BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014D11

Length=568
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610364.1|  PREDICTED: uncharacterized protein LOC104104077    291   2e-96   Nicotiana tomentosiformis
ref|XP_009795967.1|  PREDICTED: uncharacterized protein LOC104242589    286   2e-94   Nicotiana sylvestris
emb|CDP10783.1|  unnamed protein product                                264   8e-86   Coffea canephora [robusta coffee]
ref|XP_004251523.1|  PREDICTED: uncharacterized protein LOC101250189    259   4e-84   Solanum lycopersicum
ref|XP_006351969.1|  PREDICTED: B-cell receptor-associated protei...    259   7e-84   Solanum tuberosum [potatoes]
ref|XP_010549208.1|  PREDICTED: B-cell receptor-associated protei...    252   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_003605958.1|  hypothetical protein MTR_4g049540                  250   3e-80   Medicago truncatula
gb|KHN41234.1|  hypothetical protein glysoja_017278                     249   3e-80   Glycine soja [wild soybean]
ref|NP_001239654.1|  uncharacterized protein LOC100798727               249   5e-80   Glycine max [soybeans]
gb|AFK33681.1|  unknown                                                 249   6e-80   Medicago truncatula
gb|ACJ84514.1|  unknown                                                 248   2e-79   Medicago truncatula
ref|XP_010252455.1|  PREDICTED: uncharacterized protein LOC104594039    245   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010244479.1|  PREDICTED: B-cell receptor-associated protei...    245   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_003539858.1|  PREDICTED: B-cell receptor-associated protei...    244   3e-78   
gb|KHN21219.1|  hypothetical protein glysoja_006698                     244   4e-78   Glycine soja [wild soybean]
ref|XP_004506274.1|  PREDICTED: B-cell receptor-associated protei...    244   7e-78   Cicer arietinum [garbanzo]
ref|XP_006403381.1|  hypothetical protein EUTSA_v10003268mg             243   2e-77   Eutrema salsugineum [saltwater cress]
ref|XP_002270301.1|  PREDICTED: B-cell receptor-associated protei...    242   3e-77   Vitis vinifera
emb|CBI23212.3|  unnamed protein product                                239   5e-76   Vitis vinifera
ref|XP_002262807.2|  PREDICTED: B-cell receptor-associated protei...    239   7e-76   
ref|XP_010689493.1|  PREDICTED: B-cell receptor-associated protei...    238   1e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009123682.1|  PREDICTED: uncharacterized protein LOC103848551    235   1e-74   Brassica rapa
ref|XP_006447584.1|  hypothetical protein CICLE_v10016648mg             235   1e-74   Citrus clementina [clementine]
ref|XP_007132530.1|  hypothetical protein PHAVU_011G102200g             234   5e-74   Phaseolus vulgaris [French bean]
ref|XP_009587048.1|  PREDICTED: B-cell receptor-associated protei...    234   6e-74   Nicotiana tomentosiformis
gb|KFK32917.1|  hypothetical protein AALP_AA6G305900                    234   6e-74   Arabis alpina [alpine rockcress]
ref|NP_568607.1|  B-cell receptor-associated 31-like protein            233   7e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002863762.1|  hypothetical protein ARALYDRAFT_494776             233   9e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_006281077.1|  hypothetical protein CARUB_v10027105mg             233   9e-74   Capsella rubella
gb|AAM62748.1|  unknown                                                 233   2e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09328.1|  unnamed protein product                                233   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010494193.1|  PREDICTED: B-cell receptor-associated protei...    231   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_007149980.1|  hypothetical protein PHAVU_005G115800g             231   5e-73   Phaseolus vulgaris [French bean]
emb|CDY68895.1|  BnaCnng60970D                                          231   6e-73   Brassica napus [oilseed rape]
ref|XP_003540294.1|  PREDICTED: B-cell receptor-associated protei...    231   1e-72   Glycine max [soybeans]
ref|XP_002524828.1|  bcr-associated protein, bap, putative              229   2e-72   
ref|XP_010481979.1|  PREDICTED: B-cell receptor-associated protei...    229   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006449764.1|  hypothetical protein CICLE_v10016599mg             228   7e-72   
ref|XP_003543392.1|  PREDICTED: B-cell receptor-associated protei...    228   1e-71   Glycine max [soybeans]
ref|XP_010442176.1|  PREDICTED: B-cell receptor-associated protei...    227   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_007026129.1|  B-cell receptor-associated 31-like                 226   6e-71   
ref|XP_010046363.1|  PREDICTED: B-cell receptor-associated protei...    224   2e-70   Eucalyptus grandis [rose gum]
ref|XP_009629450.1|  PREDICTED: uncharacterized protein LOC104119606    224   5e-70   Nicotiana tomentosiformis
gb|KDO78297.1|  hypothetical protein CISIN_1g021727mg                   224   6e-70   Citrus sinensis [apfelsine]
ref|XP_006467408.1|  PREDICTED: B-cell receptor-associated protei...    223   9e-70   
ref|XP_006389583.1|  hypothetical protein POPTR_0021s00340g             223   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_006383887.1|  hypothetical protein POPTR_0004s00930g             223   1e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011096040.1|  PREDICTED: B-cell receptor-associated protei...    222   2e-69   Sesamum indicum [beniseed]
gb|KDO78296.1|  hypothetical protein CISIN_1g021727mg                   224   3e-69   Citrus sinensis [apfelsine]
ref|XP_006467407.1|  PREDICTED: B-cell receptor-associated protei...    222   3e-69   Citrus sinensis [apfelsine]
ref|XP_011046959.1|  PREDICTED: B-cell receptor-associated protei...    221   7e-69   Populus euphratica
gb|KDP20721.1|  hypothetical protein JCGZ_21192                         220   8e-69   Jatropha curcas
ref|XP_011008025.1|  PREDICTED: uncharacterized protein LOC105113519    220   9e-69   Populus euphratica
ref|XP_009797812.1|  PREDICTED: uncharacterized protein LOC104244159    220   1e-68   Nicotiana sylvestris
ref|XP_004231615.1|  PREDICTED: B-cell receptor-associated protei...    218   7e-68   Solanum lycopersicum
ref|XP_010099186.1|  B-cell receptor-associated protein 31              218   9e-68   
ref|XP_007046390.1|  B-cell receptor-associated 31-like                 217   2e-67   Theobroma cacao [chocolate]
ref|XP_004233786.1|  PREDICTED: uncharacterized protein LOC101255462    217   3e-67   Solanum lycopersicum
ref|XP_003534595.1|  PREDICTED: B-cell receptor-associated protei...    216   4e-67   Glycine max [soybeans]
gb|KJB68573.1|  hypothetical protein B456_010G251300                    216   4e-67   Gossypium raimondii
gb|ACU14586.1|  unknown                                                 216   6e-67   Glycine max [soybeans]
ref|XP_006348141.1|  PREDICTED: B-cell receptor-associated protei...    215   1e-66   Solanum tuberosum [potatoes]
gb|AFK47348.1|  unknown                                                 215   1e-66   Lotus japonicus
gb|KEH36901.1|  B-cell receptor-associated-like protein                 214   2e-66   Medicago truncatula
gb|AFK46642.1|  unknown                                                 214   5e-66   Medicago truncatula
ref|XP_006350475.1|  PREDICTED: B-cell receptor-associated protei...    213   7e-66   Solanum tuberosum [potatoes]
ref|NP_001236308.1|  uncharacterized protein LOC100526943               213   1e-65   Glycine max [soybeans]
gb|KHG10853.1|  B-cell receptor-associated 31                           212   2e-65   Gossypium arboreum [tree cotton]
gb|KHG15358.1|  B-cell receptor-associated 31                           212   2e-65   Gossypium arboreum [tree cotton]
gb|KFK40615.1|  hypothetical protein AALP_AA2G019200                    211   3e-65   Arabis alpina [alpine rockcress]
ref|XP_008440020.1|  PREDICTED: B-cell receptor-associated protei...    211   4e-65   Cucumis melo [Oriental melon]
gb|EYU27763.1|  hypothetical protein MIMGU_mgv1a012919mg                211   4e-65   Erythranthe guttata [common monkey flower]
gb|ACU19065.1|  unknown                                                 210   5e-65   Glycine max [soybeans]
gb|KJB69262.1|  hypothetical protein B456_011G013000                    210   9e-65   Gossypium raimondii
ref|XP_004486174.1|  PREDICTED: B-cell receptor-associated protei...    210   9e-65   
ref|XP_004151895.1|  PREDICTED: uncharacterized protein LOC101218101    209   2e-64   Cucumis sativus [cucumbers]
ref|XP_002518447.1|  bcr-associated protein, bap, putative              209   2e-64   Ricinus communis
ref|XP_004158560.1|  PREDICTED: uncharacterized LOC101218101            208   5e-64   
ref|XP_008224696.1|  PREDICTED: B-cell receptor-associated protei...    207   1e-63   Prunus mume [ume]
ref|XP_010458605.1|  PREDICTED: uncharacterized protein LOC104739838    207   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010493468.1|  PREDICTED: uncharacterized protein LOC104770706    207   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_004134773.1|  PREDICTED: uncharacterized protein LOC101221743    206   3e-63   Cucumis sativus [cucumbers]
emb|CDP04423.1|  unnamed protein product                                206   4e-63   Coffea canephora [robusta coffee]
gb|KFK35240.1|  hypothetical protein AALP_AA5G258500                    206   5e-63   Arabis alpina [alpine rockcress]
ref|XP_007212007.1|  hypothetical protein PRUPE_ppa011145mg             206   5e-63   Prunus persica
ref|XP_008784370.1|  PREDICTED: B-cell receptor-associated protei...    205   8e-63   Phoenix dactylifera
ref|XP_010476134.1|  PREDICTED: uncharacterized protein LOC104755448    205   9e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002889902.1|  hypothetical protein ARALYDRAFT_334480             204   2e-62   
ref|XP_006417293.1|  hypothetical protein EUTSA_v10008726mg             203   5e-62   Eutrema salsugineum [saltwater cress]
ref|NP_849648.4|  B-cell receptor-associated protein 31-like protein    203   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229967.1|  PREDICTED: B-cell receptor-associated protei...    202   1e-61   Prunus mume [ume]
ref|XP_007215939.1|  hypothetical protein PRUPE_ppa011161mg             201   3e-61   Prunus persica
emb|CDY34821.1|  BnaA09g47470D                                          201   4e-61   Brassica napus [oilseed rape]
ref|XP_010686812.1|  PREDICTED: B-cell receptor-associated protei...    201   4e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004293309.1|  PREDICTED: B-cell receptor-associated protei...    201   5e-61   Fragaria vesca subsp. vesca
ref|XP_008342021.1|  PREDICTED: B-cell receptor-associated protei...    199   2e-60   
ref|XP_009118164.1|  PREDICTED: uncharacterized protein LOC103843216    199   2e-60   Brassica rapa
ref|XP_008348138.1|  PREDICTED: B-cell receptor-associated protei...    199   2e-60   
ref|XP_009353295.1|  PREDICTED: B-cell receptor-associated protei...    197   2e-59   Pyrus x bretschneideri [bai li]
gb|KHN44866.1|  hypothetical protein glysoja_040795                     196   2e-59   Glycine soja [wild soybean]
ref|XP_009419329.1|  PREDICTED: B-cell receptor-associated protei...    196   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007147709.1|  hypothetical protein PHAVU_006G148100g             196   4e-59   Phaseolus vulgaris [French bean]
ref|XP_009347127.1|  PREDICTED: B-cell receptor-associated protei...    196   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_009403539.1|  PREDICTED: uncharacterized protein LOC103987073    195   6e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533802.1|  PREDICTED: uncharacterized protein LOC104809492    195   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_003596956.1|  hypothetical protein MTR_2g088060                  193   3e-58   Medicago truncatula
ref|XP_008780367.1|  PREDICTED: uncharacterized protein LOC103700158    192   1e-57   Phoenix dactylifera
ref|XP_010546686.1|  PREDICTED: uncharacterized protein LOC104818690    191   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_009390004.1|  PREDICTED: B-cell receptor-associated protei...    190   7e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006303826.1|  hypothetical protein CARUB_v10012392mg             189   1e-56   Capsella rubella
ref|XP_011047243.1|  PREDICTED: B-cell receptor-associated protei...    189   2e-56   Populus euphratica
ref|XP_002320470.1|  hypothetical protein POPTR_0014s15290g             188   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_010926189.1|  PREDICTED: uncharacterized protein LOC105048548    187   1e-55   Elaeis guineensis
emb|CDY34616.1|  BnaC08g41750D                                          187   1e-55   Brassica napus [oilseed rape]
ref|XP_010089483.1|  hypothetical protein L484_011937                   186   6e-55   
ref|XP_010916117.1|  PREDICTED: uncharacterized protein LOC105041025    185   7e-55   
ref|XP_008649481.1|  PREDICTED: uncharacterized protein LOC103630179    184   1e-54   Zea mays [maize]
ref|XP_006647215.1|  PREDICTED: B-cell receptor-associated protei...    184   1e-54   Oryza brachyantha
gb|EMT11422.1|  hypothetical protein F775_31561                         184   2e-54   
dbj|BAK02060.1|  predicted protein                                      183   4e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055067.1|  Os05g0272900                                       182   9e-54   
ref|NP_001046689.1|  Os02g0321800                                       182   9e-54   
ref|XP_006654198.1|  PREDICTED: B-cell receptor-associated protei...    181   2e-53   Oryza brachyantha
ref|XP_011086195.1|  PREDICTED: B-cell receptor-associated protei...    181   3e-53   Sesamum indicum [beniseed]
ref|XP_010234160.1|  PREDICTED: uncharacterized protein LOC100839925    180   5e-53   Brachypodium distachyon [annual false brome]
gb|EAY85610.1|  hypothetical protein OsI_06982                          180   6e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_010057913.1|  PREDICTED: B-cell receptor-associated protei...    180   7e-53   Eucalyptus grandis [rose gum]
ref|XP_004287957.1|  PREDICTED: B-cell receptor-associated protei...    179   9e-53   Fragaria vesca subsp. vesca
ref|XP_008384089.1|  PREDICTED: B-cell receptor-associated protei...    178   4e-52   
ref|NP_001170289.1|  LOC100384252                                       177   6e-52   Zea mays [maize]
gb|KHN36526.1|  ATP-dependent helicase rhp16                            189   7e-52   Glycine soja [wild soybean]
ref|XP_009358864.1|  PREDICTED: B-cell receptor-associated protei...    176   2e-51   Pyrus x bretschneideri [bai li]
ref|NP_001154328.1|  B-cell receptor-associated protein 31-like p...    176   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009357471.1|  PREDICTED: uncharacterized protein LOC103948199    175   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_004952370.1|  PREDICTED: B-cell receptor-associated protei...    174   1e-50   Setaria italica
ref|XP_008371075.1|  PREDICTED: B-cell receptor-associated protei...    173   2e-50   
ref|XP_003580219.1|  PREDICTED: B-cell receptor-associated protei...    170   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_006847259.1|  hypothetical protein AMTR_s00015p00062110          168   2e-48   
dbj|BAJ86435.1|  predicted protein                                      163   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002453641.1|  hypothetical protein SORBIDRAFT_04g009770          158   1e-44   Sorghum bicolor [broomcorn]
ref|XP_003563854.1|  PREDICTED: B-cell receptor-associated protei...    157   4e-44   Brachypodium distachyon [annual false brome]
gb|KHG00718.1|  separin                                                 154   2e-43   Gossypium arboreum [tree cotton]
gb|ADE75913.1|  unknown                                                 155   2e-43   Picea sitchensis
ref|NP_001057612.2|  Os06g0367500                                       154   2e-43   
gb|AAC17626.1|  Contains similarity to BAP31 protein gb|X81816 fr...    151   8e-42   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ87002.1|  predicted protein                                      149   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008229970.1|  PREDICTED: B-cell receptor-associated protei...    142   4e-38   Prunus mume [ume]
ref|XP_007215894.1|  hypothetical protein PRUPE_ppa010667mg             141   7e-38   Prunus persica
ref|NP_001051893.1|  Os03g0848400                                       140   1e-37   
ref|XP_006650891.1|  PREDICTED: B-cell receptor-associated protei...    140   2e-37   Oryza brachyantha
ref|XP_010247234.1|  PREDICTED: B-cell receptor-associated protei...    138   8e-37   Nelumbo nucifera [Indian lotus]
gb|EAY92582.1|  hypothetical protein OsI_14323                          137   1e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_006479253.1|  PREDICTED: B-cell receptor-associated protei...    137   3e-36   Citrus sinensis [apfelsine]
ref|XP_009802750.1|  PREDICTED: uncharacterized protein LOC104248228    134   4e-36   Nicotiana sylvestris
ref|XP_009779153.1|  PREDICTED: B-cell receptor-associated protei...    134   4e-36   Nicotiana sylvestris
gb|KHG09837.1|  hypothetical protein F383_09194                         136   5e-36   Gossypium arboreum [tree cotton]
ref|XP_009599718.1|  PREDICTED: uncharacterized protein LOC104095323    133   9e-36   Nicotiana tomentosiformis
