSAHMLPTFSKKAVHLYFSWYWGISSVL  581

Query  348  --SVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVMMSS  229
               VVEKT++PCLVELSEDPDVDVR++ANQALQA DQ+M+SS
Sbjct  582  TPQVVEKTVKPCLVELSEDPDVDVRYYANQALQACDQMMVSS  623


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +L+P+ ++
Sbjct  306  KFCRILNPQLSVQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLVPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_002893420.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69679.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis lyrata subsp. lyrata]
Length=588

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_006307078.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
 gb|EOA39976.1| hypothetical protein CARUB_v10008664mg [Capsella rubella]
Length=588

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_010460344.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Camelina sativa]
Length=588

 Score =   329 bits (844),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|NP_173920.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
 sp|Q38845.1|2AAA_ARATH RecName: Full=Serine/threonine-protein phosphatase 2A 65 kDa 
regulatory subunit A alpha isoform; Short=AtA alpha; Short=PP2A, 
subunit A, alpha isoform; Short=PR-65 A; AltName: Full=Protein 
ROOTS CURL IN NAPHTHYLPHTHALAMIC ACID 1; AltName: Full=Protein 
enhancer of ethylene-response 1 [Arabidopsis thaliana]
 gb|AAG50801.1|AC079281_3 phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAC49255.1| phosphoprotein phosphatase 2A, regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAM53315.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AAN15427.1| phosphoprotein phosphatase 2A regulatory subunit A [Arabidopsis 
thaliana]
 gb|AEE30632.1| serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform [Arabidopsis thaliana]
Length=588

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL + D
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNSID  581


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_001777048.1| predicted protein [Physcomitrella patens]
 gb|EDQ58162.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL D+VYSIR+AAANN+K
Sbjct  405  IVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLGDQVYSIREAAANNLK  464

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWA+QHIIPQV+E IN+PHYLYRMT+L A+SLLAPV+GSE TC  +LPV+I 
Sbjct  465  RLAEEFGPEWALQHIIPQVMEKINNPHYLYRMTVLVAISLLAPVVGSEATCQTMLPVVIN  524

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQS+IPIVD +VVE+TIRPCL+EL EDPDVDVRFFA QALQA D
Sbjct  525  AAKDRVPNIKFNVAKMLQSMIPIVDSTVVEQTIRPCLLELQEDPDVDVRFFAGQALQACD  584

Query  246  QVMMS  232
            QVM +
Sbjct  585  QVMCA  589


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  249  IVSFSQDKSWRVRYMVANQLYELCEAVGQEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  308

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A  HI+P V ++  D     R  +   +  +AP++G E T  +LLP+ ++
Sbjct  309  KFCGIVSPQVAQLHILPCVKDLSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIFLS  368

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  369  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>emb|CDY24397.1| BnaCnng04640D [Brassica napus]
Length=413

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN+K
Sbjct  227  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANNLK  286

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K L V++ 
Sbjct  287  RLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLSVVVE  346

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++ D
Sbjct  347  AAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRSID  406


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 81/170 (48%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L+D    +R AAA  V 
Sbjct  71   IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYERLLRDNEAEVRIAAAGKVT  130

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++    E A+QHI+  V E+  D        +   +  +AP++G + T   LL + ++
Sbjct  131  KFSQLLNLELAIQHILSCVKELSTDSSQHVCSALASVIMGMAPILGKDSTIENLLSIFLS  190

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P++  N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  191  LLKDEFPDVHLNIINKLDQVNQVIGIDLLSESLLPAIVELAEDRHWRVRL  240



>ref|XP_004236962.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY P+LASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAANN+K
Sbjct  398  IVELAEDRHWRVRLAIIEYTPMLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANNLK  457

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEE GPEWAMQHIIPQVL +IN+ HYLYRM IL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  458  RLAEELGPEWAMQHIIPQVLGVINNSHYLYRMAILRAISLLAPVMGSEITCSKLLPVVIT  517

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             +KDRVPN+KFNVAKVLQSLIP+VD SV EK IR  LVEL+EDPDVDVRF+A+QALQ+ D
Sbjct  518  VAKDRVPNVKFNVAKVLQSLIPVVDQSVAEKMIRSSLVELAEDPDVDVRFYASQALQSID  577

Query  246  QVMMSS  229
             VMMSS
Sbjct  578  GVMMSS  583


 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA    
Sbjct  242  IVNFSQDKSWRVRYMVANQLYELCEAVGPETSRKDLVPSYVRLLRDNEAEVRIAAAGKAT  301

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  302  KFSQILSPELSLQHILPSVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  361

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  411



>ref|XP_009115632.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=370

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLAS LG+GFFDDKLGALCMQWL+DKV SIR+AAANN+K
Sbjct  184  IVELAEDRHWRVRLAIIEYVPLLASPLGIGFFDDKLGALCMQWLQDKVSSIREAAANNLK  243

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQHI+PQVL+M+ +PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  244  RLAEEFGSEWAMQHIVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  303

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPN+KFNVAK+LQSLIPIVD SVVEKTIR CLV+LSEDPDVDVR+FANQAL++ D
Sbjct  304  ASKDRVPNVKFNVAKLLQSLIPIVDQSVVEKTIRQCLVDLSEDPDVDVRYFANQALRSID  363


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            +V  ++D+ WRVR  +   +  L   +G       L    +  L+D    +R AAA  V 
Sbjct  28   VVNFSQDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVGLLRDNEAEVRIAAAGKVT  87

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  88   KFCQLLNPELVIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  147

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  148  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  197



>emb|CDY42101.1| BnaA09g28590D [Brassica napus]
Length=589

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAANN+K
Sbjct  403  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAANNLK  462

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQHI+PQVL+M+ +PHYL+RM +L A+SL+APVMGSEITC+K LPV++ 
Sbjct  463  RLAEEFGSEWAMQHIVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVVVE  522

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPN+KFNVAK+LQSLIPIVD SVVEKTIR CLV+LSEDPDVDVR+FANQAL++ D
Sbjct  523  ASKDRVPNVKFNVAKLLQSLIPIVDQSVVEKTIRQCLVDLSEDPDVDVRYFANQALRSID  582


 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 81/165 (49%), Gaps = 0/165 (0%)
 Frame = -3

Query  771  EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEE  592
            +D+ WRVR  +   +  L   +G       L    +  L+D    +R AAA  V +  + 
Sbjct  252  QDKSWRVRYMVANQLYELCEAVGPDSTRTDLVPAYVGLLRDNEAEVRIAAAGKVTKFCQL  311

Query  591  FGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDR  412
              PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ ++  KD 
Sbjct  312  LNPELVVQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDE  371

Query  411  VPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
             P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  372  FPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>emb|CDY39185.1| BnaC09g21590D [Brassica napus]
Length=463

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 168/186 (90%), Gaps = 9/186 (5%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  287  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  346

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV+IT
Sbjct  347  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVIT  406

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDR         +VL SLIPIVD SVVE  IRP LVELSEDPDVDVRFFANQALQ+ D
Sbjct  407  ASKDR---------QVLTSLIPIVDQSVVENMIRPGLVELSEDPDVDVRFFANQALQSID  457

Query  246  QVMMSS  229
             VMM S
Sbjct  458  NVMMFS  463


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (51%), Gaps = 0/165 (0%)
 Frame = -3

Query  771  EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEE  592
            +D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V +    
Sbjct  136  QDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVTKFCRI  195

Query  591  FGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDR  412
              PE A+QHI+P V E+ +D     R  +   +  +APV+G E T   LLP+ ++  KD 
Sbjct  196  LNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKEATIEHLLPIFLSLLKDE  255

Query  411  VPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
             P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  256  FPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  300



>emb|CDY36104.1| BnaA08g19440D [Brassica napus]
Length=588

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++ D
Sbjct  522  AAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRSID  581


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE  +QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCQLLNPELTIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 77/180 (43%), Gaps = 0/180 (0%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  598
            L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L 
Sbjct  210  LTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYELC  269

Query  597  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  418
            E  GP+     ++P  + ++ D     R+     V+    ++  E+T   +LP +   S 
Sbjct  270  EAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCQLLNPELTIQHILPCVKELST  329

Query  417  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVM  238
            D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV+
Sbjct  330  DSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVI  389



>ref|XP_009109883.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
 ref|XP_009109885.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Brassica rapa]
Length=588

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 171/180 (95%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQW++DKVYSIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWMQDKVYSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQHI+PQVL+M+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGSEWAMQHIVPQVLDMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++ D
Sbjct  522  AAKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALRSID  581


 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE ++QHI+P V E+  D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCQLLNPELSIQHILPCVKELSTDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/180 (22%), Positives = 77/180 (43%), Gaps = 0/180 (0%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  598
            L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L 
Sbjct  210  LTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYELC  269

Query  597  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  418
            E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S 
Sbjct  270  EAVGPDCTKTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKELST  329

Query  417  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVM  238
            D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV+
Sbjct  330  DSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQVI  389



>gb|AAB60713.1| serine/threonine protein phosphatase type 2A regulatory subunit 
A [Arabidopsis thaliana]
Length=590

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 172/182 (95%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA--NN  613
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+AAA  NN
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAAAAANN  461

Query  612  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  462  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  521

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  522  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  581

Query  252  AD  247
             D
Sbjct  582  ID  583


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CEAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>gb|KJB50734.1| hypothetical protein B456_008G184500 [Gossypium raimondii]
Length=587

 Score =   324 bits (831),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKVYSIRDAAANN+ 
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGTLCMQWLQDKVYSIRDAAANNLI  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG +WAM+HIIPQVLEM N PHYLYRMTIL ++S+LAPVMGSEI C+KLLPV++ 
Sbjct  462  RLAEEFGRDWAMEHIIPQVLEMANSPHYLYRMTILRSISILAPVMGSEIACSKLLPVVVN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRV NIKFNVAKVLQSL+PIVD SV EKTI PCLVELSED DVDVR+FANQ LQ+ +
Sbjct  522  ASKDRVANIKFNVAKVLQSLVPIVDKSVAEKTIYPCLVELSEDSDVDVRYFANQGLQSIN  581

Query  246  QVMMS  232
               MS
Sbjct  582  HATMS  586


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPQPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE A  HI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFSQILSPELANHHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPISLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY51132.1| BnaA07g37150D [Brassica napus]
Length=586

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+A ANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAGANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQH++PQVLEM+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGSEWAMQHLVPQVLEMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
            ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL++
Sbjct  522  ASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALKS  579


 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE ++QHI+P V ++ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCQLLNPELSIQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDEQDSVRLLAVEGCAALGKLLEPQDCVARVLPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKDLS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_001775815.1| predicted protein [Physcomitrella patens]
 gb|EDQ59354.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL+D+VYSIR+AAANN+K
Sbjct  405  IVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLEDQVYSIREAAANNLK  464

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWA+QHIIPQV+E IN+PHYLYRMT+L A+SLLAPV+G+E TC  +LPV+I 
Sbjct  465  RLAEEFGSEWALQHIIPQVMEKINNPHYLYRMTVLVAISLLAPVVGAEATCQTMLPVVIN  524

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQS+IPIVD +VVE+TIRPCL+EL EDPDVDVRFFA QALQA  
Sbjct  525  AAKDRVPNIKFNVAKMLQSMIPIVDSTVVEQTIRPCLLELQEDPDVDVRFFAGQALQACV  584

Query  246  QVM  238
            QVM
Sbjct  585  QVM  587


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  249  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  308

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+   QHI+P V E+  D     R  +   +  +AP++G E T  +LLP+ ++
Sbjct  309  KFCGIVNPQVGQQHILPCVKELSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIFLS  368

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  369  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>ref|XP_009103071.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Brassica rapa]
Length=586

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFDDKLGALCMQWL+DKVYSIR+A ANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDDKLGALCMQWLQDKVYSIREAGANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWAMQH++PQVLEM+N+PHYL+RM  L A+SL+APVMGSEITC+K LPV++ 
Sbjct  462  RLAEEFGSEWAMQHLVPQVLEMVNNPHYLHRMMALRAISLMAPVMGSEITCSKFLPVVVE  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
            ASKD VPNIKFNVAK++QSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQALQ+
Sbjct  522  ASKDIVPNIKFNVAKLMQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALQS  579


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE ++QHI+P V ++ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCQLLNPELSIQHILPCVKDLSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDRLSQSLLPAIVELAEDRHWRVRL  415


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/181 (22%), Positives = 78/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDEQDSVRLLAVEGCAALGKLLEPQDCVARVLPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             E  GP+     ++P  + ++ D     R+     V+    ++  E++   +LP +   S
Sbjct  269  CEAVGPDCTKTDLVPAYVRLLQDNEAEVRIAAAGKVTKFCQLLNPELSIQHILPCVKDLS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>emb|CAA57527.1| 65 kDa regulatory subunit of protein phosphatase 2A [Arabidopsis 
thaliana]
Length=590