ref|XP_006365288.1|  PREDICTED: uncharacterized protein LOC102597522    133   1e-35   Solanum tuberosum [potatoes]
ref|XP_004248701.1|  PREDICTED: uncharacterized protein LOC101261860    133   1e-35   Solanum lycopersicum
ref|XP_009381320.1|  PREDICTED: B-cell receptor-associated protei...    135   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009371858.1|  PREDICTED: B-cell receptor-associated protei...    134   3e-35   Pyrus x bretschneideri [bai li]
gb|ACN36491.1|  unknown                                                 132   4e-35   Zea mays [maize]
gb|EAZ03537.1|  hypothetical protein OsI_25672                          134   5e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_006830526.1|  hypothetical protein AMTR_s00117p00045900          134   5e-35   Amborella trichopoda
ref|XP_010069636.1|  PREDICTED: B-cell receptor-associated protei...    133   5e-35   Eucalyptus grandis [rose gum]
gb|KJB26033.1|  hypothetical protein B456_004G226500                    133   6e-35   Gossypium raimondii
gb|KJB10919.1|  hypothetical protein B456_001G232500                    133   8e-35   Gossypium raimondii
gb|ACG43219.1|  B-cell receptor-associated protein 31-like contai...    133   8e-35   Zea mays [maize]
ref|XP_002463520.1|  hypothetical protein SORBIDRAFT_01g001290          133   9e-35   Sorghum bicolor [broomcorn]
gb|KJB26032.1|  hypothetical protein B456_004G226500                    132   1e-34   Gossypium raimondii
ref|XP_009370674.1|  PREDICTED: B-cell receptor-associated protei...    132   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_008809940.1|  PREDICTED: B-cell receptor-associated protei...    132   1e-34   Phoenix dactylifera
ref|XP_008380294.1|  PREDICTED: uncharacterized protein LOC103443257    130   1e-34   
ref|XP_010927692.1|  PREDICTED: B-cell receptor-associated protei...    132   2e-34   Elaeis guineensis
ref|XP_006657620.1|  PREDICTED: B-cell receptor-associated protei...    132   3e-34   Oryza brachyantha
ref|NP_001141677.1|  uncharacterized protein LOC100273803 precursor     132   3e-34   
ref|XP_003562352.1|  PREDICTED: B-cell receptor-associated protei...    132   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_003532279.1|  PREDICTED: B-cell receptor-associated protei...    131   3e-34   Glycine max [soybeans]
ref|XP_008372494.1|  PREDICTED: B-cell receptor-associated protei...    131   4e-34   Malus domestica [apple tree]
gb|EMS49195.1|  hypothetical protein TRIUR3_29235                       129   7e-34   Triticum urartu
ref|XP_008382607.1|  PREDICTED: B-cell receptor-associated protei...    130   7e-34   
ref|XP_008226862.1|  PREDICTED: uncharacterized protein LOC103326424    128   8e-34   Prunus mume [ume]
ref|XP_007049723.1|  B-cell receptor-associated protein 31-like         130   1e-33   Theobroma cacao [chocolate]
ref|XP_008385961.1|  PREDICTED: uncharacterized protein LOC103448478    128   1e-33   
gb|EMT32966.1|  hypothetical protein F775_31670                         129   1e-33   
gb|KDP26363.1|  hypothetical protein JCGZ_17521                         129   2e-33   Jatropha curcas
ref|XP_006452411.1|  hypothetical protein CICLE_v10009874mg             127   2e-33   Citrus clementina [clementine]
ref|XP_007140653.1|  hypothetical protein PHAVU_008G130500g             129   3e-33   Phaseolus vulgaris [French bean]
ref|XP_009361097.1|  PREDICTED: uncharacterized protein LOC103951454    127   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_004981056.1|  PREDICTED: B-cell receptor-associated protei...    129   3e-33   Setaria italica
ref|XP_007134124.1|  hypothetical protein PHAVU_010G021100g             128   7e-33   Phaseolus vulgaris [French bean]
ref|XP_003552124.1|  PREDICTED: B-cell receptor-associated protei...    127   9e-33   Glycine max [soybeans]
ref|XP_008794596.1|  PREDICTED: B-cell receptor-associated protei...    127   1e-32   Phoenix dactylifera
gb|KDO62065.1|  hypothetical protein CISIN_1g045614mg                   124   1e-32   Citrus sinensis [apfelsine]
ref|XP_002303054.2|  hypothetical protein POPTR_0002s24670g             127   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008802267.1|  PREDICTED: B-cell receptor-associated protei...    127   2e-32   Phoenix dactylifera
emb|CDP15777.1|  unnamed protein product                                124   3e-32   Coffea canephora [robusta coffee]
gb|EYU27354.1|  hypothetical protein MIMGU_mgv1a015673mg                124   3e-32   Erythranthe guttata [common monkey flower]
ref|XP_002266257.2|  PREDICTED: B-cell receptor-associated protei...    126   3e-32   Vitis vinifera
ref|XP_009410623.1|  PREDICTED: B-cell receptor-associated protei...    126   3e-32   
ref|XP_004987306.1|  PREDICTED: uncharacterized protein LOC101775823    124   5e-32   Setaria italica
gb|ACG37455.1|  B-cell receptor-associated protein 31-like contai...    125   6e-32   Zea mays [maize]
ref|XP_011011172.1|  PREDICTED: uncharacterized protein LOC105115831    125   9e-32   Populus euphratica
ref|XP_006281079.1|  hypothetical protein CARUB_v10027107mg             125   1e-31   Capsella rubella
ref|NP_001136567.1|  uncharacterized LOC100216689 precursor             125   1e-31   Zea mays [maize]
gb|KHN38264.1|  hypothetical protein glysoja_003929                     122   1e-31   Glycine soja [wild soybean]
ref|XP_010685051.1|  PREDICTED: B-cell receptor-associated protei...    124   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006452412.1|  hypothetical protein CICLE_v10009874mg             122   2e-31   
ref|XP_010099686.1|  hypothetical protein L484_025117                   124   2e-31   Morus notabilis
ref|NP_001143481.1|  hypothetical protein                               122   3e-31   Zea mays [maize]
gb|KHN11907.1|  hypothetical protein glysoja_019880                     120   6e-31   Glycine soja [wild soybean]
gb|EMS58132.1|  hypothetical protein TRIUR3_00710                       121   1e-30   Triticum urartu
ref|XP_002863915.1|  hypothetical protein ARALYDRAFT_494932             121   2e-30   
ref|XP_008460368.1|  PREDICTED: B-cell receptor-associated protei...    121   3e-30   Cucumis melo [Oriental melon]
ref|XP_002437063.1|  hypothetical protein SORBIDRAFT_10g020520          119   4e-30   Sorghum bicolor [broomcorn]
ref|XP_004491710.1|  PREDICTED: B-cell receptor-associated protei...    120   5e-30   Cicer arietinum [garbanzo]
ref|XP_002521067.1|  bcr-associated protein, bap, putative              122   5e-30   
ref|XP_011095414.1|  PREDICTED: uncharacterized protein LOC105174881    118   5e-30   Sesamum indicum [beniseed]
ref|XP_010552045.1|  PREDICTED: B-cell receptor-associated protei...    120   6e-30   Tarenaya hassleriana [spider flower]
gb|KEH22623.1|  B-cell receptor-associated-like protein                 120   8e-30   Medicago truncatula
gb|KDO62066.1|  hypothetical protein CISIN_1g046403mg                   117   9e-30   Citrus sinensis [apfelsine]
ref|XP_010274041.1|  PREDICTED: B-cell receptor-associated protei...    120   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006452413.1|  hypothetical protein CICLE_v10009874mg             116   2e-29   
ref|XP_004491413.1|  PREDICTED: uncharacterized protein LOC101509893    116   3e-29   Cicer arietinum [garbanzo]
ref|XP_009151666.1|  PREDICTED: uncharacterized protein LOC103874978    118   4e-29   Brassica rapa
emb|CDX86287.1|  BnaA06g30040D                                          118   4e-29   
ref|XP_004144386.1|  PREDICTED: uncharacterized protein LOC101213598    118   4e-29   Cucumis sativus [cucumbers]
emb|CDX85356.1|  BnaC07g26670D                                          117   6e-29   
ref|XP_004295837.1|  PREDICTED: uncharacterized protein LOC101305253    115   8e-29   Fragaria vesca subsp. vesca
ref|XP_009388739.1|  PREDICTED: uncharacterized protein LOC103975489    114   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP39157.1|  hypothetical protein JCGZ_00914                         113   1e-28   Jatropha curcas
ref|XP_007216855.1|  hypothetical protein PRUPE_ppa021600mg             115   2e-28   
emb|CDP03896.1|  unnamed protein product                                116   2e-28   Coffea canephora [robusta coffee]
ref|XP_008235454.1|  PREDICTED: B-cell receptor-associated protei...    115   3e-28   Prunus mume [ume]
gb|EYU40619.1|  hypothetical protein MIMGU_mgv1a013665mg                115   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_011089080.1|  PREDICTED: uncharacterized protein LOC105170143    115   7e-28   Sesamum indicum [beniseed]
ref|XP_009775442.1|  PREDICTED: uncharacterized protein LOC104225364    114   9e-28   Nicotiana sylvestris
ref|XP_009610381.1|  PREDICTED: uncharacterized protein LOC104104089    114   2e-27   Nicotiana tomentosiformis
ref|XP_004963921.1|  PREDICTED: B-cell receptor-associated protei...    111   2e-27   
ref|XP_004290194.1|  PREDICTED: B-cell receptor-associated protei...    113   2e-27   Fragaria vesca subsp. vesca
ref|XP_006340009.1|  PREDICTED: B-cell receptor-associated protei...    112   6e-27   Solanum tuberosum [potatoes]
ref|XP_004247073.1|  PREDICTED: uncharacterized protein LOC101251810    111   2e-26   Solanum lycopersicum
ref|XP_008674143.1|  PREDICTED: B-cell receptor-associated protei...    112   2e-26   
ref|XP_010913045.1|  PREDICTED: B-cell receptor-associated protei...    111   2e-26   Elaeis guineensis
ref|XP_011024634.1|  PREDICTED: uncharacterized protein LOC105125752    110   4e-26   Populus euphratica
ref|XP_007020770.1|  F-box family protein with a domain of Unchar...    113   6e-26   
ref|XP_009778813.1|  PREDICTED: uncharacterized protein LOC104228107    106   1e-25   Nicotiana sylvestris
ref|XP_010063029.1|  PREDICTED: uncharacterized protein LOC104450...    107   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010464329.1|  PREDICTED: uncharacterized protein LOC104744901    108   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010493705.1|  PREDICTED: B-cell receptor-associated protei...    108   3e-25   Camelina sativa [gold-of-pleasure]
emb|CDY29829.1|  BnaC05g31610D                                          105   3e-25   Brassica napus [oilseed rape]
ref|XP_002317336.1|  hypothetical protein POPTR_0011s09140g             105   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009129743.1|  PREDICTED: uncharacterized protein LOC103854553    107   5e-25   Brassica rapa
emb|CDY51050.1|  BnaA02g30380D                                          107   6e-25   Brassica napus [oilseed rape]
ref|XP_006298783.1|  hypothetical protein CARUB_v10014885mg             104   8e-25   Capsella rubella
ref|XP_009145629.1|  PREDICTED: uncharacterized protein LOC103869321    104   9e-25   Brassica rapa
emb|CDY66080.1|  BnaCnng49520D                                          106   1e-24   Brassica napus [oilseed rape]
ref|NP_199677.1|  B-cell receptor-associated protein 31-like protein    105   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395148.1|  hypothetical protein EUTSA_v10004894mg             105   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_010508923.1|  PREDICTED: uncharacterized protein LOC104785412    103   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010488019.1|  PREDICTED: uncharacterized protein LOC104765923    103   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_004142754.1|  PREDICTED: uncharacterized protein LOC101213037    102   3e-24   
ref|XP_010466234.1|  PREDICTED: uncharacterized protein LOC104746450    103   4e-24   Camelina sativa [gold-of-pleasure]
gb|EPS57633.1|  hypothetical protein M569_17183                         104   4e-24   Genlisea aurea
ref|XP_008458888.1|  PREDICTED: uncharacterized protein LOC103498158    101   1e-23   Cucumis melo [Oriental melon]
ref|XP_011013138.1|  PREDICTED: uncharacterized protein LOC105117241    101   2e-23   Populus euphratica
ref|XP_010666200.1|  PREDICTED: uncharacterized protein LOC104883381    101   2e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK39354.1|  hypothetical protein AALP_AA3G233700                    100   3e-23   Arabis alpina [alpine rockcress]
gb|EPS63018.1|  hypothetical protein M569_11771                         100   3e-23   Genlisea aurea
ref|NP_566662.1|  B-cell receptor-associated protein 31-like protein    100   4e-23   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67164.1|  unknown                                               99.8    7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406381.1|  hypothetical protein EUTSA_v10021737mg           99.8    7e-23   Eutrema salsugineum [saltwater cress]
ref|XP_007201384.1|  hypothetical protein PRUPE_ppa012189mg             100   8e-23   
ref|XP_008455897.1|  PREDICTED: B-cell receptor-associated protei...  98.6    9e-23   Cucumis melo [Oriental melon]
ref|XP_007142305.1|  hypothetical protein PHAVU_008G269400g             100   1e-22   Phaseolus vulgaris [French bean]
gb|KFK38172.1|  hypothetical protein AALP_AA3G078300                    100   3e-22   Arabis alpina [alpine rockcress]
ref|XP_002862714.1|  hypothetical protein ARALYDRAFT_497321           97.4    6e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_002885374.1|  hypothetical protein ARALYDRAFT_479569           97.1    6e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_008467068.1|  PREDICTED: uncharacterized protein LOC103504505  97.1    6e-22   
ref|XP_002884632.1|  hypothetical protein ARALYDRAFT_478041           99.0    7e-22   
ref|XP_009616881.1|  PREDICTED: uncharacterized protein LOC104109325  99.8    1e-21   
ref|XP_010545515.1|  PREDICTED: uncharacterized protein LOC104817861  96.3    1e-21   
gb|KDP22731.1|  hypothetical protein JCGZ_01833                       98.2    2e-21   
ref|XP_009795272.1|  PREDICTED: uncharacterized protein LOC104241998  98.2    3e-21   
ref|XP_006409380.1|  hypothetical protein EUTSA_v10022940mg           93.6    5e-21   
ref|XP_010486262.1|  PREDICTED: B-cell receptor-associated protei...  97.1    5e-21   
ref|XP_010449720.1|  PREDICTED: B-cell receptor-associated protei...  97.1    5e-21   
ref|XP_006407860.1|  hypothetical protein EUTSA_v10021483mg           94.7    3e-20   
gb|EMS47744.1|  hypothetical protein TRIUR3_06470                     95.5    3e-20   
ref|XP_002529922.1|  bcr-associated protein, bap, putative            94.7    4e-20   
ref|NP_187375.1|  B-cell receptor-associated protein 31-like protein  94.4    4e-20   
gb|AFW70952.1|  hypothetical protein ZEAMMB73_233499                  91.7    9e-20   
gb|EMT23366.1|  hypothetical protein F775_19324                       92.0    5e-19   
gb|ACU15885.1|  unknown                                               86.3    5e-18   
ref|XP_010096876.1|  hypothetical protein L484_008070                 84.7    1e-17   
ref|XP_007212356.1|  hypothetical protein PRUPE_ppa014571mg           82.8    5e-17   
emb|CBI29413.3|  unnamed protein product                              82.8    2e-16   
ref|XP_003617596.1|  hypothetical protein MTR_5g093360                81.6    2e-16   
emb|CBI28815.3|  unnamed protein product                              75.5    3e-14   
gb|EMT13188.1|  hypothetical protein F775_28124                       76.3    8e-14   
gb|AFW71006.1|  hypothetical protein ZEAMMB73_389553                  70.9    2e-12   
ref|XP_010063030.1|  PREDICTED: uncharacterized protein LOC104450...  70.5    2e-12   
ref|XP_006443576.1|  hypothetical protein CICLE_v100221651mg          71.2    2e-12   
gb|EYU39202.1|  hypothetical protein MIMGU_mgv1a024213mg              72.0    2e-12   
ref|XP_006375656.1|  hypothetical protein POPTR_0014s18880g           70.5    5e-12   
ref|XP_006342256.1|  PREDICTED: uncharacterized protein LOC102584894  71.2    9e-12   
ref|XP_010466235.1|  PREDICTED: uncharacterized protein LOC104746451  68.2    2e-11   
gb|KJB13716.1|  hypothetical protein B456_002G090900                  67.0    8e-11   
ref|XP_004240151.1|  PREDICTED: uncharacterized protein LOC101249367  67.0    3e-10   
emb|CAN62540.1|  hypothetical protein VITISV_031161                   63.9    7e-10   
ref|XP_006443575.1|  hypothetical protein CICLE_v100221652mg          62.4    1e-09   
ref|XP_006479254.1|  PREDICTED: B-cell receptor-associated protei...  62.8    2e-09   
gb|KJB13713.1|  hypothetical protein B456_002G090600                  59.7    2e-08   
ref|XP_008353105.1|  PREDICTED: uncharacterized protein LOC103416652  59.7    2e-08   
ref|XP_006375655.1|  hypothetical protein POPTR_0014s18870g           59.3    2e-08   
emb|CDX71552.1|  BnaC04g17870D                                        57.0    5e-08   
ref|NP_001175145.1|  Os07g0291200                                     58.5    6e-08   
ref|XP_008646901.1|  PREDICTED: uncharacterized protein LOC103628485  55.5    4e-07   
gb|AFW77084.1|  hypothetical protein ZEAMMB73_955327                  55.5    4e-07   
gb|AFW77083.1|  hypothetical protein ZEAMMB73_955327                  55.1    6e-07   
ref|XP_008230042.1|  PREDICTED: uncharacterized protein LOC103329358  54.3    1e-06   
gb|AEW09002.1|  hypothetical protein CL3091Contig1_06                 53.5    2e-06   
gb|AFG56242.1|  hypothetical protein CL3091Contig1_06                 52.0    5e-06   
gb|AFW77085.1|  hypothetical protein ZEAMMB73_955327                  51.6    8e-06   
gb|EMT13189.1|  hypothetical protein F775_28125                       50.8    2e-05   
emb|CBI23214.3|  unnamed protein product                              50.1    5e-05   
ref|XP_002974412.1|  hypothetical protein SELMODRAFT_271069           49.3    5e-04   
ref|XP_002985711.1|  hypothetical protein SELMODRAFT_229134           48.5    7e-04   



>ref|XP_009610364.1| PREDICTED: uncharacterized protein LOC104104077 [Nicotiana tomentosiformis]
Length=219

 Score =   291 bits (744),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 169/189 (89%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQV  389
            FKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP +++NPTDQ+
Sbjct  24   FKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPTDTVNPTDQI  83

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  209
            LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEAAKK DR  DNGKNG   E 
Sbjct  84   LLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAAKKQDRALDNGKNG---EA  140

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
            ++LK+EI+S+++K+++LESE EAK +EVK+QK NS+S KGQSEKLLLEY +LLEENQ+LR
Sbjct  141  SNLKDEISSLRNKVRQLESENEAKEKEVKSQKANSDSLKGQSEKLLLEYDRLLEENQNLR  200

Query  28   SQLHALDEN  2
            SQL ++D+N
Sbjct  201  SQLQSVDQN  209



>ref|XP_009795967.1| PREDICTED: uncharacterized protein LOC104242589 [Nicotiana sylvestris]
Length=219

 Score =   286 bits (731),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 168/189 (89%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQV  389
            FKTPLRKL+I++LDR KRGRGPL+VKSVAATV V+MIYTVYS++E+QSRP +++NPTDQ+
Sbjct  24   FKTPLRKLIIMTLDRVKRGRGPLIVKSVAATVLVIMIYTVYSIRELQSRPTDTVNPTDQI  83

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  209
            LLA QILQA+LMGF LFL LM+DRLHHYIRELRLLRK MEA KK DR  DNGKNG   E 
Sbjct  84   LLAHQILQAALMGFCLFLGLMVDRLHHYIRELRLLRKTMEAVKKQDRALDNGKNG---EA  140

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
            ++LK+EI+S+++K+++LES+ EAK +EVK+QK NS+S KGQSEKLLLEY +LLEENQ+LR
Sbjct  141  SNLKDEISSLRNKVRQLESDNEAKEKEVKSQKANSDSLKGQSEKLLLEYDRLLEENQNLR  200

Query  28   SQLHALDEN  2
            SQL ++++N
Sbjct  201  SQLQSVEQN  209



>emb|CDP10783.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   264 bits (674),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 154/189 (81%), Gaps = 0/189 (0%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQV  389
            FKTPLRKL I++LDR KRG GPLVVKSV ATV V+M Y+VY+++E+ SRP+ES NPTDQV
Sbjct  21   FKTPLRKLEIMALDRVKRGSGPLVVKSVGATVLVMMTYSVYTIRELNSRPVESFNPTDQV  80

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  209
            LLA ++L  SLMGF LFL+LMIDRLHHYIRELR+LRK MEAAKK  R  D GK     EV
Sbjct  81   LLAYEVLDTSLMGFSLFLALMIDRLHHYIRELRILRKTMEAAKKQSREVDEGKKANGAEV  140

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
            N+LKEE+ +MK+ I  LESEC+AK +E+KA + NSES K QSE LLLEY +LLE+NQ LR
Sbjct  141  NALKEEVTAMKTMINILESECKAKEKELKAAESNSESLKKQSEGLLLEYDRLLEDNQSLR  200

Query  28   SQLHALDEN  2
            SQLH+LD++
Sbjct  201  SQLHSLDQS  209



>ref|XP_004251523.1| PREDICTED: uncharacterized protein LOC101250189 [Solanum lycopersicum]
Length=219

 Score =   259 bits (663),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 165/189 (87%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQV  389
            F+TPLRKL+I+SLDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP +S+NPTDQ+
Sbjct  24   FRTPLRKLIIMSLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPADSVNPTDQI  83

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  209
            LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLRK MEA KK DR  DN KNG   E 
Sbjct  84   LLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRKTMEAVKKQDRTLDNIKNG---EA  140

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
            ++L++EI+S+++++K+LESE EAK +EV++Q+ NS+S KGQSEKLLLEY ++LEENQ+LR
Sbjct  141  STLRDEISSLRNRMKQLESESEAKEKEVQSQRANSDSLKGQSEKLLLEYDRILEENQNLR  200

Query  28   SQLHALDEN  2
            SQL ++D+ 
Sbjct  201  SQLQSVDDT  209



>ref|XP_006351969.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=219

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 165/189 (87%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQV  389
            F+TPLRKL+I++LDR KRG GPL+VKSVAATV V+MIYTVYS++E+QSRP +S+NPTDQ+
Sbjct  24   FRTPLRKLIIMTLDRVKRGSGPLIVKSVAATVLVIMIYTVYSIKELQSRPADSVNPTDQI  83

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEV  209
            LLA QIL+A+LMGF LFL LMIDRLHHYIRELRLLR+ MEA KK DR  DN KNG   E 
Sbjct  84   LLAHQILEAALMGFSLFLGLMIDRLHHYIRELRLLRRTMEAVKKQDRTLDNIKNG---EA  140

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
            ++L++EI+S+++K+K+LESE EAK EEV++Q+ NS+S KGQSEKLLLEY ++LEENQ+LR
Sbjct  141  STLRDEISSLRNKMKQLESESEAKEEEVQSQRANSDSLKGQSEKLLLEYDRILEENQNLR  200

Query  28   SQLHALDEN  2
            SQL ++D+ 
Sbjct  201  SQLQSVDQT  209



>ref|XP_010549208.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
 ref|XP_010549209.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=218

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++LDR KRGRGP+VVK++A TVFV+++ +VYS+ +IQ   +ES  ++PTD
Sbjct  21   FKTPLRKLVIMTLDRIKRGRGPVVVKTIATTVFVVLLSSVYSILKIQRGSVESGVLSPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L+A+ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   E
Sbjct  81   QILMAKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNASAE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EE+A++K+KIK+LESECE KG+E+K+ +  +E+ + Q++  LLEY +LLE+NQ+
Sbjct  141  EVKALGEEVAALKAKIKRLESECETKGKELKSAQAETEALRKQADGFLLEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LR+QL ++D+ 
Sbjct  201  LRNQLESIDQG  211



>ref|XP_003605958.1| hypothetical protein MTR_4g049540 [Medicago truncatula]
 gb|AES88155.1| B-cell receptor-associated-like protein [Medicago truncatula]
 gb|AFK41440.1| unknown [Medicago truncatula]
Length=221

 Score =   250 bits (638),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGSTE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ+
Sbjct  141  EQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLMEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D++
Sbjct  201  LRSQLEAIDQS  211



>gb|KHN41234.1| hypothetical protein glysoja_017278 [Glycine soja]
Length=213

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG +E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ 
Sbjct  141  EHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLEDNQS  200

Query  34   LRSQLHALDEN  2
            LRSQL A+++N
Sbjct  201  LRSQLQAIEQN  211



>ref|NP_001239654.1| uncharacterized protein LOC100798727 [Glycine max]
 gb|ACU21248.1| unknown [Glycine max]
Length=213

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKIQQRTLEAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG +E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ 
Sbjct  141  EHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLEDNQS  200

Query  34   LRSQLHALDEN  2
            LRSQL A+++N
Sbjct  201  LRSQLQAIEQN  211



>gb|AFK33681.1| unknown [Medicago truncatula]
Length=221

 Score =   249 bits (635),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGSTE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE   LEY +LLE+NQ+
Sbjct  141  EQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFFLEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D++
Sbjct  201  LRSQLEAIDQS  211



>gb|ACJ84514.1| unknown [Medicago truncatula]
Length=221

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLIVVLSSSLYSMAKIQQRTVEAGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK  EA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTTEAVKKQTRSFEDGKNGSTE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSK+KKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ+
Sbjct  141  EQKALTEEITTLKSKVKKLESECEAKGTKEKTLETEVEALKKQSEGFLMEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D++
Sbjct  201  LRSQLEAIDQS  211