 Score =   321 bits (822),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 171/182 (94%), Gaps = 2/182 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAA--NN  613
            IVELAEDRHWRVRLAIIEY+PLLASQLG+GFFD KLGALCMQWL+DKVYSIR+AAA  NN
Sbjct  402  IVELAEDRHWRVRLAIIEYVPLLASQLGIGFFDYKLGALCMQWLQDKVYSIREAAAAANN  461

Query  612  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
            +KRLAEEFGPEWAMQH++PQVL+M+N+PHYL+RM +L A+SL+APVMGSEITC+K LPV+
Sbjct  462  LKRLAEEFGPEWAMQHLVPQVLDMVNNPHYLHRMMVLRAISLMAPVMGSEITCSKFLPVV  521

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
            + ASKDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQAL +
Sbjct  522  VEASKDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALNS  581

Query  252  AD  247
             D
Sbjct  582  ID  583


 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCKAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  306  KFCRLLNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415


 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 77/181 (43%), Gaps = 0/181 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +L +D    VRL  +E    L   L       ++  + + + +DK + +R   AN +  L
Sbjct  209  DLTKDDQDSVRLLAVEGCAALGKLLEPQDCVARILPVIVNFSQDKSWRVRYMVANQLYEL  268

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             +  GP+     ++P  + ++ D     R+     V+    ++  E+    +LP +   S
Sbjct  269  CKAVGPDCTRTDLVPAYVRLLRDNEAEVRIAAAGKVTKFCRLLNPELAIQHILPCVKELS  328

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQV  241
             D   +++  +A V+  + PI+      + + P  + L +D   DVR      L   +QV
Sbjct  329  SDSSQHVRSALASVIMGMAPILGKDSTIEHLLPIFLSLLKDEFPDVRLNIISKLDQVNQV  388

Query  240  M  238
            +
Sbjct  389  I  389



>ref|XP_001769725.1| predicted protein [Physcomitrella patens]
 gb|EDQ65526.1| predicted protein [Physcomitrella patens]
Length=589

 Score =   320 bits (820),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGV FFDDKLGALCMQWL D+V+SIR+AAANN+K
Sbjct  405  IVELAEDRHWRVRLAIIEYIPLLASQLGVDFFDDKLGALCMQWLGDQVFSIREAAANNLK  464

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFG EWA+QHIIPQV++ IN+PHYLYRMT+L A+SLLAPV+G+E TC  +LPV+I 
Sbjct  465  RLAEEFGSEWALQHIIPQVMDKINNPHYLYRMTVLVAISLLAPVVGAEATCQTMLPVVIN  524

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDRVPNIKFNVAK+LQS+IPIV+ +VVE+TIRPCL+EL EDPDVDVRFFA QALQA D
Sbjct  525  AAKDRVPNIKFNVAKMLQSMIPIVESTVVEQTIRPCLLELQEDPDVDVRFFAGQALQACD  584

Query  246  QVMMS  232
            QVM +
Sbjct  585  QVMCA  589


 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  249  IVSFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  308

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A QHI+P V E+  D     R  +   +  +AP++G E T  +LLP+ + 
Sbjct  309  KFCGIVSPQVAQQHILPCVKELSTDSSQHVRAALASVIMGMAPLLGKEATIEQLLPIFLA  368

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  369  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  418



>ref|XP_002988290.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
 gb|EFJ10709.1| hypothetical protein SELMODRAFT_447252 [Selaginella moellendorffii]
Length=584

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+HWRVRLAIIEYIPLLASQLGV FFDDKLGALCM WL D+V SIR+AAANN+K
Sbjct  400  IVELAEDKHWRVRLAIIEYIPLLASQLGVEFFDDKLGALCMHWLGDQVCSIREAAANNLK  459

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RL EEFG EWA +HIIPQVLEMIN+PHYLYR+TIL+A+SL APV+GSE+TC  +LPV+I 
Sbjct  460  RLTEEFGTEWACRHIIPQVLEMINNPHYLYRLTILYAISLFAPVVGSEVTCQMMLPVVIN  519

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDR+PN+KFNVAK+LQS IPIV   VVE++IRPCLVELSEDPDVDVR+FANQALQ+ +
Sbjct  520  AAKDRIPNVKFNVAKILQSFIPIVGSEVVEQSIRPCLVELSEDPDVDVRYFANQALQSCE  579

Query  246  QVM  238
            Q M
Sbjct  580  QAM  582


 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 86/170 (51%), Gaps = 3/170 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA+ V 
Sbjct  247  ILNFSQDKSWRVRYMVANQLYELCETVGPECTRVDLVPAYVRLLRDNEAEVRIAAADKVT  306

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  E   PE AMQ I+P V E+  D     R  +   +  +APV+G + T  +LLP+ + 
Sbjct  307  KFCEIVQPEIAMQSILPCVKELSLDSSQHVRAALASVIMGMAPVLGKDATIEQLLPIFLA  366

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +I I    ++ +++ P +VEL+ED    VR 
Sbjct  367  LLKDEFPDVRLNIISKLDQVIGI---DLLSQSLLPAIVELAEDKHWRVRL  413



>ref|XP_002963887.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
 gb|EFJ35758.1| hypothetical protein SELMODRAFT_166330 [Selaginella moellendorffii]
Length=587

 Score =   313 bits (801),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+HWRVRLAIIEYIPLLASQLGV FFDDKLGALCM WL D+V SIR+AAANN+K
Sbjct  403  IVELAEDKHWRVRLAIIEYIPLLASQLGVEFFDDKLGALCMHWLGDQVCSIREAAANNLK  462

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RL EEFG EWA +HIIPQVLEMIN+PHYLYR+TIL+A+SL APV+GSE+TC  +LPV+I 
Sbjct  463  RLTEEFGTEWACRHIIPQVLEMINNPHYLYRLTILYAISLFAPVVGSEVTCQMMLPVVIN  522

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KDR+PN+KFNVAK+LQS IPIV   VVE++IRPCLVELSEDPDVDVR+FANQALQ+ +
Sbjct  523  AAKDRIPNVKFNVAKILQSFIPIVGSEVVEQSIRPCLVELSEDPDVDVRYFANQALQSCE  582

Query  246  QVM  238
            Q M
Sbjct  583  QAM  585


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA+ V 
Sbjct  247  ILNFSQDKSWRVRYMVANQLYELCETVGPECTRVDLVPAYVRLLRDNEAEVRIAAADKVT  306

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  E   PE AMQ I+P V E+  D     R  +   +  +APV+G + T  +LLP+ + 
Sbjct  307  KFCEIVQPEIAMQSILPCVKELSLDSSQHVRAALASVIMGMAPVLGKDATIEQLLPIFLA  366

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  367  LLKDEFPDVRLNIISKLDQVNKVIGIDLLSQSLLPAIVELAEDKHWRVRL  416



>ref|XP_002973833.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
 ref|XP_002983557.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ15458.1| hypothetical protein SELMODRAFT_268734 [Selaginella moellendorffii]
 gb|EFJ24788.1| hypothetical protein SELMODRAFT_232183 [Selaginella moellendorffii]
Length=580

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            ++ELAEDRHWRVRLAIIEYIPLLASQLGV  FDDKLG+LCMQWL D+V+SIR+AAANN+K
Sbjct  396  LLELAEDRHWRVRLAIIEYIPLLASQLGVEVFDDKLGSLCMQWLGDQVFSIREAAANNLK  455

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEW  QHI+PQV+ MIN+PHYLYRMTILHA+SLLAPV+G E+TC  LLPV+I 
Sbjct  456  RLAEEFGPEWTCQHILPQVINMINNPHYLYRMTILHAISLLAPVVGGEVTCQTLLPVVIN  515

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            ASKDRVPNIKFNVAKVL+SLIP VD SVV++TIRP L EL+EDPDVDVR+FA++AL+A D
Sbjct  516  ASKDRVPNIKFNVAKVLKSLIPTVDASVVDQTIRPTLQELNEDPDVDVRYFASEALKACD  575

Query  246  QVMMS  232
              M +
Sbjct  576  DTMST  580


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 82/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  244  IVSFSQDKSWRVRFMVANQLYELCEAVGAEATRTELVPAYVRLLRDNEAEVRIAAAGKVT  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A Q I+P V ++  D     R  +   +  +APV+G E+T  +LLP  + 
Sbjct  304  KFCRIISPQLATQQILPCVKDLAIDSSQHVRAALASVIMGMAPVLGKEVTIEQLLPTFLA  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ ++   L  +  ++   ++ ++    L+EL+ED    VR 
Sbjct  364  LLKDEFPDVRLSIMSKLDQVNQVIGIDLLSQS----LLELAEDRHWRVRL  409



>ref|XP_007036503.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
 gb|EOY21004.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform 2, partial [Theobroma cacao]
Length=432

 Score =   303 bits (777),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  277  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  336

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMG EI C+ LLP++I 
Sbjct  337  RLAEEFGPQWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGPEIICSNLLPLVIN  396

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPC  319
            ASKDRVPNIKFNVAKVLQSLIPIVD SVVEKTIRPC
Sbjct  397  ASKDRVPNIKFNVAKVLQSLIPIVDQSVVEKTIRPC  432



>ref|XP_006845686.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
 gb|ERN07361.1| hypothetical protein AMTR_s00019p00236090 [Amborella trichopoda]
Length=604

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+D+V+SIRDAAA N+K
Sbjct  420  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDQVFSIRDAAATNLK  479

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN  HYL R+TILH + LLAPV+GSEIT   LLPV++ 
Sbjct  480  RLAEEFGPEWAMQHIIPQVLEKINSTHYLQRITILHTIYLLAPVLGSEITSQSLLPVVVN  539

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             +KDRVPN+KFN AKVL+SLIPI+D SVVE+ + PCLV+L EDPDVDVRFF+  AL+  +
Sbjct  540  TTKDRVPNVKFNAAKVLRSLIPILDQSVVEQRVHPCLVDLYEDPDVDVRFFSGLALEVCE  599

Query  246  QVMMS  232
            QV +S
Sbjct  600  QVKLS  604


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  264  IVNFSQDKSWRVRYMVANQLYELCEAVGPESTRVELVPAYVRLLRDNEAEVRIAAAGKVT  323

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ A+QHI+P V E+ +D     R  +   +  +AP++G + T   LLP+ ++
Sbjct  324  KFCRILNPQLAIQHILPCVKELSSDSSQHVRSALASVIMGMAPILGKDATIELLLPIFLS  383

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  384  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  433



>emb|CAN68660.1| hypothetical protein VITISV_002162 [Vitis vinifera]
Length=582

 Score =   295 bits (755),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 159/186 (85%), Gaps = 5/186 (3%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLG+ FFDD+LGALCMQWL+DKVYSIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGIKFFDDELGALCMQWLQDKVYSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQH+IPQVLEMIN+ HYLYRMT+L A+SLLAP MG+EIT +KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHLIPQVLEMINNSHYLYRMTVLRAISLLAPAMGAEITYSKLLPVVI-  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
                R P     + +     IPIVDHSVVEKTIRPCLVELSEDPDVDVRF ANQA+   D
Sbjct  521  ----RCPMSNSMLPRCCSPWIPIVDHSVVEKTIRPCLVELSEDPDVDVRFSANQAIHVID  576

Query  246  QVMMSS  229
             VMMSS
Sbjct  577  HVMMSS  582


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+  ++DR WRVR  + + +  L   +G       L    M+ L+D    +R AAA  V 
Sbjct  246  IISFSQDRSWRVRYMVADQLYELCHAVGPEATRTDLVPAYMRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE A+ HI+P V E+  D     R  +   +  +APV+G + T ++LLP+ ++
Sbjct  306  KFCQILNPELAIHHILPCVKELSLDSSQHVRSALASVLMGMAPVLGKDATIDQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDDFPDVRLNIISKLDQINQVIGTDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG29905.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Gossypium arboreum]
Length=436

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 158/198 (80%), Gaps = 13/198 (7%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDK-------------  646
            IVELAEDRHWRVRL IIEYIPLLASQLGVGFF DKL  LCMQWL+DK             
Sbjct  236  IVELAEDRHWRVRLPIIEYIPLLASQLGVGFFYDKLDTLCMQWLQDKEVPMLLACDYCYY  295

Query  645  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  466
            + +    +ANN+ RLAEEFG +WAM+ IIPQVLEM N PHYLYRMTIL ++S+LAP+MGS
Sbjct  296  LEACNRHSANNLTRLAEEFGRDWAMEQIIPQVLEMANSPHYLYRMTILRSISILAPLMGS  355

Query  465  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  286
            EITC+KLLPV+  ASKDRV NIKFNVAKVLQSL+PIV  SVVEKTIRPCL ELSED DVD
Sbjct  356  EITCSKLLPVVENASKDRVANIKFNVAKVLQSLVPIVYKSVVEKTIRPCLFELSEDSDVD  415