>ref|XP_010252455.1| PREDICTED: uncharacterized protein LOC104594039 [Nelumbo nucifera]
Length=222

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 159/190 (84%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGP++VK+V  T+ V+++ +VYS+ +IQ+R ++S   +NPT
Sbjct  21   FKTPLRKLIIMGLDRVKRGRGPVMVKTVCGTILVVLLSSVYSMTKIQNRSMDSAGIVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK+MEA KK +RGF++GKNGG 
Sbjct  81   DQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKSMEAVKKQNRGFEDGKNGGP  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            E+  +L+EE AS+++K+K+LES+ EAK +E KA + N+E+ K QSE  LLEY +LLE+NQ
Sbjct  141  EDTKALEEERASLRAKVKELESKFEAKTKETKAAEANAEALKKQSEGFLLEYDRLLEDNQ  200

Query  37   HLRSQLHALD  8
             LR+QL ++D
Sbjct  201  SLRNQLQSID  210



>ref|XP_010244479.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=222

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 159/190 (84%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R +++   +NPT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVFVVLLSSVYSMMKIQKRSMDAAVVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+ASLMGF LFL+LMIDRLHHYIRELRLLRK MEA KK +RGF++GKNG  
Sbjct  81   DQVLMAKHLLEASLMGFSLFLALMIDRLHHYIRELRLLRKGMEAIKKQNRGFEDGKNGVA  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE  +L+EE+A+++ K+K+LESECE + +E+K  + N+ + + QSE +LLEY +L+E+NQ
Sbjct  141  EETKALEEEMANLRGKVKQLESECEVQTKELKTAEANTVALRKQSEGILLEYDRLMEDNQ  200

Query  37   HLRSQLHALD  8
            +LR+QL ++D
Sbjct  201  NLRNQLQSID  210



>ref|XP_003539858.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   244 bits (624),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ 
Sbjct  141  EHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLMEYDRLLEDNQS  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D++
Sbjct  201  LRSQLQAIDQS  211



>gb|KHN21219.1| hypothetical protein glysoja_006698 [Glycine soja]
Length=221

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K QSE  L+EY +LLE+NQ 
Sbjct  141  EHKALNEEITALKSKIKKLESECEAKGSQAKTLETEVEALKKQSEGFLMEYDRLLEDNQS  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D++
Sbjct  201  LRSQLQAIDQS  211



>ref|XP_004506274.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=221

 Score =   244 bits (622),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R +E+  INPTD
Sbjct  21   FKTPLRKLVIVSLDRVKRGRGPIVVTTVGATLVVVLSSSLYSMAKIQQRTIEAGIINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFMLFLSLMIDRLHHYIRELRLLRKTMEAVKKQTRSFEDGKNGNTE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI ++KSK+K LESECE+KG + K      E+ K QSE  L+EY +LLE+NQ+
Sbjct  141  EQKALAEEITTLKSKVKMLESECESKGNKEKTLHTEVEALKKQSEGFLMEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL  +D++
Sbjct  201  LRSQLETMDQS  211



>ref|XP_006403381.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
 gb|ESQ44834.1| hypothetical protein EUTSA_v10003268mg [Eutrema salsugineum]
Length=218

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R  +  ++NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRSEDGAALNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   E
Sbjct  81   QVLASKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++KSKI KLESE E+KG+E+K  +  +E+ + Q++  L+EY +LLE+NQ+
Sbjct  141  EVKALVEEIAALKSKIGKLESESESKGKELKGARAETEALRKQADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LR+QL ++D++
Sbjct  201  LRNQLESIDQS  211



>ref|XP_002270301.1| PREDICTED: B-cell receptor-associated protein 31-like [Vitis 
vinifera]
Length=214

 Score =   242 bits (617),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL++++LDR KRGRGP++ ++VA TVFV+++ +VYS+ +IQ+R +E   INPTD
Sbjct  21   FKTPLRKLVVMALDRVKRGRGPIMAQTVATTVFVVLMSSVYSMMKIQNRSVEPGLINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+A+ +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRKAMEA KK +RGF++GKNG  E
Sbjct  81   QVLMARHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKAMEAEKKQNRGFEDGKNGRAE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  ++ EE++S++++IKKLESECE K +E +A + N+ + K QSE  LLEY +LLEENQ+
Sbjct  141  EAKAMGEEMSSLRTQIKKLESECETKAKEAEAAEANTVALKKQSEGFLLEYDRLLEENQN  200

Query  34   LRSQLHALDE  5
            L+SQL ++D+
Sbjct  201  LKSQLESIDQ  210



>emb|CBI23212.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   239 bits (610),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R ++   +NPTD
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRGIDDDVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RGF++GK GG  
Sbjct  81   QVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRGFEDGKTGGSA  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLEY +LLEENQ+
Sbjct  141  EIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLEYDRLLEENQN  200

Query  34   LRSQLHALD  8
            LR+QL +LD
Sbjct  201  LRNQLQSLD  209



>ref|XP_002262807.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=248

 Score =   239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+ LDR KRGRGP++VK+VAATV V++I +VYS+ +I+ R ++   +NPTD
Sbjct  48   FKTPLRKLVIMGLDRVKRGRGPIMVKTVAATVLVVLISSVYSMMKIRKRGIDDDVVNPTD  107

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+A+ +L+ SLMGF LFL+LMIDRLHHYIRELRL RK+MEA KK +RGF++GK GG  
Sbjct  108  QVLMAKHLLETSLMGFTLFLALMIDRLHHYIRELRLRRKSMEAIKKQNRGFEDGKTGGSA  167

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +++EE+A++ +K+K+LESE E K +E KA + N+ + + QSE  LLEY +LLEENQ+
Sbjct  168  EIKAMEEEMAALGAKLKQLESEIETKTKEAKAAETNAVALRKQSEGFLLEYDRLLEENQN  227

Query  34   LRSQLHALD  8
            LR+QL +LD
Sbjct  228  LRNQLQSLD  236



>ref|XP_010689493.1| PREDICTED: B-cell receptor-associated protein 31 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+TPLRKL+I+ LDR KRGRGP+V+ +V  T+ VL++ T+ ++  IQ R +E  +INPTD
Sbjct  21   FRTPLRKLVILGLDRMKRGRGPIVITTVGGTILVLLVTTISTIVNIQQRDIEPGTINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L  + +L ASLMGF+LFL LM+DRLHHYIRELRLLRK MEA KK +R FD+ KNG  E
Sbjct  81   QILFTRSLLDASLMGFILFLGLMMDRLHHYIRELRLLRKTMEAVKKQNRSFDDAKNGSSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +++EE+A++KS+IK +ESEC AK +E+KA +  SE+ K QSE LLLEY +LLE+NQ 
Sbjct  141  ELKAMEEEVATLKSRIKTMESECVAKTDEIKASESKSEALKKQSEGLLLEYDRLLEDNQS  200

Query  34   LRSQLHALDEN  2
            LR QL  + ++
Sbjct  201  LRGQLEEIGQS  211



>ref|XP_009123682.1| PREDICTED: uncharacterized protein LOC103848551 [Brassica rapa]
 emb|CDY02396.1| BnaA02g23050D [Brassica napus]
Length=218

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 153/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV++I +VYS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLISSVYSLLSIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R F++GKN   E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRSFEDGKNTNGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+EY +LLE+NQ+
Sbjct  141  EVKALGEEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_006447584.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 ref|XP_006469667.1| PREDICTED: B-cell receptor-associated protein 31-like [Citrus 
sinensis]
 gb|ESR60824.1| hypothetical protein CICLE_v10016648mg [Citrus clementina]
 gb|KDO54706.1| hypothetical protein CISIN_1g027898mg [Citrus sinensis]
Length=217

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLDR KRGRGP+VVK+V  T+F++++ +VYS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIMSLDRVKRGRGPVVVKTVGGTLFIVLMSSVYSILKIQQRTLETGALNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L+++ +L+ASLMGF+LFLSLM+DRLHHYIRELRLLRKAMEAAKK  R F++GKN  V+
Sbjct  81   QILMSKHMLEASLMGFLLFLSLMMDRLHHYIRELRLLRKAMEAAKKQTRSFEDGKNDNVD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E   L ++IA++K+KIKKLESECE K +E  A K  +E+ K QSE  LLEY +LL +NQH
Sbjct  141  ERKGLGDDIATLKTKIKKLESECEMKDKEANAAKAEAEALKKQSEGFLLEYDRLLADNQH  200

Query  34   LRSQLHALDEN  2
            LR+QL ++D +
Sbjct  201  LRNQLESIDHS  211



>ref|XP_007132530.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
 gb|ESW04524.1| hypothetical protein PHAVU_011G102200g [Phaseolus vulgaris]
Length=212

 Score =   234 bits (596),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 148/191 (77%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKT LRKL+IISLDR KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTSLRKLVIISLDRVKRGRGPIVVSTVGATLVVVLSSSLYSMTKIQQRTLEAGILNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELRLLRK  E  KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRLLRKTNEVIKKQSRSFEDGKNGNAE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L  EIA++KSKIKKLESECE KG E K  +   E  K QSE  L+EY +LLE+NQ 
Sbjct  141  EQKTLT-EIATLKSKIKKLESECETKGNEAKTLETEVEVLKKQSEGFLMEYDRLLEDNQS  199

Query  34   LRSQLHALDEN  2
            LRSQL  ++++
Sbjct  200  LRSQLQVIEQS  210



>ref|XP_009587048.1| PREDICTED: B-cell receptor-associated protein 31 [Nicotiana tomentosiformis]
Length=222

 Score =   234 bits (596),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP++VK+VA T+FV+M+ T+YS+  I++R ++    I PT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTLFVVMLSTIYSIASIRTRWMDEGGDITPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R F++GK+G  
Sbjct  81   DQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNRAFEDGKSGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +L+EE ++++ KIK+LESE + K +E    + N+ + K QSE  LLEY +LLEENQ
Sbjct  141  EEIKTLEEEASALRGKIKQLESELQEKAKEASGAEANAVALKKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALDEN  2
            +LRSQL +LD  
Sbjct  201  NLRSQLQSLDRT  212



>gb|KFK32917.1| hypothetical protein AALP_AA6G305900 [Arabis alpina]
Length=218

 Score =   234 bits (596),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ ++YS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLMSSLYSLLNIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+K KKLES+ E+KG+E+K+ +  +E+ + Q++  LLEY +LLE+NQ+
Sbjct  141  EVKALGEEIAALKAKNKKLESDSESKGKELKSAQAETEALRKQADGFLLEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            L++QL ++D++
Sbjct  201  LKNQLDSIDQS  211



>ref|NP_568607.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
 gb|AAK96684.1| Unknown protein [Arabidopsis thaliana]
 gb|ABD43004.1| At5g42570 [Arabidopsis thaliana]
 gb|AED94830.1| B-cell receptor-associated 31-like protein [Arabidopsis thaliana]
Length=218

 Score =   233 bits (595),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LLE+NQ+
Sbjct  141  EVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_002863762.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40021.1| hypothetical protein ARALYDRAFT_494776 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   233 bits (594),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 154/188 (82%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVF++++ ++YS+ +IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGITVFIVLLSSIYSLVKIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GKN   E
Sbjct  81   QVLASKYLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKNTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV ++ EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LLE+NQ+
Sbjct  141  EVKAIGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESV  208



>ref|XP_006281077.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
 gb|EOA13975.1| hypothetical protein CARUB_v10027105mg [Capsella rubella]
Length=218

 Score =   233 bits (594),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ D+ KRGRGP+VVK++  TVFV+++ +VYS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDKIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEI ++K+KIK LESE E+KG+E+K  K  +E+ + Q++  LLEY +LLE+NQ+
Sbjct  141  EVKALGEEIVALKTKIKTLESESESKGKELKGAKGETEALRKQADGFLLEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>gb|AAM62748.1| unknown [Arabidopsis thaliana]
Length=218

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + QS+  L+EY +LLE+N++
Sbjct  141  EVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQSDGFLMEYDRLLEDNRN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>dbj|BAB09328.1| unnamed protein product [Arabidopsis thaliana]
Length=252

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ ++YS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSIYSLVNIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+KIK LESE E+KG+E+K  +  +E+ + Q++  L+EY +LLE+NQ+
Sbjct  141  EVKALGEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_010494193.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLINIRRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY +LLE+NQ+
Sbjct  141  EVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_007149980.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
 gb|ESW21974.1| hypothetical protein PHAVU_005G115800g [Phaseolus vulgaris]
Length=221

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +IQ R L++  +NPTD
Sbjct  21   FKTPARKLVILTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIQRRSLDASVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++  L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK MEAAKK  R F++GK+    
Sbjct  81   QVLVSKHTLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMEAAKKQSRSFEDGKSVSAA  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEI+  K++++KLESECE K  + K  +   E+ + QSE  L+EY +LLE+NQ+
Sbjct  141  EHKALVEEISGFKAEVEKLESECEVKASKAKTLEAEVEALRKQSEGFLMEYDRLLEDNQN  200

Query  34   LRSQLHALD  8
            LRSQL A+D
Sbjct  201  LRSQLQAID  209



>emb|CDY68895.1| BnaCnng60970D [Brassica napus]
Length=218

 Score =   231 bits (589),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 152/188 (81%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++ ATVFV+++ +VYS+  IQ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGATVFVVLMSSVYSLLSIQRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +R F++GKN   E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRSFEDGKNTNGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L  EIA +K+KIKKLESE E+KG+E+K+ +  +E+ +  ++  L+EY +LLE+NQ+
Sbjct  141  EVKALGGEIAVLKAKIKKLESESESKGKELKSAQAETEALRKSADGFLMEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_003540294.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKL+II+LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R L++  +NPTD
Sbjct  21   FKTPARKLVIITLDRVKRGRGPVVVKTVAATLLVVLASSLYSIAKIRRRNLDAPVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F++GK+    
Sbjct  81   QVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEDGKSVSAA  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL +NQ+
Sbjct  141  EHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL A+D +
Sbjct  201  LRSQLQAIDHS  211



>ref|XP_002524828.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF37548.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=209

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I+SLDR KRGRGP++VK+V  TVFV+++ +VYS+ +IQ+R +E  ++NPTD
Sbjct  9    FKTPLRKLVIMSLDRVKRGRGPVMVKTVGGTVFVVLLSSVYSMVKIQNRTIEGGAVNPTD  68

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELR+LRK MEAAKK  RGF++GKNG  +
Sbjct  69   QVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRILRKTMEAAKKQSRGFEDGKNGSAD  128

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EE+ ++++KIK LES+ E K +E KA +   E+ + QSE  L+EYG+LLE+NQ+
Sbjct  129  EAKALGEEVKTLQNKIKYLESKFEEKAKEAKAAEAEVEALRKQSEVFLIEYGRLLEDNQN  188

Query  34   LRSQLHALDEN  2
            LR+QL ++D++
Sbjct  189  LRNQLESMDQS  199



>ref|XP_010481979.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   229 bits (583),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  T+FV+++ +VY +  I+ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTLFVVLLSSVYGLVNIRRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME+AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMESAKKQNRGFEDGKTKSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA++K+KIK +ESE E KG+E+K  K  +E+ + Q++  LLEY +LLE+NQ+
Sbjct  141  EVKALGEEIAALKAKIKTVESESEGKGKELKEAKGETEALRKQADGFLLEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_006449764.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
 gb|ESR63004.1| hypothetical protein CICLE_v10016599mg [Citrus clementina]
Length=223

 Score =   228 bits (582),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 147/191 (77%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INP  401
            FKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NP
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK  G
Sbjct  81   TDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAG  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             EE+ +L++++ ++KSK+K+LESE E K +E  A + N+ + + QSE  L EY +LLEEN
Sbjct  141  SEEIKALEDQMTTLKSKLKELESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_003543392.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
Length=221

 Score =   228 bits (580),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKL+I++LDR KRGRGP+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTD
Sbjct  21   FKTPARKLVIVTLDRLKRGRGPVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+ + +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    
Sbjct  81   QVLVYKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAA  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EEIA +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL +NQ+
Sbjct  141  EHKALVEEIAMLKPKIEKLESECEMEASKAKALETEVEALRKQSEGFLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQ+ A+D +
Sbjct  201  LRSQVQAIDHS  211



>ref|XP_010442176.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=218

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 150/188 (80%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++ DR KRGRGP+VVK++  TVFV+++ +VYS+  I+ R  +   +NPTD
Sbjct  21   FKTPLRKLIILTFDRIKRGRGPVVVKTIGTTVFVVLLSSVYSLVNIRRRSEDGAVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRK ME AKK +RGF++GK    E
Sbjct  81   QVLASKHLLEASLMGFVLFLSLMIDRLHHYIRELRLLRKTMETAKKQNRGFEDGKTTSGE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEIA +K+KIK +ESE + KG+E+K  K  +E+ + Q+++ L EY +LLE+NQ+
Sbjct  141  EVKALGEEIAVLKAKIKTVESESDGKGKELKEAKGETEALRKQADEFLKEYDRLLEDNQN  200

Query  34   LRSQLHAL  11
            LR+QL ++
Sbjct  201  LRNQLESI  208



>ref|XP_007026129.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY28751.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=221

 Score =   226 bits (576),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I+ LDR KRGRGP++VK+VA TV V+M+ +VYS+ +IQ R ++  + NPTD
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPVMVKTVAGTVSVVMMSSVYSMMKIQKRWIDDGAANPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+A+ +L+A+LMG  LFL+LMIDRLHHYIRELRL RK MEAAKK  RGF++ K GG  
Sbjct  81   QVLMAKHLLEATLMGASLFLALMIDRLHHYIRELRLRRKNMEAAKKQGRGFEDVKPGGSN  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L+EE+ +++ K K+LES+ E K +E+ A + N+ + + QSE  LLEY +LLEENQ+
Sbjct  141  EVKALEEEVTALREKFKQLESDLETKTKEMNAAEANAVALRKQSEGFLLEYDRLLEENQN  200

Query  34   LRSQLHALDE  5
            LR+QL +LD+
Sbjct  201  LRNQLQSLDQ  210



>ref|XP_010046363.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW88772.1| hypothetical protein EUGRSUZ_A01117 [Eucalyptus grandis]
Length=221

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I++LDR KRGRGP++VK+V  T+ V++  ++YS+ +IQ R +E+  +NPTD
Sbjct  21   FKTPLRKLVIMALDRVKRGRGPVMVKTVGVTLLVVLASSLYSMVKIQRRTVEAGLLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLM+DRLHHYIRELRLLRK MEAAKK  RG D GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFVLFLSLMLDRLHHYIRELRLLRKTMEAAKKQSRGIDEGKNGSAE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV  LKEEIA++++K+ KLE+E   K +E K  +  +E+ K QSE LLLEY +LL +NQ 
Sbjct  141  EVKGLKEEIATLRTKLNKLENEYGTKDKEAKTAEAEAEALKKQSEGLLLEYDRLLADNQS  200

Query  34   LRSQLHALD  8
            LRSQL ++D
Sbjct  201  LRSQLESID  209



>ref|XP_009629450.1| PREDICTED: uncharacterized protein LOC104119606 [Nicotiana tomentosiformis]
Length=221

 Score =   224 bits (570),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP+VVK++  T+FV+M+ T+YSV  I+ R ++   +I PT
Sbjct  21   FKTPLRKLVIMGLDRIKRGRGPIVVKTIGGTIFVVMLSTIYSVVSIRKRWIDEDGNITPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +RGF++GKNG  
Sbjct  81   DQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRIRRKSMEAVNKQNRGFEDGKNGAC  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   LE   LLE+NQ
Sbjct  141  DDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFGLENDSLLEDNQ  200

Query  37   HLRSQLHALDE  5
            +LR+QL ALD+
Sbjct  201  NLRAQLQALDQ  211



>gb|KDO78297.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=223

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INP  401
            FKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NP
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK   
Sbjct  81   TDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAS  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LLEEN
Sbjct  141  SEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_006467408.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X2 [Citrus sinensis]
Length=223

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INP  401
            FKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NP
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK   
Sbjct  81   TDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAS  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LLEEN
Sbjct  141  SEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_006389583.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
 gb|ABK95443.1| unknown [Populus trichocarpa]
 gb|ERP48497.1| hypothetical protein POPTR_0021s00340g [Populus trichocarpa]
Length=219

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 149/190 (78%), Gaps = 6/190 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++   ++NPT
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRWIDDGGAVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R F++GK   V
Sbjct  81   DQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRMRRKTMEDVKKQNRSFEDGK---V  137

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE  +L+ E ++++ K+K+LESE E K +EV   + N+ +   QSE  LLEY +LLEENQ
Sbjct  138  EETKALEAEASTLREKLKQLESELEIKTKEVNTSEANAVALSKQSEGFLLEYDRLLEENQ  197

Query  37   HLRSQLHALD  8
            +LRSQL +LD
Sbjct  198  NLRSQLQSLD  207



>ref|XP_006383887.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
 gb|ERP61684.1| hypothetical protein POPTR_0004s00930g [Populus trichocarpa]
Length=219

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FK+PLRK LI+SLDR KRGRGP++VK+VA TVF+++I +VYS+ +IQ R ++    +NPT
Sbjct  21   FKSPLRKFLIMSLDRLKRGRGPVMVKTVAGTVFLVLISSVYSMVKIQKRGIDVGGVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R F++GK   V
Sbjct  81   DQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNRSFEDGK---V  137

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LLEY +LLEENQ
Sbjct  138  EETKALETEVSTLQEKLKQLQSELEVKSKEVNTSEANAAALSKQSEGFLLEYDRLLEENQ  197

Query  37   HLRSQLHALD  8
            +LRSQL ++D
Sbjct  198  NLRSQLQSMD  207



>ref|XP_011096040.1| PREDICTED: B-cell receptor-associated protein 31 [Sesamum indicum]
Length=221

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/189 (58%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+ LDR KRGRGP+VVK+VAAT+FV+M+ +VY+   IQ R ++    NPTD
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPVVVKTVAATIFVVMMASVYNAVAIQRRWIQDGEANPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L A  IL+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK  R F++ K    E
Sbjct  81   QILFANHILEASLMGFALFLALMIDRLHHYIRELRIRRKTMEAVKKQSRVFEDSKPPATE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +L+EE  +++ +IK LE++ E K +E  + + N+ + K QSE  LLEY +LLEENQ+
Sbjct  141  EIKALEEETIALRGRIKDLETQLEEKNKESGSAEANAMALKKQSEGFLLEYDRLLEENQN  200

Query  34   LRSQLHALD  8
            LRSQL +LD
Sbjct  201  LRSQLQSLD  209



>gb|KDO78296.1| hypothetical protein CISIN_1g021727mg [Citrus sinensis]
Length=308

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INP  401
            FKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NP
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMMIQKRWIDDEGAVVNP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK   
Sbjct  81   TDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAS  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LLEEN
Sbjct  141  SEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_006467407.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
Length=242

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES----INP  401
            FKTPLRKLLI+SLDR KRGRGP+VVK+VA TV V++I +VY++  IQ R ++     +NP
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVVVKTVAGTVLVMLISSVYNIMIIQKRWIDDEGAVVNP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVLLA  +L+A+LMG  LFL+ MIDRLHHYIRELR+ RK MEA K   RGF++GK   
Sbjct  81   TDQVLLANHLLEATLMGASLFLAFMIDRLHHYIRELRIRRKTMEAIKNQSRGFEDGKAAS  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             EE+ +L++++ ++K K+K LESE E K +E  A + N+ + + QSE  L EY +LLEEN
Sbjct  141  SEEIKALEDQMTTLKLKLKDLESELETKSKEANAAETNAVALRKQSEGFLFEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_011046959.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=219

 Score =   221 bits (562),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FK+P+RK LI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++    +NPT
Sbjct  21   FKSPIRKFLIMSLDRLKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRGIDVGGVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFLSLMIDRLHHYIRELR+ RK+MEA KK +R F++GK   V
Sbjct  81   DQVLMAKHLLEATLMGSILFLSLMIDRLHHYIRELRMRRKSMEAVKKQNRSFEDGK---V  137

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE  +L+ E+++++ K+K+L+SE E K +EV   + N+ +   QSE  LLEY +LLEENQ
Sbjct  138  EETKALETEVSTLQEKLKQLQSELEVKTKEVNTSEANAIALSKQSEGFLLEYDRLLEENQ  197

Query  37   HLRSQLHALD  8
            +LRSQL ++D
Sbjct  198  NLRSQLQSMD  207



>gb|KDP20721.1| hypothetical protein JCGZ_21192 [Jatropha curcas]
Length=206

 Score =   220 bits (560),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+++ LDR KRGRGP+VVK+VA TV V++I +VYS+ +IQ R ++  ++NPTD
Sbjct  9    FKTPLRKLVLMVLDRVKRGRGPIVVKTVAGTVLVVLISSVYSMMKIQKRWIDEGAVNPTD  68

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL++  +LQA+LMGF LFL+LMIDRLHHYIRELR+ RK+MEA KK  R F++GK   VE
Sbjct  69   QVLMSGHLLQATLMGFCLFLALMIDRLHHYIRELRMRRKSMEAIKKQSRAFEDGK---VE  125

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +++EEI ++++K+K LES+ E K +E  A + N+ + K Q+E  LLEY +L EENQ+
Sbjct  126  ESKAMEEEITTLRAKLKHLESDLEMKTKEAHASEANAVALKKQAEGFLLEYDRLHEENQN  185

Query  34   LRSQLHALD  8
            LR+QL +LD
Sbjct  186  LRNQLQSLD  194



>ref|XP_011008025.1| PREDICTED: uncharacterized protein LOC105113519 [Populus euphratica]
Length=219

 Score =   220 bits (561),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 149/190 (78%), Gaps = 6/190 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKLLI+SLDR KRGRGP++VK+VA TVFV+++ +VYS+ +IQ R ++   ++NPT
Sbjct  21   FKTPLRKLLIMSLDRVKRGRGPVMVKTVAGTVFVVLMSSVYSMVKIQKRWIDDGGAVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVLLA+ +L+A+LMG +LFL LMIDRLHHYIRELR+ RK ME  KK +R F++GK   V
Sbjct  81   DQVLLAKHLLEATLMGSILFLGLMIDRLHHYIRELRVRRKTMEDVKKQNRSFEDGK---V  137

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE  +L+ E ++++ K+++LESE E K +EV   + N+ +   QSE  LLEY +LLEENQ
Sbjct  138  EETKALEAEASTLREKLQQLESELEIKTKEVNTSEANAIALSKQSEGFLLEYDRLLEENQ  197

Query  37   HLRSQLHALD  8
            +LRSQL +LD
Sbjct  198  NLRSQLQSLD  207



>ref|XP_009797812.1| PREDICTED: uncharacterized protein LOC104244159 [Nicotiana sylvestris]
Length=220

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRK++I+ LDR KRGRGP+VVK++  T+F++M+ T+YSV  I+ R ++   +I PT
Sbjct  21   FKTPLRKVVIMGLDRIKRGRGPIVVKTIGGTIFMVMLSTIYSVVSIRKRWIDEDGNITPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+L+AQ +L+ASLMGF LFL+LM+DRLHHYIRELR+ RK+MEA  K +RGF++GKNG  
Sbjct  81   DQILMAQHLLEASLMGFSLFLALMVDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++ SL+EE ++++ KIKKLE   E K  E    + NS + K QSE   LE   LLE+NQ
Sbjct  141  DDMKSLEEEASALRLKIKKLELCLEEKARETSDAEANSVALKKQSENFRLENDYLLEDNQ  200

Query  37   HLRSQLHALDE  5
            +LR+QL ALD+
Sbjct  201  NLRAQLQALDQ  211



>ref|XP_004231615.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
lycopersicum]
Length=222

 Score =   218 bits (556),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YSV  I +R ++    I PT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMMSTIYSVASIHTRWVDEGGDITPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+LLAQ +L+ASLMGF LFL+ MIDRLHHYIREL + RK MEA KK +R F++GKNG  
Sbjct  81   DQILLAQHLLEASLMGFSLFLAFMIDRLHHYIRELSMRRKTMEAVKKQNRAFEDGKNGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LLEY +LLEENQ
Sbjct  141  EEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALDEN  2
            +LRSQL +LD  
Sbjct  201  NLRSQLQSLDRT  212



>ref|XP_010099186.1| B-cell receptor-associated protein 31 [Morus notabilis]
 gb|EXB77058.1| B-cell receptor-associated protein 31 [Morus notabilis]
Length=209

 Score =   218 bits (554),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 150/189 (79%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I++LDR KRGRGP+VVK+V+AT  VL+  +VYS+ +IQ R ++  + NPTD
Sbjct  9    FKTPLRKLVIMALDRVKRGRGPVVVKTVSATAAVLLASSVYSMVKIQKRWIDDGASNPTD  68