Query  285  VRFFANQALQAADQVMMS  232
            VR+FANQ LQ+ +   +S
Sbjct  416  VRYFANQGLQSINHATIS  433


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  + 
Sbjct  80   IVNFSQDKSWRVRYMVANQLFELCEAVGPQPTRMDLVPAYVRLLRDNEAEVRIAAAGKIT  139

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE A QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  140  KFSQILSPELATQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIYLS  199

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  200  LLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  249



>ref|XP_006297363.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
 gb|EOA30261.1| hypothetical protein CARUB_v10013383mg [Capsella rubella]
Length=550

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 144/147 (98%), Gaps = 0/147 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHS  346
            ASKDRVPNIKFNVAK++QSLIPIVD S
Sbjct  522  ASKDRVPNIKFNVAKMMQSLIPIVDQS  548


 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTKTDLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>gb|KHG29904.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Gossypium arboreum]
Length=505

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 158/198 (80%), Gaps = 13/198 (7%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDK-------------  646
            IVELAEDRHWRVRL IIEYIPLLASQLGVGFF DKL  LCMQWL+DK             
Sbjct  305  IVELAEDRHWRVRLPIIEYIPLLASQLGVGFFYDKLDTLCMQWLQDKEVPMLLACDYCYY  364

Query  645  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  466
            + +    +ANN+ RLAEEFG +WAM+ IIPQVLEM N PHYLYRMTIL ++S+LAP+MGS
Sbjct  365  LEACNRHSANNLTRLAEEFGRDWAMEQIIPQVLEMANSPHYLYRMTILRSISILAPLMGS  424

Query  465  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  286
            EITC+KLLPV+  ASKDRV NIKFNVAKVLQSL+PIV  SVVEKTIRPCL ELSED DVD
Sbjct  425  EITCSKLLPVVENASKDRVANIKFNVAKVLQSLVPIVYKSVVEKTIRPCLFELSEDSDVD  484

Query  285  VRFFANQALQAADQVMMS  232
            VR+FANQ LQ+ +   +S
Sbjct  485  VRYFANQGLQSINHATIS  502


 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  + 
Sbjct  149  IVNFSQDKSWRVRYMVANQLFELCEAVGPQPTRMDLVPAYVRLLRDNEAEVRIAAAGKIT  208

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE A QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  209  KFSQILSPELATQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIYLS  268

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  +V   ++ +++ P +VEL+ED    VR 
Sbjct  269  LLKDEFPDVRLNIISKLDQVNQVVGIDLLSQSLLPAIVELAEDRHWRVRL  318



>ref|XP_008659342.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X1 [Zea mays]
 gb|AFW86037.1| hypothetical protein ZEAMMB73_179225 [Zea mays]
Length=592

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLEDKVFSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHIIPQVLE IN+PHYLYRMTIL A+SLLAPVMG+EITC KLLPV+I 
Sbjct  462  RLAEEFGPEWAMQHIIPQVLEKINNPHYLYRMTILQAISLLAPVMGAEITCQKLLPVVIN  521

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSV  343
            +SKDRVPNIKFNVAKVL+SL+PI+D SV
Sbjct  522  SSKDRVPNIKFNVAKVLKSLVPILDQSV  549


 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRADLVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      P+ ++QHI+P V E+ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPQLSIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATMEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++    + +T+ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDFLSQTLLPAIVELAEDRHWRVRL  415



>ref|XP_010319425.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like isoform X2 [Solanum lycopersicum]
Length=549

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEY P+LASQLGVGFFDDKLG LCMQWL+D+VYSIRDAAANN+K
Sbjct  398  IVELAEDRHWRVRLAIIEYTPMLASQLGVGFFDDKLGTLCMQWLQDEVYSIRDAAANNLK  457

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEE GPEWAMQHIIPQVL +IN+ HYLYRM IL A+SLLAPVMGSEITC+KLLPV+IT
Sbjct  458  RLAEELGPEWAMQHIIPQVLGVINNSHYLYRMAILRAISLLAPVMGSEITCSKLLPVVIT  517

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHS  346
             +KDRVPN+KFNVAKVLQSLIP+VD S
Sbjct  518  VAKDRVPNVKFNVAKVLQSLIPVVDQS  544


 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA    
Sbjct  242  IVNFSQDKSWRVRYMVANQLYELCEAVGPETSRKDLVPSYVRLLRDNEAEVRIAAAGKAT  301

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            + ++   PE ++QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  302  KFSQILSPELSLQHILPSVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  361

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  362  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  411



>ref|XP_006279159.1| hypothetical protein CARUB_v100079671mg, partial [Capsella rubella]
 gb|EOA12057.1| hypothetical protein CARUB_v100079671mg, partial [Capsella rubella]
Length=139

 Score =   256 bits (655),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -3

Query  645  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  466
            V+SIR+AAANN+KRLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGS
Sbjct  1    VHSIREAAANNLKRLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGS  60

Query  465  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  286
            EITC+KLLP +ITASKDRVPNIKFNVAK++QSLIPIVD SVVE  IRPCLVELSEDPDVD
Sbjct  61   EITCSKLLPAVITASKDRVPNIKFNVAKMMQSLIPIVDQSVVESMIRPCLVELSEDPDVD  120

Query  285  VRFFANQALQAADQVMMSS  229
            VRFFANQALQ+ D VMMSS
Sbjct  121  VRFFANQALQSIDNVMMSS  139



>ref|XP_009616233.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana tomentosiformis]
Length=583

 Score =   268 bits (686),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I EL+E +HWRVR+A+I +IPLLASQLG GF++DK+GALCMQWL DKV+ +R AAANN++
Sbjct  403  IDELSEAKHWRVRVALINFIPLLASQLGFGFYNDKIGALCMQWLIDKVHQVRVAAANNLR  462

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             LAE+FGPEWA +HIIPQVL+M++D +YLYR+TILHA+SLLAPVMGSEIT +  LPVI+ 
Sbjct  463  LLAEKFGPEWASEHIIPQVLDMVDDRNYLYRITILHALSLLAPVMGSEITTSTFLPVILA  522

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            AS DRVPN++FNVAKVL  L  +VD SVVE+ IRPCL + +ED DVDVRFFAN+ALQA  
Sbjct  523  ASTDRVPNVRFNVAKVLGYLASVVDQSVVEERIRPCLNKFNEDEDVDVRFFANKALQAIY  582

Query  246  Q  244
            Q
Sbjct  583  Q  583


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/162 (26%), Positives = 82/162 (51%), Gaps = 0/162 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            ++ LA+D  W+VR  + + I  L   +G      ++    +  L+D    +R AAA  V 
Sbjct  247  MISLAQDASWQVRYTVADQIYELCETVGPDATRTEMVPAYVGLLRDNETEVRKAAAGKVT  306

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++ +   PE  +QHI P V E+ +DP       +   +  LAP++G + T  +LLP+ ++
Sbjct  307  KVFQILSPELPVQHIFPCVKELSSDPFQEVPFALASDIMGLAPILGKDQTVEQLLPIFLS  366

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSE  301
              KD    I+ N+   ++ +  ++   ++ +++   + ELSE
Sbjct  367  LLKDESTQIRVNIISKIEQVNQVIGIDLLSQSLLSVIDELSE  408



>ref|XP_009419803.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A gamma isoform-like [Musa acuminata subsp. 
malaccensis]
Length=146

 Score =   254 bits (649),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -3

Query  666  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  487
            MQWL+DKV+SIR+AA NN+KRLAEEFGPEWAMQHI+PQ+LE I++PHYL+RMTIL A+SL
Sbjct  1    MQWLEDKVFSIREAATNNLKRLAEEFGPEWAMQHIVPQLLEKISNPHYLHRMTILQAISL  60

Query  486  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  307
            L+PV+GS+ITC KLLPVII+ASKDRVPNIKFNVAKVLQSL+PI DHSVVE+T+RPCLVEL
Sbjct  61   LSPVLGSDITCQKLLPVIISASKDRVPNIKFNVAKVLQSLVPIFDHSVVEQTVRPCLVEL  120

Query  306  SEDPDVDVRFFANQALQAADQVMMSS  229
             EDPDVDVR+FA+QALQ  D  MMS+
Sbjct  121  GEDPDVDVRYFASQALQTCDSAMMSN  146



>emb|CDY03849.1| BnaC07g10740D [Brassica napus]
Length=529

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 142/176 (81%), Gaps = 19/176 (11%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            +LAEDRH R                    F DKLGALCMQWL+DKVYSIR+A ANN+KRL
Sbjct  366  QLAEDRHLR-------------------GFSDKLGALCMQWLQDKVYSIREAGANNLKRL  406

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
            AEEFG EWAMQH++PQVLEM+N PHYL+RM  L  +SL+APVMGSEITC+K LPV++ AS
Sbjct  407  AEEFGSEWAMQHLVPQVLEMVNTPHYLHRMMALRVISLMAPVMGSEITCSKFLPVVVEAS  466

Query  420  KDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
            KDRVPNIKFNVAK+LQSLIPIVD SVV+KTIR CLV+LSEDPDVDVR+FANQALQ 
Sbjct  467  KDRVPNIKFNVAKLLQSLIPIVDQSVVDKTIRQCLVDLSEDPDVDVRYFANQALQT  522



>gb|ABR14732.1| protein phosphatase, partial [Gossypium hirsutum]
Length=245

 Score =   250 bits (639),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 125/126 (99%), Gaps = 0/126 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  120  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  179

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL++IN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  180  RLAEEFGPDWAMQHIVPQVLDVINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  239

Query  426  ASKDRV  409
            ASKDRV
Sbjct  240  ASKDRV  245


 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 70/130 (54%), Gaps = 0/130 (0%)
 Frame = -3

Query  666  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  487
            ++ L+D    +R AAA  V +      PE A+QHI+P V E+  D     R  +   +  
Sbjct  4    VRLLRDNEAEVRIAAAGKVTKFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMG  63

Query  486  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  307
            +APV+G + T  +LLP+ ++  KD  P+++ N+   L  +  ++   ++ +++ P +VEL
Sbjct  64   MAPVLGKDATIEQLLPIFLSLLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVEL  123

Query  306  SEDPDVDVRF  277
            +ED    VR 
Sbjct  124  AEDRHWRVRL  133



>gb|AFB74194.1| protein phosphatase 2A, partial [Halocnemum strobilaceum]
Length=314

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLG LCMQWL+DKVYSIRDAAANNVK
Sbjct  190  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGNLCMQWLQDKVYSIRDAAANNVK  249

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTILHA+SLLAPV+G+EITC+KLLPV+I 
Sbjct  250  RLAEEFGPEWAMQHIVPQVLEMMNNPHYLYRMTILHAISLLAPVLGAEITCSKLLPVVIN  309

Query  426  ASKDR  412
            ASKDR
Sbjct  310  ASKDR  314


 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L    ++ L+D    +R AAA  V 
Sbjct  34   IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYVRLLRDNEAEVRIAAAGKVT  93

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V ++ +D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  94   KFCRILSPELAIQHILPCVKDLSSDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  153

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  154  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  203



>gb|KJB39314.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39315.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
 gb|KJB39316.1| hypothetical protein B456_007G006100 [Gossypium raimondii]
Length=526

 Score =   251 bits (641),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVL+MIN+PHYLYRMTILHA+SLLAPVMGS+ITC+KLLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLDMINNPHYLYRMTILHAISLLAPVMGSDITCSKLLPVVIN  521

Query  426  ASKDR  412
            ASKDR
Sbjct  522  ASKDR  526


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+  D     R  +   +  +APV+G + T  +LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY04181.1| BnaA09g19590D [Brassica napus]
Length=347

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 135/162 (83%), Gaps = 16/162 (10%)
 Frame = -3

Query  678  GALCMQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILH  499
              LCMQWL+DKV+SIRDAAANN+KRLAEEFG EWAMQHI+PQ LEMI +PHYLYRMTIL 
Sbjct  190  STLCMQWLQDKVHSIRDAAANNLKRLAEEFGHEWAMQHIVPQFLEMIYNPHYLYRMTILR  249

Query  498  AVSLLAPVMGSEITCNKLLPVIITASKD------------RVPNIKFNVAKVLQSLIPIV  355
            AVSLLAPV+GSEITC+KLLPV+ITASKD            RVPNIKFNVAKVLQSLIPI 
Sbjct  250  AVSLLAPVIGSEITCSKLLPVVITASKDRQYNKQGFFIYHRVPNIKFNVAKVLQSLIPI-  308

Query  354  DHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVMMSS  229
               VVE  IRP LVELSEDPDVDVRFFANQALQ+ D VMMSS
Sbjct  309  ---VVENMIRPGLVELSEDPDVDVRFFANQALQSIDNVMMSS  347