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QV++A+ +L+A+LMG  LFL LMIDRLHHYIRELR+ RK +EA KK ++ F++GK GG +
Sbjct  69   QVIMAKHLLEATLMGSSLFLVLMIDRLHHYIRELRIRRKTLEAVKKQNQAFEDGKTGGSD  128

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ + +EE+A++++ +K+LESE E K +++ A + N+ + + QSE  LLEY +LLEENQ+
Sbjct  129  EIKAKEEEMATLRTTLKQLESELETKTKDIHAAEANAVALQKQSEGFLLEYDRLLEENQN  188

Query  34   LRSQLHALD  8
            LR+QL  LD
Sbjct  189  LRNQLQILD  197



>ref|XP_007046390.1| B-cell receptor-associated 31-like [Theobroma cacao]
 gb|EOY02222.1| B-cell receptor-associated 31-like [Theobroma cacao]
Length=219

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKLLI++LDR KRGRGP+V+ +VAAT+ V++  T+YS+ +IQ R +++  +NPTD
Sbjct  21   FKTPFRKLLIMALDRVKRGRGPVVLTTVAATLMVVLASTLYSMLKIQRRTIDAAALNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFL+LMIDRLHHYIRELR LRK+ME AKK  +G+++ KN G  
Sbjct  81   QVLMSKHMLEASLMGFVLFLALMIDRLHHYIRELRFLRKSMETAKKQSQGYEDRKNAG--  138

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +L EE   +K+KIKKLESECE K +EV+A +  +E+ + QSE LLLEY +LLE+NQ+
Sbjct  139  ELKALGEETVILKTKIKKLESECETKSKEVEAAQAEAEALRKQSEGLLLEYDRLLEDNQN  198

Query  34   LRSQLHALDEN  2
            L++QL +++++
Sbjct  199  LQNQLESIEQS  209



>ref|XP_004233786.1| PREDICTED: uncharacterized protein LOC101255462 [Solanum lycopersicum]
Length=222

 Score =   217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP+VVK+   T+FV+M+ ++YSV  I  R ++   ++ PT
Sbjct  21   FKTPLRKLIIMGLDRVKRGRGPIVVKTTGGTIFVVMLSSIYSVVSIHKRWIDEDGNVTPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+L+AQ +L+ASLMGF LFL LMIDRLHHYIRELR+ RK+MEA  K +RGF++GKNG  
Sbjct  81   DQILMAQHLLEASLMGFSLFLGLMIDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++ SL+EE  +++ KIKKLE+  E K +E    + N  + K QSE  L E   L EENQ
Sbjct  141  DDMKSLEEEAGALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLRENDSLHEENQ  200

Query  37   HLRSQLHALDE  5
            +LR+QL +LD+
Sbjct  201  NLRAQLQSLDQ  211



>ref|XP_003534595.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN40872.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 146/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPT
Sbjct  21   FKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAIVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    
Sbjct  81   DQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR+QL +LD
Sbjct  201  NLRNQLQSLD  210



>gb|KJB68573.1| hypothetical protein B456_010G251300 [Gossypium raimondii]
Length=222

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 146/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP---T  398
            FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R ++   P   T
Sbjct  21   FKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRWVDDDGPVSST  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +G D+ K  G 
Sbjct  81   DQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQGSDDKKPDGF  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            ++V SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLLEY +LLEEN+
Sbjct  141  DKVKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLLEYDRLLEENE  200

Query  37   HLRSQLHALD  8
             LR QL +LD
Sbjct  201  SLRGQLQSLD  210



>gb|ACU14586.1| unknown [Glycine max]
Length=225

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 146/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+   +VYS+  IQ R +E    +NPT
Sbjct  21   FKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVFFSSVYSMVNIQKRGIEEGAVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    
Sbjct  81   DQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +++EE A +++++ +LESE ++K ++V A + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EEIKAVEEERARLRAELSRLESELQSKTKDVDAAEANVAALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR+QL +LD
Sbjct  201  NLRNQLQSLD  210



>ref|XP_006348141.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 144/191 (75%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP+VVK+   T+F++M+ ++YSV  I  R ++   ++ PT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIVVKTTGGTIFIVMLSSIYSVVSIHKRWIDEDGNVTPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+L+AQ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK+MEA  K +RGF++GKNG  
Sbjct  81   DQILMAQHLLEASLMGFSLFLALMIDRLHHYIRELRMRRKSMEAVNKQNRGFEDGKNGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++ SL+EE ++++ KIKKLE+  E K +E    + N  + K QSE  L E   L E+NQ
Sbjct  141  DDMKSLEEEASALRLKIKKLEATVEEKAKESSDAEANVVALKKQSEHFLRENDSLHEDNQ  200

Query  37   HLRSQLHALDE  5
            +LR+Q+ +LD+
Sbjct  201  NLRAQVQSLDQ  211



>gb|AFK47348.1| unknown [Lotus japonicus]
Length=222

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGPL+V++V ATV V+++ ++YS+  IQ R +E    +NPT
Sbjct  21   FKTPLRKLMIMGLDRLKRGRGPLMVRTVGATVLVVLLSSLYSMFNIQKRGIEDGGVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG D+GK    
Sbjct  81   DQVLMAKHLLEATLMGAVLFLALMIDRLHHYIRELRVRRKTMEAVKKQSRGSDDGKAAHS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +++EE   ++++I +LESE ++K +EV   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EEIRAMEEETTKLRAEINRLESELKSKTKEVDGAEANVSALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR++L + D
Sbjct  201  NLRNELQSWD  210



>gb|KEH36901.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPT
Sbjct  21   FKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  
Sbjct  81   DQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +E  ++++E A +++++ +LESE ++K +EV A + +  + + QSE  LLEY +LLEENQ
Sbjct  141  DETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEASVSALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR+QL ++D
Sbjct  201  NLRNQLQSVD  210



>gb|AFK46642.1| unknown [Medicago truncatula]
Length=222

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 149/190 (78%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I++LDR KRGRGP++VK+VA TV V++  +VYS+ +IQ R +E   S+NPT
Sbjct  21   FKTPLRKLVIMALDRLKRGRGPVMVKTVAGTVLVVLSSSVYSMMKIQQRGIEDGASVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  RG ++ K G  
Sbjct  81   DQVLMAKHLLEATLMGAILFLALMIDRLHHYIRELRIRRKSMEAVKKQMRGAEDAKAGTS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +E  ++++E A +++++ +LESE ++K +EV A +    + + QSE  LLEY +LLEENQ
Sbjct  141  DETKTMEQEAAKLRAEVGRLESELQSKDKEVGAAEAGVSALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR+QL ++D
Sbjct  201  NLRNQLQSVD  210



>ref|XP_006350475.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=222

 Score =   213 bits (542),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP+++K+VA TVFV+M+ T+YSV  I +R ++    I PT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIIMKTVAGTVFVVMMSTIYSVASIHTRWVDEGGDITPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+LLAQ +L+ASLMGF LFL+ MID+LHHYIREL + RK MEA KK +R F++GK+G  
Sbjct  81   DQILLAQHLLEASLMGFSLFLAFMIDKLHHYIRELSIRRKTMEAVKKQNRAFEDGKSGAS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +L+ E ++++ KI++LE E E K +E  + + N+ + K QSE  LLEY +LLEENQ
Sbjct  141  EEIKTLEGEASALREKIRQLELELEEKAKEASSAEANAGALKKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALDEN  2
            +LRSQL +LD  
Sbjct  201  NLRSQLQSLDRT  212



>ref|NP_001236308.1| uncharacterized protein LOC100526943 [Glycine max]
 gb|ACU15966.1| unknown [Glycine max]
 gb|KHN33010.1| B-cell receptor-associated protein 31 [Glycine soja]
Length=222

 Score =   213 bits (541),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLRKL+I+ LDR KRGRGPL+VK+VA TV V+++ +VYS+ +IQ R ++    +NPT
Sbjct  21   FKTPLRKLVIMGLDRLKRGRGPLMVKTVAGTVLVVLLSSVYSMLKIQKRGIQEGAVVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LM  VLFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    
Sbjct  81   DQVLMAKHLLEATLMVAVLFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGTEDGKVANS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ S++EE A +++++ +LESE ++K ++V   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EEIKSVEEERARLRAELSRLESELQSKTKDVDGAEANIAALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LR+QL +LD
Sbjct  201  NLRNQLQSLD  210



>gb|KHG10853.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=219

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R ++  S NPT+
Sbjct  21   FKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMMIQKRWIDDGSANPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G ++GK+GG +
Sbjct  81   QILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GPEDGKSGGSD  138

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            +V +L+ E+ ++++K+K+LES+ E K +E+ A   N+ + + QSE  LLEY +LLEENQ+
Sbjct  139  KVKALEGEVTTLQAKLKQLESDLETKTKEMDAADANAVALRKQSEGFLLEYDRLLEENQN  198

Query  34   LRSQLHALDEN  2
            LR+QL +L+++
Sbjct  199  LRNQLESLEQS  209



>gb|KHG15358.1| B-cell receptor-associated 31 [Gossypium arboreum]
Length=222

 Score =   212 bits (539),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP---T  398
            FKTP RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ +VYS+ EIQ R +    P   T
Sbjct  21   FKTPFRKLVIMGLDRLKRGRGPVVVKTVAGTVFVVMVSSVYSMMEIQKRWVGDDGPVSST  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L+A+LMG  +FL+LMIDRLHHYIRELR+ RK M+A KK  +G ++ K  G 
Sbjct  81   DQVLMVRHLLEATLMGATIFLALMIDRLHHYIRELRIRRKTMDAVKKQGQGSNDKKPDGF  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++ SL+EE+ +++ K+K+LES+ EAK +++ A + N+ + + QSE LLLEY +LLEEN+
Sbjct  141  DKIKSLEEEVMTLREKLKQLESDIEAKTKQINAAEVNTVALRKQSEGLLLEYDRLLEENE  200

Query  37   HLRSQLHALD  8
             LR QL +LD
Sbjct  201  SLRVQLQSLD  210



>gb|KFK40615.1| hypothetical protein AALP_AA2G019200 [Arabis alpina]
Length=221

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL--ESINPTD  395
            FKTP+RK LI+ LDR+KRGRGP+VVK+V+ T+FV+ + +VYS+ +IQ R     S+NPTD
Sbjct  21   FKTPIRKFLIMGLDRSKRGRGPMVVKTVSVTIFVVFVSSVYSMMKIQKRWFVEGSVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG VLFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK G  +
Sbjct  81   EVIMAKHLLESTLMGGVLFLGLMIDRLHHYMRELRVRRKSMEAIKKQTVGFESGKVGASD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+  L++E+ ++  K K LESE E   +EV++++ NS + + QSE  L+E+ +LLEENQ 
Sbjct  141  EIKKLEDEVKALLEKEKHLESELETMTKEVRSEESNSVALQKQSEGFLIEFNRLLEENQK  200

Query  34   LRSQLHAL  11
            LR QLH++
Sbjct  201  LRDQLHSM  208



>ref|XP_008440020.1| PREDICTED: B-cell receptor-associated protein 29 [Cucumis melo]
Length=221

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R ++  +INPTD
Sbjct  21   FKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRWIDDGAINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R  ++GK    E
Sbjct  81   QVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRALEDGKVSKSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +L+EE  ++++K+K+LESE ++K ++V A + N  + + QSE LLLEY +LLEENQ+
Sbjct  141  EIKALEEERTTLETKLKQLESELDSKTKDVTASEANVVALRKQSEGLLLEYDRLLEENQN  200

Query  34   LRSQLHALD  8
            LR QL +++
Sbjct  201  LRGQLQSVE  209



>gb|EYU27763.1| hypothetical protein MIMGU_mgv1a012919mg [Erythranthe guttata]
Length=236

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 23/207 (11%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI--NPTD  395
            FKTP+RKL+I+ LDR KRGRGP+VVK+VA TVFV+M+ TVY+V +IQ R ++ +  NPTD
Sbjct  21   FKTPVRKLVIMGLDRVKRGRGPIVVKTVAGTVFVVMMATVYNVVKIQRRWIQDVEVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVLLA+ +L+ASLMGF LFL+LMIDRLHHYIRELR+ RK MEA KK +R F++GK     
Sbjct  81   QVLLAKHLLEASLMGFSLFLALMIDRLHHYIRELRIRRKNMEAVKKQNRIFEDGKPL---  137

Query  214  EVNSLKEEIASMKSKIKKLE------------------SECEAKGEEVKAQKDNSESFKG  89
            E+  L+EE  S++ +IK+LE                  ++ E K +E  + + N+ + K 
Sbjct  138  EIKLLEEEKISLRGRIKQLEAQLEDKTTSLHDRINQLGTQLEEKTKEASSSETNAIALKK  197

Query  88   QSEKLLLEYGQLLEENQHLRSQLHALD  8
            QSE  LLEY +LLEENQHLRSQL  LD
Sbjct  198  QSEGFLLEYDRLLEENQHLRSQLQTLD  224



>gb|ACU19065.1| unknown [Glycine max]
Length=200

 Score =   210 bits (535),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 128/162 (79%), Gaps = 2/162 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+SLD  KRGRGP+VV +V AT+ V++  ++YS+ +IQ R LE+  +NPTD
Sbjct  21   FKTPLRKLVIVSLDSVKRGRGPVVVSTVGATLMVVLASSLYSMAKIQQRTLEAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGF+LFLSLMIDRLHHYIRELR LRK MEA KK  R F++GKNG  E
Sbjct  81   QVLMSKHMLEASLMGFLLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKG  89
            E  +L EEI ++KSKIKKLESECEAKG + K  +   E+ K 
Sbjct  141  EHKALNEEITTLKSKIKKLESECEAKGSQAKTLETEVEALKS  182



>gb|KJB69262.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
 gb|KJB69263.1| hypothetical protein B456_011G013000 [Gossypium raimondii]
Length=219

 Score =   210 bits (535),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 152/191 (80%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL ++ LDR KRGRGPL+VK+VAAT+ V+MI +VYS+  IQ R ++  S NPT+
Sbjct  21   FKTPLRKLTLMVLDRVKRGRGPLMVKTVAATIAVVMISSVYSMMTIQKRWIDDGSANPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L+ + +L+A+LMG VLFL+LMIDRLHHYIRELR+ RK+MEA KK   G ++GK+ G +
Sbjct  81   QILMVKHLLEATLMGGVLFLALMIDRLHHYIRELRIRRKSMEAIKKQ--GPEDGKSSGSD  138