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 76/153 (50%), Gaps = 10/153 (7%)
 Frame = -3

Query  771  EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEE  592
            +D+ WRV L ++  + LL   L   +         ++ L+D    +R AAA  V +    
Sbjct  44   QDKSWRV-LYMLWDLNLLGKDLVPAY---------VRLLRDNEAEVRIAAAEKVTKFCRI  93

Query  591  FGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDR  412
              PE A+QHI+P V E+ +D     +  +   +  +APV+G + T   LLP+ ++  KD 
Sbjct  94   LNPELAIQHILPSVKELSSDSSQHIKSALASVIMGMAPVLGKDATIEHLLPIFLSLLKDE  153

Query  411  VPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLV  313
             P++  N+   L  +  ++   ++ +++ P +V
Sbjct  154  FPDVCLNIISKLDQVNQVIGIDLLSRSLLPAIV  186



>ref|NP_001030769.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
 gb|AEE77070.1| protein phosphatase 2A subunit A2 [Arabidopsis thaliana]
Length=544

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIRDAAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIRDAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEM+N+PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMVNNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  521

Query  426  ASKDR  412
            ASKDR
Sbjct  522  ASKDR  526


 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 87/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPEIAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|XP_009764796.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Nicotiana sylvestris]
Length=601

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I EL+E +HWRVR+A+I +IPLLASQLGV F++DK+GALCMQWL D+V+ +R AAANN+ 
Sbjct  421  IDELSEAKHWRVRVALINFIPLLASQLGVSFYNDKIGALCMQWLTDEVHQVRVAAANNLV  480

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             LA +FGPEWA++HII QVL+M+ND  Y YR+ IL  +SLLAPV+G EIT + + PVI+ 
Sbjct  481  LLAVKFGPEWALEHIISQVLDMVNDRRYQYRINILRTLSLLAPVVGLEITTSTIFPVILA  540

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            AS DRVPN++FNVAKVL SL  IVD SVVE+ IRPCL +L++D DVDVRFFAN+ALQA  
Sbjct  541  ASTDRVPNVRFNVAKVLPSLASIVDQSVVEERIRPCLNKLNQDEDVDVRFFANKALQAIY  600

Query  246  Q  244
            Q
Sbjct  601  Q  601


 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 80/162 (49%), Gaps = 8/162 (5%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+ L++D  W+VR  + + +  L   +G      ++    ++ L+D    +R AAA  V 
Sbjct  273  IISLSQDDSWQVRYTVADQLCELCETVGPDATRTEMVPAYVRLLRDNETDVRRAAAGKVT  332

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +  +   PE  +QHI+P V E+        R  +   +  L+P++G + T  +LLP+ +T
Sbjct  333  KFFQILSPELPVQHILPCVKEV--------RFALASDIMGLSPILGKDQTVEQLLPIFLT  384

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSE  301
              KD    I+ N+   +  +  ++   ++ +++   + ELSE
Sbjct  385  LLKDESTQIRVNIISKIDQVNQVIGIDLLSQSLLSVIDELSE  426



>gb|KDO41973.1| hypothetical protein CISIN_1g007863mg [Citrus sinensis]
Length=536

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGP+WAMQHI+PQVLEMIN+PHYLYRMTIL A+SLLAPVMGSEITC++LLPV+I 
Sbjct  462  RLAEEFGPDWAMQHIVPQVLEMINNPHYLYRMTILQAISLLAPVMGSEITCSQLLPVVIN  521

Query  426  ASKD  415
            ASKD
Sbjct  522  ASKD  525


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 88/170 (52%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       +    ++ L+D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRSDVVPAYVRLLRDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++     PE A+QHI+P V E+ +D     R  +   +  +AP++G + T  +LLP+ ++
Sbjct  306  KICRILNPELAIQHILPCVKELSSDSSQHVRSALATVIMGMAPILGKDATIEQLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>ref|NP_001031035.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
 gb|AEE28999.1| protein phosphatase 2A subunit A3 [Arabidopsis thaliana]
Length=537

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFD+KLGALCMQWL+DKV+SIR+AAANN+K
Sbjct  402  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDEKLGALCMQWLQDKVHSIREAAANNLK  461

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMIN+PHYLYRMTIL AVSLLAPVMGSEITC+KLLP +IT
Sbjct  462  RLAEEFGPEWAMQHIVPQVLEMINNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPAVIT  521

Query  426  ASKDR  412
            ASKDR
Sbjct  522  ASKDR  526


 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 84/170 (49%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV  ++D+ WRVR  +   +  L   +G       L     + L D    +R AAA  V 
Sbjct  246  IVNFSQDKSWRVRYMVANQLYELCEAVGPEPTRTDLVPAYARLLCDNEAEVRIAAAGKVT  305

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +      PE A+QHI+P V E+ +D     R  +   +  +APV+G + T   LLP+ ++
Sbjct  306  KFCRILNPELAIQHILPCVKELSSDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLS  365

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  366  LLKDEFPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  415



>emb|CDY69424.1| BnaAnng30450D, partial [Brassica napus]
Length=531

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 123/125 (98%), Gaps = 0/125 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWL+DKV+SIR+AAANNVK
Sbjct  403  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLQDKVHSIREAAANNVK  462

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            RLAEEFGPEWAMQHI+PQVLEMI++PHYLYRMTIL AVSLLAPVMGSEITC+KLLPV++T
Sbjct  463  RLAEEFGPEWAMQHIVPQVLEMISNPHYLYRMTILRAVSLLAPVMGSEITCSKLLPVVMT  522

Query  426  ASKDR  412
             +KDR
Sbjct  523  GAKDR  527


 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 83/165 (50%), Gaps = 0/165 (0%)
 Frame = -3

Query  771  EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEE  592
            +D+ WRVR  +   +  L   +G      +L    ++ L+D    +R AAA  V +    
Sbjct  252  QDKSWRVRYMVANQLYELCEAVGPEPTRTELVPAYVRLLRDNEAEVRIAAAGKVTKFCRI  311

Query  591  FGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDR  412
              PE A+QHI+P V E+  D     R  +   +  +APV+G + T   LLP+ ++  KD 
Sbjct  312  LNPELAIQHILPCVKELSTDSSQHVRSALASVIMGMAPVLGKDATIEHLLPIFLSLLKDE  371

Query  411  VPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
             P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  372  FPDVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDRHWRVRL  416



>ref|XP_005644559.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20015.1| ARM repeat-containing protein [Coccomyxa subellipsoidea C-169]
Length=589

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I  LA+D HWRVRLAII+YIPLLA+QLG   F  +LG  CM+WL+D+V+ IR+AA  N++
Sbjct  405  IENLADDNHWRVRLAIIKYIPLLATQLGADVFQQQLGQQCMRWLEDQVFCIREAATLNLQ  464

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +LA EFGPEWA +H++PQVL M+N+ HYLYRMTIL AV+ LAP +  ++ CN +LPV+I+
Sbjct  465  KLAAEFGPEWAKEHLVPQVLAMVNNSHYLYRMTILSAVAALAPAVSHDVLCNNMLPVVIS  524

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
             +KD+VPNIKF VAK+L+ L+P+VD ++ E TI+PCL+EL++D D DV+FFA  ALQ+ +
Sbjct  525  CAKDKVPNIKFTVAKMLERLVPLVDAAIAEHTIKPCLLELADDSDADVQFFAQHALQSCE  584


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 81/167 (49%), Gaps = 0/167 (0%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  598
             A+D+ WRVR  + + + +L + LG     +++    ++ L+D    +R AAA  V  ++
Sbjct  252  FAQDKSWRVRYNVAQQLHMLCAALGAEASRNEIVPPFLKLLRDSEAEVRVAAAGKVAAIS  311

Query  597  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  418
                 +  ++ ++P V  +  D     R  +   V  +A  +G   T   LLPV ++  K
Sbjct  312  NLLDADTVIRVVLPCVKVLAADSSQYVRSALAAVVMEMAAALGKSATIEHLLPVFLSLLK  371

Query  417  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            D VP+++ N+   L  +  ++   ++ +++ P +  L++D    VR 
Sbjct  372  DDVPDVRLNIISKLDQVNQVIGIDLLGESLMPAIENLADDNHWRVRL  418



>emb|CDX84995.1| BnaC05g20600D [Brassica napus]
Length=188

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 6/142 (4%)
 Frame = -3

Query  666  MQWLKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSL  487
            MQWL+DKVYSIR+AAANN+KRLAEEFGPEWAMQH++P VLEM+++PHYL+RM +L A+SL
Sbjct  1    MQWLQDKVYSIREAAANNLKRLAEEFGPEWAMQHLVPHVLEMVSNPHYLHRMMVLRAISL  60

Query  486  LAPVMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL  307
            + PV+GSEITC+K LPV++ ASKDRVPN+KFNVAK+LQSLIPI    VVEKTIR CLV+L
Sbjct  61   MDPVLGSEITCSKFLPVVVEASKDRVPNVKFNVAKLLQSLIPI----VVEKTIRQCLVDL  116

Query  306  SEDP--DVDVRFFANQALQAAD  247
            SEDP  DVDVR+FANQAL++ D
Sbjct  117  SEDPDVDVDVRYFANQALRSID  138



>ref|XP_002954993.1| hypothetical protein VOLCADRAFT_83018 [Volvox carteri f. nagariensis]
 gb|EFJ43981.1| hypothetical protein VOLCADRAFT_83018 [Volvox carteri f. nagariensis]
Length=584

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I ELAED+HWRVRLAI+E+IPLLA QLG  FF +KLG  CM+ L+D+V SIR+AA   ++
Sbjct  401  IEELAEDKHWRVRLAIVEHIPLLAGQLGSEFFQEKLGPQCMKSLEDQVASIREAATRTLQ  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++A +FGP+WA  H++P VL +I +PHYLYRMT+L A+S+LA ++  ++ CN +LPV+  
Sbjct  461  KVAAQFGPDWARDHLVPHVLSLIKNPHYLYRMTVLVAISMLATIVNQDVLCNLMLPVLTA  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KD+VPN+KFNVAK+++ L  +V+ +V+E TIRP L+EL ED D+DVRF+A QAL A D
Sbjct  521  AAKDKVPNVKFNVAKIMEKLAGLVNRNVLESTIRPVLLELCEDSDMDVRFYARQALYACD  580

Query  246  Q  244
             
Sbjct  581  H  581


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 86/170 (51%), Gaps = 0/170 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I + A+D+ WRVR  + + +  LA  LG+     +L    ++ L+D    +R AAA  V 
Sbjct  245  IHKFAQDKSWRVRYNVAQQLVQLAEALGIDVTRIELTPNFVRLLRDNEAEVRVAAAGKVS  304

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
              ++    +  +  +IP V E+  D     R  +   V  +APV+G ++T   L+P+ +T
Sbjct  305  AFSKLLTAQQVVTSVIPCVRELSMDSSQYVRAALAGVVMEMAPVLGKQLTIEHLVPIFLT  364

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ NV   L  +  ++   ++ +++ P + EL+ED    VR 
Sbjct  365  LLKDVYPDVRLNVISKLDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRL  414


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 70/142 (49%), Gaps = 8/142 (6%)
 Frame = -3

Query  780  ELAEDRHWRVRLA----IIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANN  613
            EL+ D    VR A    ++E  P+L  QL +    + L  + +  LKD    +R    + 
Sbjct  325  ELSMDSSQYVRAALAGVVMEMAPVLGKQLTI----EHLVPIFLTLLKDVYPDVRLNVISK  380

Query  612  VKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
            + ++ +  G +   Q ++P + E+  D H+  R+ I+  + LLA  +GSE    KL P  
Sbjct  381  LDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRLAIVEHIPLLAGQLGSEFFQEKLGPQC  440

Query  432  ITASKDRVPNIKFNVAKVLQSL  367
            + + +D+V +I+    + LQ +
Sbjct  441  MKSLEDQVASIREAATRTLQKV  462



>ref|XP_001697300.1| protein phosphatase 2A regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP00240.1| protein phosphatase 2A regulatory subunit [Chlamydomonas reinhardtii]
Length=593

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I ELAED+HWRVRLAI+E+IPLLASQLG  FF +KLG  CM+ L+D+V SIR+A A  ++
Sbjct  409  IEELAEDKHWRVRLAIVEHIPLLASQLGAEFFQEKLGPQCMKSLEDQVASIREAGARTLQ  468

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            ++A EFG EWA  H++P VL +I +PHYLYRMT+L A+S+LA ++  ++ CN +LPVI T
Sbjct  469  KVAGEFGAEWARDHLVPHVLGLIKNPHYLYRMTVLVALSMLATIVSQDVLCNLMLPVITT  528