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            +V +L+ E+ ++++K+K+LES+ E K +E+ A + N+ + + QSE  LLEY +LLEENQ+
Sbjct  139  KVKALEGEVTTLQAKLKQLESDLETKTKEMDAAEANAVALRKQSEGFLLEYDRLLEENQN  198

Query  34   LRSQLHALDEN  2
            LR+QL +L+++
Sbjct  199  LRNQLESLEQS  209



>ref|XP_004486174.1| PREDICTED: B-cell receptor-associated protein 29-like [Cicer 
arietinum]
Length=222

 Score =   210 bits (535),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 146/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I++LDR KRGRGPL+VK++A T+ V++  ++YS+ +IQ R +E   ++NPT
Sbjct  21   FKTPLRKLVIMALDRLKRGRGPLMVKTIAGTLLVVLSSSIYSMLKIQKRGIEDAAAVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG VLFL+LM+DRLHHYIRELR+ RK+MEA KK  RG ++ K    
Sbjct  81   DQVLMAKHLLEATLMGAVLFLALMVDRLHHYIRELRIRRKSMEAVKKQMRGSEDAKAATS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            E+  +++EE A +++ + +LESE ++K +EV   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EDTKAMEEEAAKLRAAVNRLESELQSKNKEVGVSEANVNALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
             LR+QL ++D
Sbjct  201  SLRNQLQSVD  210



>ref|XP_004151895.1| PREDICTED: uncharacterized protein LOC101218101 [Cucumis sativus]
 gb|KGN63240.1| hypothetical protein Csa_2G416790 [Cucumis sativus]
Length=210

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +E+  +NPTD
Sbjct  21   FRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMVEAGEVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R     ++   E
Sbjct  81   QVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA---SEDASAE  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ +L EE  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY +LLE+NQ+
Sbjct  138  KLKALGEEATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEYDRLLEDNQN  197

Query  34   LRSQLHALD  8
            LR+QL +++
Sbjct  198  LRNQLESIE  206



>ref|XP_002518447.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF43834.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=218

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 146/189 (77%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKL+++ LDR KRG GP++VK+VA T+ V++I +VYS+ +IQ R ++   +NPTD
Sbjct  21   FKTPFRKLVLMGLDRVKRGSGPIIVKTVAGTILVVLISSVYSMMKIQKRGIDEGFVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK+MEA KK  R  ++GK    E
Sbjct  81   QVLMAKHLLEATLMGAMLFLALMIDRLHHYIRELRMRRKSMEAVKKQSRVAEDGK---AE  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EE+ ++++++K+LESE E K +E  A + N+ + + QSE  LLEY +LLEENQ+
Sbjct  138  ENKALGEEMTTLRARLKQLESELEVKTKEAHASETNAVALRKQSEGFLLEYDRLLEENQN  197

Query  34   LRSQLHALD  8
            LR+QL +LD
Sbjct  198  LRNQLQSLD  206



>ref|XP_004158560.1| PREDICTED: uncharacterized LOC101218101 [Cucumis sativus]
Length=210

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRKL+I +LDR KRG+GP+VV+++A TVFV+++ +VYS+ +I +R +E+  +NPTD
Sbjct  21   FRTPLRKLVIFTLDRLKRGKGPIVVQTIAGTVFVVLLSSVYSMLKIHNRMVEAGEVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL++  +L+ASLMGF+LFL+LMIDRLHHYIRELRLLRK ME AKK  R     ++   E
Sbjct  81   QVLMSNHLLEASLMGFLLFLALMIDRLHHYIRELRLLRKTMEVAKKQIRA---SEDASAE  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ +L E+  +M++KI KLESE E K +E    +  +++ + QSE+ LLEY +LLE+NQ+
Sbjct  138  KLKALGEDATTMRNKITKLESEVEVKTKEANDAEAETDALRKQSEEYLLEYDRLLEDNQN  197

Query  34   LRSQLHALD  8
            LR+QL +++
Sbjct  198  LRNQLESIE  206



>ref|XP_008224696.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=222

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            F+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  ++    ++PT
Sbjct  21   FRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSRIDKAAIVSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK   +
Sbjct  81   DQVLMVKHLLEATLMGCFLFLALMIDRLHHYIRELRIRRKSMEAIKKQNRGSEDGKASSL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +E+ +L+ EIA++++++K+LESE E K ++V   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  DEIKALENEIATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +L++QL +LD
Sbjct  201  NLKNQLKSLD  210



>ref|XP_010458605.1| PREDICTED: uncharacterized protein LOC104739838 [Camelina sativa]
Length=221

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EIKNLKEEITSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQG  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LRDQLHTVD  209



>ref|XP_010493468.1| PREDICTED: uncharacterized protein LOC104770706 [Camelina sativa]
Length=221

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL + +VY++  IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLFVASVYNMMAIQKRWIEDGAVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EIKNLKEEIMSLQKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQD  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LRDQLHTVD  209



>ref|XP_004134773.1| PREDICTED: uncharacterized protein LOC101221743 [Cucumis sativus]
 ref|XP_004170033.1| PREDICTED: uncharacterized protein LOC101228301 [Cucumis sativus]
 gb|KGN49093.1| hypothetical protein Csa_6G513570 [Cucumis sativus]
Length=221

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I+++DR KRGRGP++VK+VA TV ++++ +VYS+  IQ R ++  +INPTD
Sbjct  21   FKTPLRKLVILAVDRMKRGRGPIMVKTVAGTVLIVLLSSVYSMVTIQKRWIDDGAINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+ + +L+A+LMG  LFL+LMIDRLHHY+RELRL RK MEA KK  R  ++GK    E
Sbjct  81   QVLMVKHLLEATLMGGSLFLALMIDRLHHYMRELRLRRKGMEAIKKQSRAVEDGKVSKSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +L+EE  ++++K+K+LES  ++K +++   + N  + + QSE LLLEY +LLEENQ+
Sbjct  141  EIKALEEERTTLETKLKQLESVLDSKTKDITTSEANVVALRKQSEGLLLEYDRLLEENQN  200

Query  34   LRSQLHALD  8
            LR QL +++
Sbjct  201  LRGQLQSVE  209



>emb|CDP04423.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   206 bits (523),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL+I+ +DR KRGRGP VVK+VA T+ V+M+ + Y+   I +R  +   INPTD
Sbjct  21   FKTPLRKLVIMGIDRVKRGRGPTVVKAVAGTLSVVMMSSGYNAVAIHNRWSQDADINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L A  +L+ASLMGF LFL+ MIDRLHHYIRELR+ RK+MEA KK +R  D+GKNG   
Sbjct  81   QILFANYLLEASLMGFSLFLAFMIDRLHHYIRELRIRRKSMEAGKKQNRISDDGKNG---  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            +  +L+EE A++++K+K LE+E + K +E  + + N  + K QSE  LLEY +LLEENQ 
Sbjct  138  DFKALEEESAALRAKVKNLEAELDEKTKEASSAEANKLALKKQSEGFLLEYDRLLEENQS  197

Query  34   LRSQLHALD  8
            LRSQL +LD
Sbjct  198  LRSQLQSLD  206



>gb|KFK35240.1| hypothetical protein AALP_AA5G258500 [Arabis alpina]
Length=221

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++++ TV V+++ +VYS+  IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTISVTVLVVLVASVYSMMNIQKRWIEDGAMNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK   G +  K   ++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGAGLEGVKAKALD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +LKEEI S++ + K+L SE E + +E++ +K ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EVKNLKEEIMSLQERQKQLASEIETRSKEIRTEKTSAIALQKQSEGFLIEFNRLLEENQE  200

Query  34   LRSQLHALD  8
            LR QLH  D
Sbjct  201  LRDQLHTAD  209



>ref|XP_007212007.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
 gb|EMJ13206.1| hypothetical protein PRUPE_ppa011145mg [Prunus persica]
Length=222

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            F+TP RKL+I+ LD+ KRGRGP+VVK+VA TV V ++ +VYS+ +I++  ++    ++PT
Sbjct  21   FRTPFRKLVILGLDQIKRGRGPIVVKTVAGTVLVALMTSVYSIIKIKNSRIDKAAIVSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L+A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK   +
Sbjct  81   DQVLMVKHLLEATLMGCSLFLALMIDRLHHYIRELRIRRKSMEAIKKQNRGSEDGKASSL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +E+ +L+ EIA+ ++++K+LESE E K ++V   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  DEIKALENEIATSRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +L++QL +LD
Sbjct  201  NLKNQLKSLD  210



>ref|XP_008784370.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=221

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL I+ LDR KRGRGP++VK+VAAT+ +++  +VYS+ +I+S   E  S+ PTD
Sbjct  21   FKTPLRKLAILGLDRLKRGRGPVMVKTVAATLLIVLASSVYSIAKIRSHSTEIGSLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K GG +
Sbjct  81   QVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKGGGSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ S  ++I ++  +IK L+ E EA+ +E KA + N+ + + QSE  LLEY +LLE+NQ+
Sbjct  141  ELKSQDKDITNLNEEIKHLKLELEARTKEAKAAEANTTALRKQSEGFLLEYDRLLEDNQN  200

Query  34   LRSQLHALDE  5
            LR+QL +LD+
Sbjct  201  LRNQLQSLDQ  210



>ref|XP_010476134.1| PREDICTED: uncharacterized protein LOC104755448 [Camelina sativa]
Length=221

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++V+ TV VL + +VY++  IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTVSVTVIVLFVASVYNMMAIQKRWIEDGAVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +LKEEI S++ + ++L SE EA+ +E++ QK ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EIKNLKEEIMSLRKRQEQLNSELEARSKEIRTQKTSAVALQKQSEGFLIEFNRLLEENQG  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LRDQLHTVD  209



>ref|XP_002889902.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66161.1| hypothetical protein ARALYDRAFT_334480 [Arabidopsis lyrata subsp. 
lyrata]
Length=221

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPTD
Sbjct  21   FKTPMRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMAIQKRWIEDGVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEI S++ + ++L+SE EA+ +E++ ++ ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EVKNLMEEITSLRKRQEQLDSELEARSKEIRTERTSAVALQKQSEGFLIEFNRLLEENQV  200

Query  34   LRSQLHALD  8
            LR QLHA+D
Sbjct  201  LRDQLHAVD  209



>ref|XP_006417293.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
 gb|ESQ35646.1| hypothetical protein EUTSA_v10008726mg [Eutrema salsugineum]
Length=221

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++++ATV V+++ +VYS+ +IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTISATVCVVLVASVYSMMKIQKRGIEDGAMNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K    +
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKMMEVIKKEGAVLEGVKARASD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +LKEE+ S++ + K+L SE EA+ +E++ +K ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EVKNLKEEVVSLQERQKQLVSEIEARSKEIRTEKTSAVALEKQSEGFLIEFNRLLEENQD  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LRDQLHTVD  209



>ref|NP_849648.4| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AAM98189.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28811.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=221

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPTD
Sbjct  21   FKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEFNRLLEENQV  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LRDQLHTVD  209



>ref|XP_008229967.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=221

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R +ES  +NPTD
Sbjct  21   FKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYTLVDIKNRTIESGMLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  +     KNG  E
Sbjct  81   EVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQSIQEEKNGSSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+EY +LL +NQ+
Sbjct  141  QLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL +++++
Sbjct  201  LRSQLTSIEQS  211



>ref|XP_007215939.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
 gb|EMJ17138.1| hypothetical protein PRUPE_ppa011161mg [Prunus persica]
Length=221

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK+PLRKL+I++LD+ KRG+GP++VK+VA TVFV+++  VY++ +I++R +ES  +NPTD
Sbjct  21   FKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFVVLLAGVYNLVDIKNRTIESGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAM+AAKK  +     KNG  E
Sbjct  81   EVLMSVKMLEISLMGFFLFLSLMLDRLHHYIRELRFLRKAMDAAKKQSQSIQEEKNGSSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ +L +E  ++++KIK LESE E K ++ KA     E+ + QSE LL+EY +LL +NQ+
Sbjct  141  QLKTLAQENDTLRTKIKNLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL +++++
Sbjct  201  LRSQLTSIEQS  211



>emb|CDY34821.1| BnaA09g47470D [Brassica napus]
Length=221

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRWVEEGAMNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK     +  K    +
Sbjct  81   EVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSVLEGEKARASD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E+ +L EENQ 
Sbjct  141  EVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIEFNRLSEENQD  200

Query  34   LRSQLHALD  8
            LR+QLH +D
Sbjct  201  LRNQLHTVD  209



>ref|XP_010686812.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 140/193 (73%), Gaps = 11/193 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPL------ESI  407
            FK+PLRKL+I  LD+ KRGRGP+VVK+V+AT+ +  I T+YS  +IQ R +      +++
Sbjct  21   FKSPLRKLVIAVLDKIKRGRGPIVVKTVSATISIFFISTLYSTLKIQRRGIGEDGAPDAL  80

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
            NPTDQVL ++ +L+ASLMGF+LFLSLMIDRLHHYIRELRL RK MEA KK+D      K 
Sbjct  81   NPTDQVLFSKHLLEASLMGFILFLSLMIDRLHHYIRELRLRRKTMEAVKKND-----VKC  135

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
             G EE+ + ++++ + K+ I++LES+ E+K +E    +   E+ + QSE LLLEY +LL 
Sbjct  136  AGPEEIKAREQQVETFKAMIRQLESDLESKVKEASTSEATVEALRKQSEGLLLEYDRLLA  195

Query  46   ENQHLRSQLHALD  8
            ENQ  R+QLH LD
Sbjct  196  ENQEFRNQLHTLD  208



>ref|XP_004293309.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=222

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 145/190 (76%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI---NPT  398
            F+TPLRKL+I+ LD+ KRGRGP+VVK+ A TVFV+++ ++Y + +I+    +++   +PT
Sbjct  21   FRTPLRKLVIVGLDQIKRGRGPVVVKTAAGTVFVVLLTSLYGMVKIKRSGADAVGILSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQ+L+ + +L+ +LMGF LFL LMIDR+HHYIRELR+ RK MEA KK +RG ++GK GG+
Sbjct  81   DQILMFKHLLEVTLMGFFLFLVLMIDRIHHYIRELRVRRKTMEAIKKQNRGSEDGKAGGL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +EV +L+ E+++ + +IK+LES  E   +E  A + + ++ + QSE  LLEY +LLEENQ
Sbjct  141  DEVKALENEMSTSRLRIKQLESNIETTTKEAHAAEASVDALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +L++QL +LD
Sbjct  201  NLKNQLQSLD  210