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAAD  247
            A+KD+VPN+KFNVAK+++ L  +V   V+E +IRP L+EL ED D+DVRF+A QAL A D
Sbjct  529  AAKDKVPNVKFNVAKIMEKLATLVPRPVLESSIRPVLLELCEDGDMDVRFYARQALYACD  588

Query  246  Q  244
             
Sbjct  589  H  589


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/167 (28%), Positives = 81/167 (49%), Gaps = 0/167 (0%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLA  598
            LA D+ WRVR  + + +  L   LG      +L    ++ L+D    +R AAA  V   +
Sbjct  256  LARDKSWRVRYNVAQQLVQLCEVLGPDVTRIELTPNFVRLLRDSEAEVRVAAAGKVAAFS  315

Query  597  EEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASK  418
            +   P+  +  +IP V E+  D     R  +   V  +AP +G  +T   L+P+ +T  K
Sbjct  316  KLLTPQQIVTSVIPCVRELSMDSSQYVRAALAGVVMEMAPTLGKALTIEHLVPIFLTLLK  375

Query  417  DRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            D  P+++ NV   L  +  ++   ++ +++ P + EL+ED    VR 
Sbjct  376  DVYPDVRLNVISKLDQVNQVIGIDLLAQSLLPAIEELAEDKHWRVRL  422


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 68/138 (49%), Gaps = 0/138 (0%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            EL+ D    VR A+   +  +A  LG     + L  + +  LKD    +R    + + ++
Sbjct  333  ELSMDSSQYVRAALAGVVMEMAPTLGKALTIEHLVPIFLTLLKDVYPDVRLNVISKLDQV  392

Query  600  AEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITAS  421
             +  G +   Q ++P + E+  D H+  R+ I+  + LLA  +G+E    KL P  + + 
Sbjct  393  NQVIGIDLLAQSLLPAIEELAEDKHWRVRLAIVEHIPLLASQLGAEFFQEKLGPQCMKSL  452

Query  420  KDRVPNIKFNVAKVLQSL  367
            +D+V +I+   A+ LQ +
Sbjct  453  EDQVASIREAGARTLQKV  470



>ref|XP_004363241.1| protein phosphatase 2A scaffold subunit [Dictyostelium fasciculatum]
 gb|EGG25390.1| protein phosphatase 2A scaffold subunit [Dictyostelium fasciculatum]
Length=626

 Score =   232 bits (592),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+ WRVRLA+I+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN++
Sbjct  448  IVELAEDQQWRVRLAVIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNNLR  507

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG EWA  +IIP+VL + + P+YLYRMT L AV +L+PV+GS++  + ++P++  
Sbjct  508  KLTEVFGVEWAKSNIIPKVLTLHSHPNYLYRMTTLFAVGVLSPVVGSDVIASSMIPLLSK  567

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
               D+VPNI+FNVAK  Q +IP+VD +VV+  ++P L++L EDPD DV+F+ANQALQ
Sbjct  568  MVLDKVPNIRFNVAKTFQIIIPLVDSTVVQSRVKPSLLKLIEDPDKDVKFYANQALQ  624


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 78/166 (47%), Gaps = 0/166 (0%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            ++D+ WRVR  +      L   +G      +L    ++ LKD    +R  A+  V  +  
Sbjct  296  SQDKSWRVRYMVAHLFKELCDSMGPEITKAELVGAFVKLLKDSEAEVRTEASLRVTEVCS  355

Query  594  EFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKD  415
                + + + I+P + ++++D     R  +   +  LAP+ G E T   L  + +   KD
Sbjct  356  LISKDMSTKQILPCIRDLVSDSSQHVRAALAQVIMGLAPIFGKEDTLTHLKDLFLQLLKD  415

Query  414  RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              P+++ N+   L S+  ++   ++ +++ P +VEL+ED    VR 
Sbjct  416  DFPDVRLNIISKLDSVNKVIGIEMLSQSLLPAIVELAEDQQWRVRL  461



>gb|EFA85153.1| protein phosphatase 2A scaffold subunit [Polysphondylium pallidum 
PN500]
Length=628

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+ WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN+K
Sbjct  450  IVELAEDQQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNNLK  509

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG EWA  +IIP+VL + + P+YLYRMT L ++ +L+PV+GS++  + ++P++  
Sbjct  510  KLTEVFGVEWAKSNIIPKVLTLHSHPNYLYRMTTLFSIGVLSPVVGSDVIASSMIPLLTK  569

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
               D+VPNI+FNVAK  Q +IP++D ++V+  ++P L++L EDPD DV+F+ANQALQ
Sbjct  570  MVTDKVPNIRFNVAKTFQIIIPLLDSTIVQSRVKPSLLKLLEDPDKDVKFYANQALQ  626


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 80/166 (48%), Gaps = 0/166 (0%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            A+D+ WRVR  +      L   +G      +L    ++ LKD    +R  AA  V  +  
Sbjct  298  AQDKSWRVRYMVARLFKELCDSMGQEITKSELVGSFVKLLKDTEAEVRTEAAQRVTEVCA  357

Query  594  EFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKD  415
                + ++++I+P V ++++D     R  +   +  L P+ G + T   LL + +   KD
Sbjct  358  LISKDMSVKNILPCVKDLVSDVSQHVRAALAQVIMGLCPIFGKDDTLQYLLELFLQLLKD  417

Query  414  RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              P+++ N+   L ++  ++   ++ +++ P +VEL+ED    VR 
Sbjct  418  DFPDVRLNIISKLDAVNKVIGIEMLSQSLLPAIVELAEDQQWRVRL  463



>ref|XP_006376761.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 ref|XP_006376762.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 gb|ERP54558.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
 gb|ERP54559.1| hypothetical protein POPTR_0012s06200g [Populus trichocarpa]
Length=115

 Score =   211 bits (538),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -3

Query  573  MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRVPNIKF  394
            MQHI+PQVL++IN+PHYLYRMTILHAVSLL+PVMGSEITC++LLP++I ASKDRVPNIKF
Sbjct  1    MQHIVPQVLDLINNPHYLYRMTILHAVSLLSPVMGSEITCSQLLPIVINASKDRVPNIKF  60

Query  393  NVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQAADQVMMSS  229
            NVAKVLQSLIPIVD SVVEKTIRPCLVELSEDPDVDVRFFA QALQ++D VMMS+
Sbjct  61   NVAKVLQSLIPIVDQSVVEKTIRPCLVELSEDPDVDVRFFATQALQSSDHVMMST  115



>ref|XP_638954.1| protein phosphatase 2A scaffold subunit [Dictyostelium discoideum 
AX4]
 sp|Q54QR9.1|2AAA_DICDI RecName: Full=Serine/threonine-protein phosphatase 2A regulatory 
subunit pppA; AltName: Full=Protein phosphatase 2A 65 kDa 
regulatory subunit; AltName: Full=Protein phosphatase 2A A 
subunit; AltName: Full=Protein phosphatase 2A scaffold subunit 
[Dictyostelium discoideum]
 gb|EAL65567.1| protein phosphatase 2A scaffold subunit [Dictyostelium discoideum 
AX4]
Length=584

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN+K
Sbjct  406  IVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNNLK  465

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG +WA  +IIP+VL + + P+YLYRMT L ++S L+ V+G ++  + ++P++  
Sbjct  466  KLTEVFGVDWAKNNIIPKVLSLHSHPNYLYRMTTLFSISTLSTVVGGDVISSSMVPLLAK  525

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
               D+VPNI+FNVAK  Q++IP++D ++V+  ++P LV+L ED D DV+F+A+QALQ
Sbjct  526  MVSDKVPNIRFNVAKTFQTIIPLLDSTIVQSRVKPLLVKLHEDTDKDVKFYASQALQ  582


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 77/164 (47%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  +   +  L   +G      +L    ++ LKD    +R  A+  +  +    
Sbjct  256  DKSWRVRYMVARLLKELCESMGTEITKTELIGAFVKLLKDTEAEVRTEASLRIADVCSLL  315

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
              E  ++ I+P V ++++D     R  +   +  LAP+ G E T   LL + +   KD  
Sbjct  316  TKEMNIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPIYGKEDTLTHLLELFLHLLKDDF  375

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  376  PDVRLNIISKLDQVSKVIGIEMLSQSLLPAIVELAEDHQWRVRL  419



>ref|XP_004358064.1| HEAT repeat containing protein, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR25631.1| HEAT repeat containing protein, partial [Acanthamoeba castellanii 
str. Neff]
Length=580

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 136/179 (76%), Gaps = 1/179 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAEDR WRVRLAIIEYIPLLA QLGV FFD+KLG LCM WL D V+SIR+AA NN+K
Sbjct  401  IVELAEDRQWRVRLAIIEYIPLLADQLGVAFFDEKLGFLCMTWLGDCVFSIREAATNNLK  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMG-SEITCNKLLPVII  430
            +L E FG EWA  +IIP+VL +   P+YLYRMT L A+S+LA V G  E+  N +LP++I
Sbjct  461  KLTEVFGVEWAQNNIIPKVLALYTHPNYLYRMTTLFAISVLAEVKGMKEVIQNSMLPLVI  520

Query  429  TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
              + D VPNI+FNVAK L +LI  +D +VV+  +RPCL  L +D D DV+F+A +AL+A
Sbjct  521  RMADDPVPNIRFNVAKTLYTLIKYLDATVVQNKVRPCLQNLEKDKDRDVQFYAGRALRA  579


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 82/164 (50%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  + E+   L   +G      +L    ++ L+D    +R AAA  V  +A++ 
Sbjct  251  DKSWRVRYMMAEHFVELCDAMGPEITQAELIPAFVRLLRDTEAEVRTAAAFKVTGVAKKL  310

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
              + +++H++P V E++ D     R  +   +  LAPV G E T   LL + +   +D  
Sbjct  311  PADVSIKHLLPCVKELVTDSSQHARAALASVIMGLAPVFGREHTIEHLLDLFLQLLRDDF  370

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P ++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  371  PEVRLNIISKLDEVNKVIGVEMLSQSLLPAIVELAEDRQWRVRL  414



>dbj|GAM25934.1| hypothetical protein SAMD00019534_091090 [Acytostelium subglobosum 
LB1]
Length=665

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 142/178 (80%), Gaps = 1/178 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+ WRVRLAIIEYIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN+K
Sbjct  486  IVELAEDQQWRVRLAIIEYIPLLASQLGVEFFDEKLGNLCMTWLGDSVFSIREAATNNLK  545

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E F  EWA   IIP+VL + + P+YLYRMT L A+S+L+PV+GS++  + ++P++  
Sbjct  546  KLTEVFSVEWAKSTIIPKVLTLHSHPNYLYRMTTLFAISVLSPVVGSDVISSSMIPLLSK  605

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL-SEDPDVDVRFFANQALQ  256
             + D+VPNI+FNVAK LQ +IP++D ++V+  ++P L +L S++ D DV+F+ANQALQ
Sbjct  606  MATDKVPNIRFNVAKTLQIIIPLIDSTLVQSKVKPLLTKLISDETDKDVKFYANQALQ  663


 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (48%), Gaps = 0/166 (0%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            A+D+ WRVR  + ++   L   +G      +L    ++ LKD    +R  AA  V  +  
Sbjct  334  AQDKSWRVRYMVAKFFKELCDSMGPEITRSELVPAFVKLLKDTEPEVRTEAAQRVTEVCS  393

Query  594  EFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKD  415
                + A++ I+P V ++++D     R  +   +  LAP+ G + T   LL + +   KD
Sbjct  394  IIPKDVAIKSILPCVKDLVSDSSQHVRAALAQVIMGLAPIFGKDDTRQHLLDLFLQLLKD  453

Query  414  RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              P ++ N+   L  +  ++   ++  ++ P +VEL+ED    VR 
Sbjct  454  DFPEVRLNIISKLDQVNKVIGIEMLSHSLLPAIVELAEDQQWRVRL  499



>emb|CDX87453.1| BnaA07g34200D [Brassica napus]
Length=154

 Score =   211 bits (536),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 118/137 (86%), Gaps = 8/137 (6%)
 Frame = -3

Query  657  LKDKVYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAP  478
            L  KVYSIR+AAANN+KR AEEFGPEWAMQH++PQVL+M+ +PHYL+RM +L A+SL+AP
Sbjct  19   LFGKVYSIREAAANNLKRFAEEFGPEWAMQHLVPQVLDMVTNPHYLHRMMVLRAISLMAP  78

Query  477  VMGSEITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSED  298
            VMGSEITC+K LPV+  ASKDRVPN+KFNVAK+LQSLIPIVD S        CLV+LSED
Sbjct  79   VMGSEITCSKFLPVVAEASKDRVPNVKFNVAKLLQSLIPIVDQS--------CLVDLSED  130

Query  297  PDVDVRFFANQALQAAD  247
            PDVDVR+FANQAL++ D
Sbjct  131  PDVDVRYFANQALRSID  147



>ref|XP_004671588.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Jaculus jaculus]
Length=265

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  84   IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  143

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT N +LP ++ 
Sbjct  144  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTNHMLPTVLR  203

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  204  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPTLEKLTQDQDVDVKYFAQEAL  259



>gb|AAB03670.1| phosphoprotein phosphatase A [Dictyostelium discoideum]
Length=584

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN+K
Sbjct  406  IVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREAATNNLK  465

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG +WA  +IIP+VL + + P+Y YRMT L ++S L+ V+G ++  + ++P++  
Sbjct  466  KLTEVFGVDWAKNNIIPKVLSLHSHPNYFYRMTTLFSISTLSTVVGGDVIFSSMVPLLAK  525

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
               D+VPNI+FNVAK  Q++IP++D ++V+  ++P LV+L ED D DV+F+A+QALQ
Sbjct  526  MVSDKVPNIRFNVAKTFQTIIPLLDSTIVQSRVKPLLVKLHEDTDKDVKFYASQALQ  582


 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 77/164 (47%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  +   +  L   +G      +L    ++ LKD    +R  A+  +  +    
Sbjct  256  DKSWRVRYMVARLLKELCESMGTEITKTELIGAFVKLLKDTEAEVRTEASLRIADVCSLL  315

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
              E  ++ I+P V ++++D     R  +   +  LAP+ G E T   LL + +   KD  
Sbjct  316  TKEMNIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPIYGKEDTLTHLLELFLHLLKDDF  375

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  376  PDVRLNIISKLDQVSKVIGIEMLSQSLLPAIVELAEDHQWRVRL  419



>pdb|3C5W|A Chain A, Complex Between Pp2a-Specific Methylesterase Pme-1 And 
Pp2a Core Enzyme
Length=232

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  51   IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  110

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  111  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  170

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  171  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  226



>emb|CDY70440.1| BnaAnng33670D, partial [Brassica napus]
Length=155

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 116/133 (87%), Gaps = 8/133 (6%)
 Frame = -3

Query  645  VYSIRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGS  466
            VYSIR+AAANN+KR AEEFGPEWAMQH++PQVL+M+ +PHYL+RM +L A+SL+APVMGS
Sbjct  24   VYSIREAAANNLKRFAEEFGPEWAMQHLVPQVLDMVTNPHYLHRMMVLRAISLMAPVMGS  83

Query  465  EITCNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVD  286
            EITC+K LPV+  ASKDRVPN+KFNVAK+LQSLIPIVD S        CLV+LSEDPDVD
Sbjct  84   EITCSKFLPVVAEASKDRVPNVKFNVAKLLQSLIPIVDQS--------CLVDLSEDPDVD  135

Query  285  VRFFANQALQAAD  247
            VR+FANQAL++ D
Sbjct  136  VRYFANQALRSID  148



>dbj|GAM23034.1| hypothetical protein SAMD00019534_062090 [Acytostelium subglobosum 
LB1]
Length=581

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+ WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+A+ NN++
Sbjct  401  IVELAEDQQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDPVFSIREASTNNLR  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG EWA   +IP+VL + + P+YLYRMT L ++ +LAPV+GS++  + ++P++  
Sbjct  461  KLTEVFGVEWAKTSVIPKVLTLHSHPNYLYRMTTLFSIGVLAPVVGSDVISSSMVPLLSK  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVEL-SEDPDVDVRFFANQALQ  256
             + D+VPNI+FNVAK  + +IP +D ++V+  +RP L +L ++D D DV+F+ANQALQ
Sbjct  521  MASDKVPNIRFNVAKTFECIIPYIDSTLVQSKVRPLLTKLQNDDQDKDVKFYANQALQ  578


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/166 (27%), Positives = 81/166 (49%), Gaps = 0/166 (0%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            A D+ WRVR  +      L   +G      +L    ++ LKD    +R  AA  V  ++ 
Sbjct  249  ANDKSWRVRYMVARLFKELCEAMGPEITRSELLGCFVKLLKDTESEVRTEAAQRVTEVST  308

Query  594  EFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKD  415
                +   + I+P V +++ DP    R  +  ++  LAP++G E T N LL + +   KD
Sbjct  309  FISKDMCAKIILPCVKDLVTDPSQHVRAALAQSIMGLAPILGKEDTLNHLLNIFLQLLKD  368

Query  414  RVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              P+++ N+   L ++  ++   ++ +++ P +VEL+ED    VR 
Sbjct  369  DFPDVRLNIISKLDTVNQVIGIEMLSQSLLPAIVELAEDQQWRVRL  414



>ref|XP_006746607.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Leptonychotes weddellii]
Length=235

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  54   IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  113

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  114  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  173

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  174  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  229



>pdb|4LAC|A Chain A, Crystal Structure Of Protein Phosphatase 2a (pp2a) And 
Pp2a Phosphatase Activator (ptpa) Complex With Atpgammas
Length=258

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV +FD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  77   IVELAEDAKWRVRLAIIEYMPLLAGQLGVEYFDEKLNSLCMAWLVDHVYAIREAATSNLK  136

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  137  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  196

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  197  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  252



>gb|KFM75065.1| Serine/threonine-protein phosphatase 2A regulatory subunit A 
alpha isoform, partial [Stegodyphus mimosarum]
Length=409

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D V++IR+AA  N+K
Sbjct  229  IVELAEDSKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMTWLVDHVFAIREAATQNLK  288

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FGP+WA   +IP+VL M  D +YL+RMT L  V++LA   G EIT   +LP ++ 
Sbjct  289  KLVEKFGPDWATNTVIPKVLTMSQDQNYLHRMTCLFCVNVLAEACGPEITAKYMLPTVLG  348

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
             + D V N++FNVAK LQ + P++D++ +E  ++PCL +L+ D D+DVR+FA++AL A
Sbjct  349  LANDNVANVRFNVAKTLQRIGPVLDNAALESQVKPCLDKLNNDNDMDVRYFASEALAA  406


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 84/172 (49%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK--  607
            + AED+ WRVR  + +    +   +G       L       LKD    +R AAA+ VK  
Sbjct  71   QAAEDKSWRVRYMVADKFNEIQKAVGPEITKTDLVPAFQNLLKDCEAEVRAAAAHKVKDF  130

Query  606  --RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
               L  +   +  M +I+P + E++ D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  131  CQNLPTDIQEQVIMSNILPCIKELVADANQHVKSALASVIMGLSPILGKQNTVEHLLPLF  190

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            ++  KD  P+++ N+   L  +  ++  + + +++ P +VEL+ED    VR 
Sbjct  191  LSQLKDECPDVRLNIISNLDCVNEVIGITQLSQSLLPAIVELAEDSKWRVRL  242



>ref|XP_003290313.1| phosphoprotein phosphatase A [Dictyostelium purpureum]
 gb|EGC33157.1| phosphoprotein phosphatase A [Dictyostelium purpureum]
Length=579

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAII+YIPLLASQLGV FFD+KLG LCM WL D V+SIR+AA NN++
Sbjct  401  IVELAEDHQWRVRLAIIDYIPLLASQLGVEFFDEKLGNLCMTWLGDSVFSIREAATNNLR  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG EWA  +IIP+VL + + P+YLYRMT L ++S L+ V+G ++    ++P++  
Sbjct  461  KLTEVFGVEWAKNNIIPKVLSLHSHPNYLYRMTTLFSISTLSTVVGGDLISQAMVPLLAK  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
               D+VPNI+FNVAK  Q++IP++D +VV+  ++P L++L ED D DV+F++ QAL 
Sbjct  521  MVSDKVPNIRFNVAKTFQTIIPLLDSTVVQSRVKPLLLKLQEDTDKDVKFYSMQALN  577


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 79/164 (48%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  +   +  L   +G     ++L    ++ LKD    +R  AA  +  +    
Sbjct  251  DKSWRVRYMVARLLKELCESMGPEITKNELVGAFVKLLKDTEAEVRTEAALRIADVCSLL  310

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
              E +++ I+P V ++++D     R  +   +  LAPV G E T   LL + +   KD  
Sbjct  311  PKEISIKTILPCVKDLVSDSSQHVRAALAQVIMSLAPVFGKEDTVAHLLELFLQLLKDDF  370

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L  +  ++   ++ +++ P +VEL+ED    VR 
Sbjct  371  PDVRLNIISKLDQVSKVIGIEMLAQSLLPAIVELAEDHQWRVRL  414



>ref|XP_001625764.1| predicted protein [Nematostella vectensis]
 gb|EDO33664.1| predicted protein [Nematostella vectensis]
Length=586

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D V SIR+AAA N+K
Sbjct  408  IVELAEDTKWRVRLAIIEYMPLLAGQLGVDFFDEKLNTLCMSWLVDHVCSIREAAAINLK  467

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FGPEWA Q +IP+VL M  +P+YL+R+T L++VS+LA V G E     +LPV++ 
Sbjct  468  KLVEKFGPEWAQQQVIPKVLAMAREPNYLHRLTTLNSVSVLADVCGPENISKLMLPVVLN  527

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
             + D V N++FNVAK LQ + P++D S ++  I+PCL +L+ D DVDV++FA +AL A
Sbjct  528  LATDNVANVRFNVAKTLQKIGPLLDASTIQAQIKPCLDKLNADADVDVKYFAQEALTA  585


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 82/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            A D+ WRVR  + + I  L   +G      +L       LKD    +R AAA  VK  +E
Sbjct  252  AYDKSWRVRYMVADKITELQKAVGPEITKTELVPAFQVLLKDCEAEVRAAAAGKVKEFSE  311

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M +I+P V E++ DP+   +  +   +  L+P++G + T   LLP+ +T
Sbjct  312  SLSSDIRESVLMTNILPCVKELVIDPNQHVKSALASVIMGLSPLLGKDNTIEHLLPLFLT  371

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  372  MLKDEFPEVRLNIISNLDCVNQVIGVHQLSQSLLPAIVELAEDTKWRVRL  421



>gb|ETE63053.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform, partial [Ophiophagus hannah]
Length=572

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  391  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  450

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  451  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  510

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++DPDVDV++FA +AL
Sbjct  511  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDPDVDVKYFAQEAL  566


 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 81/175 (46%), Gaps = 15/175 (9%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCM----QWLKDKVYSIRDAAANNV  610
            LA D    VRL  +E    +A  L      + L +L M    Q  +DK + +R   A   
Sbjct  237  LASDEQDSVRLLAVEACVNIAQLL----LQEDLESLVMPTLRQAAEDKSWRVRYMVA---  289

Query  609  KRLAEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLL  442
            ++  E   P+      M  I+P + E+++D +   +  +   +  L+P++G + T   LL
Sbjct  290  EKFTENLSPDCRENIIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLL  349

Query  441  PVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+ +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  350  PLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  404



>ref|XP_007441284.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Python bivittatus]
Length=589

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  408  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  467

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  468  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  527

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++DPDVDV++FA +AL
Sbjct  528  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDPDVDVKYFAQEAL  583


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 80/170 (47%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + E    L   +G       L       +KD    +R AA++ VK   E
Sbjct  252  AEDKSWRVRYMVAEKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASSKVKEFCE  311

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
               P+      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ + 
Sbjct  312  NLSPDCRENIIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLA  371

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  372  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  421



>gb|ACN58639.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Salmo salar]
Length=256

 Score =   209 bits (532),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D VY+IR+AA  N+ 
Sbjct  75   IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMAWLIDHVYAIREAATCNLM  134

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G +IT  ++LPV++ 
Sbjct  135  KLVEKFGAEWAQNTIVPKVLGMANDPNYLHRMTTLFCINALSEVCGQDITTKQMLPVVLK  194

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             S D+V N++FNVAK LQ + P++D + ++  ++P L +L  D D+DV++FA +A+
Sbjct  195  MSNDQVANVRFNVAKSLQKIGPVLDSNALQTEVKPVLEKLDTDTDMDVKYFAQEAI  250



>gb|KFO36119.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Fukomys damarensis]
Length=589

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAI+EYIPLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  408  IVELAEDAKWRVRLAIVEYIPLLAGQLGVEFFDEKLNSLCMAWLMDHVYAIREAATSNLK  467

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YLYRMT L  V++L+ V G +IT   +LP +++
Sbjct  468  KLVEKFGKEWACATIIPKVLAMSRDPNYLYRMTTLFCVNVLSEVCGQDITTKLMLPTVLS  527

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V NI+FNVAK LQ + PI+D+S ++  +RP L +L++D DVDV++F+ +AL
Sbjct  528  MAGDPVANIRFNVAKSLQKIGPILDNSTLQSKVRPILEKLTQDQDVDVKYFSQEAL  583


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            ++AED+ WRVR  + +    L   +G       L  +    + D    +R AA+  VK  
Sbjct  250  QIAEDKSWRVRYMVADKFTELQKAVGSEITKTDLVPVFQNLMNDCEAEVRAAASQKVKEF  309

Query  600  AEEFGPEW----AMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E    +      M  I+P + E+ +D ++  +  +   +  L+P++G + T   LLP+ 
Sbjct  310  CENLPADCRENVVMTQILPCIKELASDTNHHVKSALASVIMGLSPILGKDNTIEHLLPLF  369

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  370  LAQLKDECPEVRLNIISNLNCVNQVIGIQQLSQSLLPAIVELAEDAKWRVRL  421



>ref|XP_005404518.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X3 [Chinchilla 
lanigera]
Length=462

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N+K
Sbjct  281  IVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSNLK  340

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP ++ 
Sbjct  341  KLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTVLQ  400

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  401  MAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  456


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 81/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + E +  L   +G      +L  +    + D    +R AA+  VK   E
Sbjct  125  AEDKSWRVRYMVAEKVTELQKAVGPEITKTELVPIFQNLMNDFEAEVRAAASQKVKEFCE  184

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M  I+P + E+ +D ++L +  +   +  L+PV+G + T   LLP+ + 
Sbjct  185  NLSDDCRENVIMTQILPCIKELASDNNHLVKSALASVIMGLSPVLGKDNTIEHLLPLFLA  244

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  245  QLKDECPEVRLNIISNLDCVNQVIGVRQLSQSLLPAIVELAEDAKWRVRL  294



>dbj|BAG52168.1| unnamed protein product [Homo sapiens]
Length=410

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  229  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  288

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  289  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  348

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  349  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  404


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK  
Sbjct  71   QAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEF  130

Query  600  AEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  131  CENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLF  190

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  191  LAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_008969519.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Pan paniscus]
Length=365

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  184  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  243

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  244  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  303

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  304  MAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  359


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 18/175 (10%)
 Frame = -3

Query  777  LAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCM----QWLKDKVYSIRDAAANNV  610
            LA D    VRL  +E    +A  L      D L  L M    Q  +DK + +R   A+  
Sbjct  33   LASDEQDSVRLLAVEACVSIAQLLS----QDDLETLVMPTLRQAAEDKSWRVRYMVADRF  88

Query  609  KRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLA---PVMGSE-ITCNKLL  442
              L +  GP+  +  +IP    ++ D     R    H V  L    P+   E I  N++L
Sbjct  89   SELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQIL  148

Query  441  PVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P I      + P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  149  PYI------KCPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  197



>ref|XP_004316880.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Tursiops truncatus]
 ref|XP_004694117.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Condylura cristata]
Length=410

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  229  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  288

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  289  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  348

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  349  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  404


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK  
Sbjct  71   QAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEF  130

Query  600  AEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  131  CENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLF  190

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  191  LAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|NP_001272048.1| uncharacterized protein LOC101865435 [Macaca fascicularis]
 dbj|BAE87279.1| unnamed protein product [Macaca fascicularis]
Length=425

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  244  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  303

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  304  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  363

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  364  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEAL  419


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK   E
Sbjct  88   AEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCE  147

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ + 
Sbjct  148  NLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLA  207

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  208  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  257



>ref|XP_008174129.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Chrysemys picta bellii]
Length=537

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  356  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  415

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  416  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  475

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  476  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  531


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK   E
Sbjct  200  AEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCE  259

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ + 
Sbjct  260  NLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLA  319

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  320  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  369



>ref|XP_008969515.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Pan paniscus]
Length=410

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  229  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  288

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  289  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  348

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  349  MAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  404


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 80/170 (47%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  73   AEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGE  132

Query  594  EFGPE----WAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D +   +  +   +  L+ ++G E T   LLP+ + 
Sbjct  133  NLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLA  192

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  193  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>ref|XP_002162841.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Hydra vulgaris]
Length=587

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 133/178 (75%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            I+ELAED  WRVRLAIIEY+PLLA QLG+ FFD+KL ALCM WL D VY+IR+AAA N+K
Sbjct  409  IMELAEDPKWRVRLAIIEYMPLLAGQLGMQFFDEKLSALCMSWLVDHVYAIREAAALNLK  468

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG  WA  ++IP+VL M  D +YL+RMT L A++ +  V   +ITC  +LP +++
Sbjct  469  KLVEKFGLTWAQSNVIPKVLAMSKDTNYLHRMTTLFAINTMIEVCEPDITCKLILPTVLS  528

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
             +KD V N++FNVAK LQ + P  D +VV  TI+PCL +L++D DVDV++FA  AL A
Sbjct  529  LAKDSVANVRFNVAKTLQKIAPTTDTTVVNGTIKPCLTQLNQDSDVDVKYFAGVALSA  586


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 87/170 (51%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKR---  604
            A+D+ WRVR  + + I  L   +G      +L       LKD    ++ AAA+ VK    
Sbjct  253  AQDKSWRVRYMVADKIVELQKAVGPEINKQELVPAFASLLKDGEAEVKTAAAHKVKEFCE  312

Query  603  -LAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
             L E+   +  M  ++P V +++ DP+   +  +   +  L+P++G + T   LLP+ +T
Sbjct  313  NLPEDIREQSIMMTLLPCVKDLVIDPNMHVKAALAGVIMGLSPMLGKDNTIEHLLPLFLT  372

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P+++ N+   L S+  ++    + +++ P ++EL+EDP   VR 
Sbjct  373  MLKDEFPDVRLNIISNLDSVNQVIGIHQLSQSLLPAIMELAEDPKWRVRL  422



>ref|XP_005404517.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Chinchilla 
lanigera]
Length=546

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N+K
Sbjct  365  IVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSNLK  424

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP ++ 
Sbjct  425  KLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTVLQ  484

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  485  MAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  540



>ref|XP_007173032.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=473

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  293  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G EIT  ++LPV++ 
Sbjct  353  KLVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEVCGQEITTKQMLPVVLK  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             ++D+V N++FNVAK LQ + PI+D   +E+ ++P L +L +D DVDV++FA +A+
Sbjct  413  MARDQVANVRFNVAKSLQKIGPILDTDALEE-VKPVLQKLGQDEDVDVKYFAQEAI  467


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  137  AEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELCE  196

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D +   +  +   +  L+ ++G   T   LLP+ + 
Sbjct  197  NLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKGNTIEHLLPLFLA  256

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  257  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_003225135.2| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform [Anolis carolinensis]
Length=614

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  433  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  492

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  493  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  552

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  553  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDADVDVKYFAQEAL  608


 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/172 (26%), Positives = 81/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK  
Sbjct  275  QAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEF  334

Query  600  AEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E   P+      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  335  CENLSPDCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLF  394

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  395  LAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  446



>gb|ELT97469.1| hypothetical protein CAPTEDRAFT_152474 [Capitella teleta]
Length=591

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IV+LAED  WRVRLAIIEY+PLLA QLG  FFD+KL ALCM WL D V++IR+AA  N+K
Sbjct  410  IVDLAEDTKWRVRLAIIEYMPLLAGQLGTEFFDEKLNALCMTWLVDHVFAIREAATINLK  469

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FGPEWA Q ++P+++ M  D +YL+RMT L +++LLA   GS++T  +LLPV+I 
Sbjct  470  KLVEKFGPEWAGQTVVPRIIPMSRDVNYLHRMTCLFSINLLAEPCGSQLTTRQLLPVVIE  529

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FN AK LQ L P +D   +EK ++PCL +L +DPD DV+F+A +AL
Sbjct  530  MAGDAVANVRFNTAKTLQKLGPQIDQPTLEKLVKPCLEKLKQDPDSDVQFYAQEAL  585


 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 82/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            A D+ WRVR  + +    L + +G     + L A     LKD    +R AAAN VK   +
Sbjct  254  ANDKSWRVRYMVADKFTELQNAVGPEITKNDLVAAFQTLLKDCEAEVRAAAANKVKEFCQ  313

Query  594  EFGP----EWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
               P    +  M +I+P V +++ D +   +  +   +  L+P++G + T   LLP+ + 
Sbjct  314  NLAPDSREQLIMTNILPCVKDLVTDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLI  373

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +V+L+ED    VR 
Sbjct  374  QLKDECPEVRLNIISNLDCVNVVIGIQQLSQSLLPAIVDLAEDTKWRVRL  423



>ref|XP_001418916.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97209.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=603

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 135/189 (71%), Gaps = 10/189 (5%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFF----------DDKLGALCMQWLKDKVYS  637
            I ELAED+HWRVRLAIIEYIP+LA Q+G  F           DD L +LC+QWL+D VYS
Sbjct  414  IKELAEDKHWRVRLAIIEYIPVLAQQIGTTFLFQKDEGSDSGDDLLNSLCLQWLQDSVYS  473

Query  636  IRDAAANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEIT  457
            IR+AAANN+ RL E FG +WA+++I P++ E+++  HYLYR+T+L AVSLLAP +G E+ 
Sbjct  474  IREAAANNLFRLTEIFGADWALEYIFPRIKELMSSHHYLYRLTVLRAVSLLAPAVGEEVI  533

Query  456  CNKLLPVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              ++LP+I  A+ D VPN++FN AK L  LI  +D +  +  IRP LV L  DPD DVR+
Sbjct  534  LGEILPIIKHATTDTVPNVRFNAAKALSPLIKAIDVAKFQSEIRPILVGLQSDPDADVRY  593

Query  276  FANQALQAA  250
            FA++ L +A
Sbjct  594  FASEVLTSA  602


 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 84/175 (48%), Gaps = 10/175 (6%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGV-----GFFDDKLGALCMQWLKDKVYSIRDAA  622
            +++LA D+ WRVR A+ + I  +   +G      G FD  +       L D    +R +A
Sbjct  258  VLKLAADKSWRVRYAVAQQIYEMCDVVGAEVAAKGLFDAYVA-----LLGDSEGEVRISA  312

Query  621  ANNVKRLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLL  442
            A  +       G  ++ + I+P+V E+ ND     R  +  AV  LAP MG + T  KLL
Sbjct  313  AGKISEFCSLAGAVYSAEKILPKVHELANDSSQHVRAALAEAVLGLAPTMGKDTTVEKLL  372

Query  441  PVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            PV     KD  P+++ N+   L+ +  ++   ++   + P + EL+ED    VR 
Sbjct  373  PVFFILLKDEFPDVRLNIISKLEQVNTVIGVEMLSTELLPAIKELAEDKHWRVRL  427



>ref|XP_005987322.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform X1 [Latimeria chalumnae]
Length=589

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  408  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  467

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LPV++ 
Sbjct  468  KLVEKFGAEWAQNTIVPKVLAMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVVLK  527

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQ  256
             S D+V N++FNVAK LQ + PI++++ ++  I+P L +L +D D+DV++FA +A+ 
Sbjct  528  MSGDQVANVRFNVAKSLQKIGPILENNTLQTEIKPVLEKLGQDQDIDVKYFAQEAIN  584


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 80/170 (47%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAAN VK   E
Sbjct  252  AEDKSWRVRYMVADKFSELQKAVGPEITKNDLVPAFQNLLKDCEAEVRAAAANKVKEFCE  311

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M HI+P V E+++D +   +  +   +  L+ ++G + T   LLP+ + 
Sbjct  312  NLPADSKENIIMNHILPCVKELVSDTNQHVKSALASVIMGLSTILGKDNTIEHLLPLFLA  371

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  372  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  421



>ref|XP_006114916.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like, partial [Pelodiscus sinensis]
Length=400

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +L M WL D VY+IR+AA +N+K
Sbjct  219  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLSMAWLVDHVYAIREAATSNLK  278

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  279  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  338

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  339  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  394



>ref|NP_001171792.1| protein phosphatase 2, regulatory subunit A, alpha [Saccoglossus 
kowalevskii]
Length=590

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 130/178 (73%), Gaps = 0/178 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL  LCM WL D VY+IR+AA NN+K
Sbjct  409  IVELAEDTKWRVRLAIIEYMPLLAGQLGVEFFDEKLNTLCMAWLVDNVYAIREAATNNLK  468

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   +IP+VL M  D +YL+RMT L  V++LA   G+E+T   +LPV++ 
Sbjct  469  KLVEKFGTEWAQNAVIPKVLLMARDQNYLHRMTCLFCVNVLADACGAEVTVKLMLPVVLN  528

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQALQA  253
               D V N++FNVAK LQ + PI+D + V+  ++ CL +L  D DVDV+FFA +AL A
Sbjct  529  LGGDAVANVRFNVAKTLQRVGPILDSNTVQSQVKSCLDKLGTDSDVDVKFFAQEALAA  586


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 83/172 (48%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+ WRVR  + +    +   +G       L       LKD    +R AAA+ VK+ 
Sbjct  251  QCAEDKSWRVRYMVADKFTEIQKAVGPEIAKTDLVPAFQSLLKDCEAEVRAAAAHKVKKF  310

Query  600  AEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E+  P       M +I+P V E+++D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  311  CEDLDPSVRETVIMNNILPCVKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLF  370

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  371  LAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDTKWRVRL  422



>ref|XP_007054025.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like [Chelonia mydas]
 gb|EMP41291.1| Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A alpha isoform [Chelonia mydas]
Length=605

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  424  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  483

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG +WA   IIP+VL M NDP+YL+RMT L  +++L+ V G EIT   +LP ++ 
Sbjct  484  KLVEKFGKDWAHATIIPKVLAMSNDPNYLHRMTTLFCINVLSEVCGQEITTKHMLPTVLR  543

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +L++D DVDV++FA +AL
Sbjct  544  MAGDAVANVRFNVAKSLQKIGPILDNSTLQNEVKPVLEKLTQDQDVDVKYFAQEAL  599


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 9/175 (5%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK   E
Sbjct  263  AEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCE  322

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLL-----  442
                +      M  I+P + E+++D +   +  +   +  L+P++G +     LL     
Sbjct  323  NLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGQDNNIEHLLXXXXX  382

Query  441  PVIITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
               +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  383  XXFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  437



>ref|XP_005404516.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X1 [Chinchilla 
lanigera]
Length=589

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEYIPLLA QLGV FFD+KL +LCM  L D VY+IR+AA +N+K
Sbjct  408  IVELAEDAKWRVRLAIIEYIPLLAGQLGVEFFDEKLNSLCMACLMDHVYAIREAATSNLK  467

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YLYRMT L  +++L+ V G +IT  ++LP ++ 
Sbjct  468  KLVEKFGREWARAAIIPKVLAMSGDPNYLYRMTTLFCINVLSEVCGQDITTKQMLPTVLQ  527

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V NI+FNVAK LQ + PI+D+S+++  ++P L +L++D DVDV++F+ QAL
Sbjct  528  MAGDPVANIRFNVAKSLQKIGPILDNSILQSKVKPILEKLTQDQDVDVKYFSQQAL  583


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 81/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + E +  L   +G      +L  +    + D    +R AA+  VK   E
Sbjct  252  AEDKSWRVRYMVAEKVTELQKAVGPEITKTELVPIFQNLMNDFEAEVRAAASQKVKEFCE  311

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                +      M  I+P + E+ +D ++L +  +   +  L+PV+G + T   LLP+ + 
Sbjct  312  NLSDDCRENVIMTQILPCIKELASDNNHLVKSALASVIMGLSPVLGKDNTIEHLLPLFLA  371

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  372  QLKDECPEVRLNIISNLDCVNQVIGVRQLSQSLLPAIVELAEDAKWRVRL  421



>ref|XP_006190431.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Camelus ferus]
Length=439

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  258  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  317

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  318  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  377

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D   +++ ++P L +L +D D+DV++FA +A+
Sbjct  378  MAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDMDVKYFAQEAM  433


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 80/170 (47%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  102  AEDKSWRVRYMVADKFSELQKAVGPKITQNDLIPAFQNLLKDCEAEVRAAAAHKVKELCE  161

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D +   +  +   +  L+ ++G E T   LLP+ + 
Sbjct  162  NLPIEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLA  221

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  222  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  271



>ref|XP_004273471.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Orcinus orca]
Length=474

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA N + 
Sbjct  293  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNGLV  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LPV++ 
Sbjct  353  KLVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVVLK  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             ++D+V N++FNVAK LQ + PI+D + +++ ++P L +L +D DVDV++FA +A+
Sbjct  413  MARDQVANVRFNVAKSLQKIGPILDTNALQEEVKPVLQKLGQDEDVDVKYFAQEAI  468


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  137  AEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELCE  196

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D +   +  +   +  L+ ++G   T   LLP+ + 
Sbjct  197  NLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKGNTIEHLLPLFLA  256

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  257  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|NP_998541.1| serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit 
A beta isoform [Danio rerio]
 gb|AAH46055.1| Protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 
65), alpha isoform [Danio rerio]
Length=476

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA  N+ 
Sbjct  295  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATCNLM  354

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+ V G EIT   +LPV++ 
Sbjct  355  KLVEKFGAEWAQNTIVPKVLGMANDPNYLHRMTTLFCINALSEVCGQEITTKHMLPVVLK  414

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             S D+V N++FNVAK LQ + P++D S ++  ++P L +L+ D D+DV++FA +A+
Sbjct  415  MSNDQVANVRFNVAKSLQKIGPVLDSSCLQTEVKPVLEKLASDQDMDVKYFAQEAI  470


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 82/171 (48%), Gaps = 7/171 (4%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAAN VK   E
Sbjct  140  AEDKSWRVRYMVADKFSDLQKAVGPEITKNDLVPAFQNLLKDCEAEVR-AAANKVKEFCE  198

Query  594  EFGPEWA-----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVII  430
               PE +     M HI+P V E+++D +   +  +   +  L+ ++G + T   LLP+ +
Sbjct  199  NL-PEDSRETIIMTHILPCVKELVSDTNQHVKSALASVIMGLSTILGKDNTIEHLLPLFL  257

Query  429  TASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
               KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  258  AQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  308



>gb|KFH64368.1| protein phosphatase PP2A regulatory subunit A [Mortierella verticillata 
NRRL 6337]
Length=583

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 137/181 (76%), Gaps = 5/181 (3%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED+ WRVRLAII+YIPLLA+QLGV FFD+KLGALCM WL D V+SIR+AA  N++
Sbjct  401  IVELAEDKQWRVRLAIIDYIPLLATQLGVEFFDEKLGALCMSWLGDSVFSIREAATVNLR  460

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E FG EWA Q IIP+VL M   P+YLYRMT + A++ +AP + +E+  + ++P +  
Sbjct  461  KLTEVFGVEWARQTIIPKVLAMGTHPNYLYRMTTIFAITAMAPAVTAEVIRDYIMPTVTN  520

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVD-----HSVVEKTIRPCLVELSEDPDVDVRFFANQA  262
               D +PNI+FNVAK +++LIP++        +V++ ++P LV+LSEDPD DVRFFA +A
Sbjct  521  LVSDPIPNIRFNVAKSIEALIPVLSLNPDTKPLVDQQLKPALVKLSEDPDNDVRFFALKA  580

Query  261  L  259
            L
Sbjct  581  L  581


 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 84/164 (51%), Gaps = 0/164 (0%)
 Frame = -3

Query  768  DRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEEF  589
            D+ WRVR  I +    L+  +G     D L    ++ LKD    +R AAA  V   AE  
Sbjct  251  DKSWRVRYMIADNFVKLSKAVGQEITRDDLVVAFVRLLKDNEAEVRTAAAGQVPGFAELV  310

Query  588  GPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITASKDRV  409
              +  + +I+P V +++ D     R  +   +S LAP++G E T   LLP+ +   KD  
Sbjct  311  DKDTILSYILPCVKDLVTDTSQHVRAALAMQISGLAPILGKEATTEHLLPLFLQLLKDEF  370

Query  408  PNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            P+++ N+   L+++  ++   ++ +++ P +VEL+ED    VR 
Sbjct  371  PDVRLNIISKLETVNKVIGIELLSQSLLPAIVELAEDKQWRVRL  414



>ref|XP_004709032.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform [Echinops telfairi]
Length=410

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 131/176 (74%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+ 
Sbjct  229  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLM  288

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  289  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  348

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D   ++  +RP L  L +D D+DV++FA +A+
Sbjct  349  MAGDQVANVRFNVAKSLQKIGPILDTDALQGEVRPVLQRLGQDEDMDVKYFAQEAI  404


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 79/169 (47%), Gaps = 4/169 (2%)
 Frame = -3

Query  771  EDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAEE  592
            ED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E 
Sbjct  74   EDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELCEN  133

Query  591  FGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIITA  424
               E      M  I+P + E+++D +   +  +   +  L+ ++G E T   LLP+ +  
Sbjct  134  LPNEGRETIIMSQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQ  193

Query  423  SKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
             KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  194  LKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  242



>dbj|BAH11499.1| unnamed protein product [Homo sapiens]
Length=440

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  259  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  318

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  319  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  378

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  379  MAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  434


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 81/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+  RVR  + +    L   +G     + L       LKD    +R AAA+ VK L
Sbjct  101  QAAEDKSCRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKEL  160

Query  600  AEEFGPE----WAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E    E      M  I+P + E+++D +   +  +   +  L+ ++G E T   LLP+ 
Sbjct  161  GENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLF  220

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P+++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  221  LAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  272



>ref|XP_004413638.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Odobenus rosmarus 
divergens]
Length=474

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  293  IVELAEDAKWRVRLAIIEYMPLLAGQLGVQFFDEKLNSLCMAWLVDHVYAIREAATNNLM  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M  DP+YL+RMT L  +++L+   G EIT  ++LP+++ 
Sbjct  353  KLVKKFGTEWAQNTIVPKVLVMAGDPNYLHRMTTLFCINVLSEACGQEITTKQMLPIVLK  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D   +++ ++P L +L +D DVDV++FA +AL
Sbjct  413  MAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDEDVDVKYFAQEAL  468


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 81/170 (48%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  137  AEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELCE  196

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
               PE      M  I+P + E+++D +   +  +   +  L+ ++G E T   LLP+ + 
Sbjct  197  NLPPEGRETIIMNQILPFIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLA  256

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  257  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_003253172.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Nomascus leucogenys]
Length=474

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA NN+ 
Sbjct  293  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLM  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LP+++ 
Sbjct  353  KLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLK  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D+V N++FNVAK LQ + PI+D + ++  ++P L +L +D D+DV++FA +A+
Sbjct  413  MAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAI  468


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  137  AEDKSWRVRYMVADKFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGE  196

Query  594  EFGPE----WAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D     +  +   +  L+ ++G E T   LLP+ + 
Sbjct  197  NLSIEDRETIIMNQILPYIKELVSDTSQHVKSALASVIMGLSTILGKENTIEHLLPLFLA  256

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  257  QLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_004326180.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform isoform 5 [Tursiops truncatus]
Length=474

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA N + 
Sbjct  293  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNGLV  352

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L ++FG EWA   I+P+VL M NDP+YL+RMT L  ++ L+   G EIT  ++LPV++ 
Sbjct  353  KLVQKFGKEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPVVLK  412

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             ++D+V N++FNVAK LQ + P++D + +++ ++P L +L +D DVDV++FA +A+
Sbjct  413  MARDQVANVRFNVAKSLQKIGPVLDTNALQEEVKPVLQKLGQDEDVDVKYFAQEAI  468


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = -3

Query  774  AEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRLAE  595
            AED+ WRVR  + +    L   +G     + L       LKD    +R AAA+ VK L E
Sbjct  137  AEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELCE  196

Query  594  EFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
                E      M  I+P + E+++D +   +  +   +  L+ ++G   T   LLP+ + 
Sbjct  197  NLPMEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKGNTIEHLLPLFLA  256

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
              KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  257  QLKDECPEVRLNIISNLDCVNEVIGVRQLSQSLLPAIVELAEDAKWRVRL  306



>ref|XP_006868186.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A alpha isoform-like isoform X2 [Chrysochloris 
asiatica]
Length=532

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 134/176 (76%), Gaps = 0/176 (0%)
 Frame = -3

Query  786  IVELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVK  607
            IVELAED  WRVRLAIIEY+PLLA QLGV FFD+KL +LCM WL D VY+IR+AA +N+K
Sbjct  351  IVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLK  410

Query  606  RLAEEFGPEWAMQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVIIT  427
            +L E+FG EWA   IIP+VL M  DP+YL+RMT L  +++L+ V G +IT   +LP ++ 
Sbjct  411  KLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLR  470

Query  426  ASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRFFANQAL  259
             + D V N++FNVAK LQ + PI+D+S ++  ++P L +LS+D DVDV++FA +AL
Sbjct  471  MAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPVLEKLSQDQDVDVKYFAQEAL  526


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (47%), Gaps = 4/172 (2%)
 Frame = -3

Query  780  ELAEDRHWRVRLAIIEYIPLLASQLGVGFFDDKLGALCMQWLKDKVYSIRDAAANNVKRL  601
            + AED+ WRVR  + +    L   +G       L       +KD    +R AA++ VK  
Sbjct  193  QAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEF  252

Query  600  AEEFGPEWA----MQHIIPQVLEMINDPHYLYRMTILHAVSLLAPVMGSEITCNKLLPVI  433
             E    +      M  I+P + E+++D +   +  +   +  L+P++G + T   LLP+ 
Sbjct  253  CENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLF  312

Query  432  ITASKDRVPNIKFNVAKVLQSLIPIVDHSVVEKTIRPCLVELSEDPDVDVRF  277
            +   KD  P ++ N+   L  +  ++    + +++ P +VEL+ED    VR 
Sbjct  313  LAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRL  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1547783500360