>ref|XP_008342021.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342022.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342023.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
 ref|XP_008342024.1| PREDICTED: B-cell receptor-associated protein 31 [Malus domestica]
Length=221

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK+PLRKL+I++LD+ KRG+GP++VK+VA TVF++++  VY++ +I++R  ES  +NPTD
Sbjct  21   FKSPLRKLVILALDKMKRGKGPVMVKTVAGTVFIVLLANVYNLVDIKNRTNESGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL++ ++L+ SLMGF LFLSLM+DRLHHYIRELR LRKAMEAAK+ ++   + KNG  E
Sbjct  81   EVLMSMKMLENSLMGFFLFLSLMMDRLHHYIRELRFLRKAMEAAKRQNQSSQDDKNGSSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ +L +E  ++++KI+ LESE E K ++ KA     E+ + QSE LL+EY +LL +NQ+
Sbjct  141  QLKTLVQENETLRTKIETLESEYETKAKKAKAAGSEVEALRKQSEGLLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL +++++
Sbjct  201  LRSQLTSIEQS  211



>ref|XP_009118164.1| PREDICTED: uncharacterized protein LOC103843216 [Brassica rapa]
Length=221

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VY + +IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYGMMKIQKRWVEEGAMNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++++ +L+++LMG  LFL LMIDRLHHY+RELR+ RK MEA KK     +  K    +
Sbjct  81   EVIMSKHLLESTLMGGFLFLGLMIDRLHHYMRELRMRRKTMEAIKKEGSVLEGEKARASD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV SLK+EI +++ + K+L +E EAK +E++ ++ +  + + QSE  L+E+ +L EENQ 
Sbjct  141  EVKSLKQEITALQERQKQLAAEIEAKSKEIRTEETSGIALQKQSEGFLIEFNRLSEENQD  200

Query  34   LRSQLHALD  8
            LR+QLH +D
Sbjct  201  LRNQLHTVD  209



>ref|XP_008348138.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=221

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK PLRKL+I++LD+ K+G+GP++VK+VA TVF +++  VY++ +I++R +ES  +NPTD
Sbjct  21   FKNPLRKLVILALDKMKQGKGPVMVKTVAGTVFAVLMADVYNLVDIKNRTIESGVLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEA K+ ++     KNG  +
Sbjct  81   EVLMSVKMLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAVKRQNQSSQEEKNGSSK  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ ++ +E  ++++KIK LESE E K ++ +A     E+ + QSE LL+EY +LL +NQ+
Sbjct  141  QLKTIVQENETLRTKIKTLESEYETKEKKAEAAGSEVEALRKQSEGLLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL +++++
Sbjct  201  LRSQLTSIEQS  211



>ref|XP_009353295.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009353296.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD
Sbjct  21   FKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            ++L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E
Sbjct  81   EILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ ++ +E  ++++KIK LE E E K ++ KA     E+ K QSE LL+EY +LL +NQ+
Sbjct  141  QLKTIVQENETLRTKIKTLEFEYETKEKKAKAAGSEVEALKKQSEGLLMEYDRLLADNQN  200

Query  34   LRSQLHALDEN  2
            L+SQL +++++
Sbjct  201  LQSQLTSIEQS  211



>gb|KHN44866.1| hypothetical protein glysoja_040795 [Glycine soja]
Length=217

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 6/191 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP RKL+II+LDR KR       K+VAAT+ V++  ++YS+ +I+ R L++  +NPTD
Sbjct  21   FKTPARKLVIITLDRVKRVVV----KTVAATLLVVLASSLYSIAKIRRRNLDAPVVNPTD  76

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  R F++GK+    
Sbjct  77   QVLVSKHMLEASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKQSRSFEDGKSVSAA  136

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E  +L EE A +K KI+KLESECE +  + KA +   E+ + QSE  L+EY +LL +NQ+
Sbjct  137  EHKALLEENAMLKPKIEKLESECEVEASKAKALETEVEALRKQSEGFLMEYDRLLADNQN  196

Query  34   LRSQLHALDEN  2
            LRSQL A+D +
Sbjct  197  LRSQLQAIDHS  207



>ref|XP_009419329.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+I+ LDR KRGRGP++VK+VA TV +++  ++YS+ +I+SR  E  +  PTD
Sbjct  21   FKTPLRKLVILGLDRFKRGRGPVMVKTVAGTVVIVLASSLYSMAKIRSRSAEFGAFTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMG+ LFL L+IDRLHHYIRELR LRK+MEA  K +R  +  K GG +
Sbjct  81   QVLMSRHLLEASLMGYSLFLVLIIDRLHHYIRELRGLRKSMEAVMKQNRVLEETKCGGSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +   EIA +  +IK L+ E E + +E +A + N  + K QS+ LL+EY +LLE+NQ+
Sbjct  141  EIKTRDREIACLNEQIKHLKFESEERIKEARAAEANVMALKKQSDDLLIEYDRLLEDNQN  200

Query  34   LRSQLHALD  8
            + +QLH++D
Sbjct  201  ILNQLHSID  209



>ref|XP_007147709.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
 gb|ESW19703.1| hypothetical protein PHAVU_006G148100g [Phaseolus vulgaris]
Length=222

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGPL+VK+VA T+ V+++ +VYS+ +IQ   +E   S+NPT
Sbjct  21   FKTPLRKLVIMGLDRLKRGRGPLIVKTVAGTILVVLLSSVYSMIKIQKHEIEDGGSVNPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+A+ +L+A+LMG +LFL+LMIDRLHHYIRELR+ RK MEA KK  RG ++GK    
Sbjct  81   DQVLMAKHLLEATLMGGILFLALMIDRLHHYIRELRIRRKGMEAVKKQTRGSEDGKFTFS  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            EE+ +++EE A +++++++LESE ++K ++    + N  + + QSE  LLEY +LLEENQ
Sbjct  141  EEMKAVEEERARLRAELRRLESELQSKTKDADIAEANVSALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +LRSQL +LD
Sbjct  201  NLRSQLQSLD  210



>ref|XP_009347127.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=221

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 144/191 (75%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK PLRKL+I++LD+ KRG+GP++VK+VA TVF +++  V+++ +I++R +ES  + PTD
Sbjct  21   FKNPLRKLVILALDKMKRGKGPVMVKTVAGTVFAVLMADVFNLVDIKNRTIESGVLKPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            ++L++ ++L+ SLMGF LFLSLM DRLHHYIRELR LRKAMEAAK+ ++     KNG  E
Sbjct  81   EILMSMKMLEISLMGFFLFLSLMTDRLHHYIRELRFLRKAMEAAKRQNQSSQEEKNGSPE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ ++ +E  ++K+KIK LESE E   ++ K      E+ + QSE LL+EY +L  +NQ+
Sbjct  141  QLKTIVQENETLKTKIKTLESEYETNAKKAKVAGSEVEALRKQSEGLLMEYDRLQADNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL +++++
Sbjct  201  LRSQLASIEQS  211



>ref|XP_009403539.1| PREDICTED: uncharacterized protein LOC103987073 [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   195 bits (496),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL+++ LDR KRGRGP++VK+VA TV V++  ++YS+ +I S   E  ++ PTD
Sbjct  21   FKTPLRKLVVVGLDRLKRGRGPVMVKTVAGTVLVVLASSLYSIAKISSGSAELGALTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMG+ LFL+L+IDRLHHY+RELR LRK+MEA  K +R  +  K GG  
Sbjct  81   QVLMSRHLLEASLMGYSLFLALIIDRLHHYVRELRGLRKSMEAVLKQNRVLEEAKTGGSS  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L   IAS+  +IK+L+SE E + +E KA +  + + K QSE LLLEY +LLE+NQ+
Sbjct  141  EVKALDGMIASLNEQIKQLKSESEDRLQEAKAAEARAAALKKQSEDLLLEYDRLLEDNQN  200

Query  34   LRSQLHALD  8
            LR+QL+++D
Sbjct  201  LRNQLNSID  209



>ref|XP_010533802.1| PREDICTED: uncharacterized protein LOC104809492 [Tarenaya hassleriana]
Length=221

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+VVK+V ATV V+M  +VYSV +IQ R ++  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVVKTVVATVCVVMASSVYSVMKIQKRWIDEGTVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+ + +L+++LMG  LFL LMIDRLHHY+RELR+ RK+MEA KK   GF++GK    +
Sbjct  81   EVLMTRNLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKSMEAIKKQGLGFEDGKAVASD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ S++E+I S++    +LESE +AK +E ++++ N+ + + QSE  LLE+ +LLEENQ 
Sbjct  141  ELKSMEEQIRSLQEIKNQLESELDAKAKEARSEESNAVALRKQSEGFLLEFNRLLEENQD  200

Query  34   LRSQLHALD  8
            LR+QLH LD
Sbjct  201  LRNQLHLLD  209



>ref|XP_003596956.1| hypothetical protein MTR_2g088060 [Medicago truncatula]
 gb|ABN08523.1| Prefoldin [Medicago truncatula]
 gb|AES67207.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=222

 Score =   193 bits (491),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 140/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLR L+II+L++ KRGRGP++VK+V  TV  ++   +Y++ +IQ R +E   +++ T
Sbjct  21   FKTPLRNLVIITLNKVKRGRGPVIVKTVVGTVVTMLGSALYNIFKIQRRSIEGFATVDST  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVLL+  +LQASL+GFVLFLSLMIDRLHHYIRELRLLR A+E  KK +R F N  N   
Sbjct  81   DQVLLSNHVLQASLLGFVLFLSLMIDRLHHYIRELRLLRNAVETGKKQNRCFQNNTNIKA  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
             E  SLKEEI +++ KI+KLESECE KG  VK+ +   E+FK QSE  L+EY  LL +NQ
Sbjct  141  MEHTSLKEEIGALRFKIEKLESECEVKGSRVKSLEIEVEAFKKQSEGFLMEYDGLLIDNQ  200

Query  37   HLRSQLHALDE  5
            +LR  L  +++
Sbjct  201  NLRKLLECIEK  211



>ref|XP_008780367.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
 ref|XP_008780411.1| PREDICTED: uncharacterized protein LOC103700158 [Phoenix dactylifera]
Length=221

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL  + LD  KRGRGP++VK+VA TV +++  +VYS+ EI+ R  E  S+ PTD
Sbjct  21   FKTPLRKLATLGLDHLKRGRGPVMVKTVAGTVLLVLASSVYSMVEIRGRFTEIGSLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL++Q +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +
Sbjct  81   QVLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRRLRKSMEAVMKQNRALEETKNGGSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ S  +E+ ++  +IK+L+ E EA+ +E KA + ++ + K QSE  LLEY  LLE+N++
Sbjct  141  ELKSRDKEVTNLNEQIKQLKLELEARTKEAKAAEASATALKKQSEGFLLEYDHLLEDNKN  200

Query  34   LRSQLHALD  8
            LR+QL ++D
Sbjct  201  LRNQLQSID  209



>ref|XP_010546686.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
 ref|XP_010546696.1| PREDICTED: uncharacterized protein LOC104818690 [Tarenaya hassleriana]
Length=221

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+VVK+VAATV V+M  +VYS+ +IQ R ++  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVVKTVAATVCVVMASSVYSMMKIQKRWIDEGTVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+ + +L+++LMG  LFL LM DRLHHY+RELR+ RK+MEA KK   GF+ GK G  +
Sbjct  81   EVLMKKNLLESTLMGGFLFLGLMTDRLHHYMRELRVRRKSMEAIKKQGLGFNGGKPGNSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+  ++E+I +++   K+LESE EAK +E   ++  + + + QSE  LLE+ +LLEENQ 
Sbjct  141  EIKGMEEQIRTLQEIQKQLESELEAKTKEANGEESGAVALRQQSEGFLLEFNRLLEENQE  200

Query  34   LRSQLHALD  8
            LR+QL++LD
Sbjct  201  LRNQLNSLD  209



>ref|XP_009390004.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009390005.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=221

 Score =   190 bits (482),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 141/191 (74%), Gaps = 2/191 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTD  395
            F TPLRKL ++ LDR KRGRGPLVV+++AAT  V++  ++YS+ +I SR   + ++ PTD
Sbjct  21   FNTPLRKLALLGLDRLKRGRGPLVVRTIAATGLVVLGSSLYSMSKIWSRSDQIGALTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++  L+ASLMG+ LFL+L+IDRLHHYIRE R LRK+MEAA K +R  +  K+G  +
Sbjct  81   QVLHSRHFLEASLMGYSLFLALIIDRLHHYIREWRGLRKSMEAATKQNRLLEEAKSGKSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+   +E+I S+  +I++L+   E + +EVK  + N+ + + QSE LLLEY +LLE+NQ+
Sbjct  141  EIKGREEKITSLNEEIQQLKLASEERMKEVKTAEANAIALRKQSEGLLLEYDRLLEDNQN  200

Query  34   LRSQLHALDEN  2
            LRSQL ++D +
Sbjct  201  LRSQLQSIDHH  211



>ref|XP_006303826.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
 gb|EOA36724.1| hypothetical protein CARUB_v10012392mg [Capsella rubella]
Length=221

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+V+++V+ATV VL++ +VY++  IQ R +E  ++NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVIQTVSATVIVLLVASVYNMMGIQKRWIEDGAVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG +LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGLLFLGLMIDRLHHYMRELRIRRKTMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+ +LKEEI S++ + ++L+SE EAK +E++ +K ++ + + QSE  L+E+ +LLEENQ 
Sbjct  141  EIKTLKEEIMSLRKRQEQLDSELEAKSKEIRTEKTSAVALQKQSEGFLIEFNRLLEENQD  200

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  201  LREQLHTVD  209



>ref|XP_011047243.1| PREDICTED: B-cell receptor-associated protein 31-like [Populus 
euphratica]
Length=218

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 152/191 (80%), Gaps = 5/191 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+ PLRKL+I+ LDR KRGRGP+VVK+VA T+ VL++  VY++  IQ+R +E+  +NPTD
Sbjct  21   FRNPLRKLVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYTIGNIQNRKMEAGALNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+A  +LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F++GKNG   
Sbjct  81   EVLMAMLLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSFEDGKNG---  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y  LLE+NQ 
Sbjct  138  EGKGLGEEVEALRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQYDHLLEDNQS  197

Query  34   LRSQLHALDEN  2
            LR+QL ++D+ 
Sbjct  198  LRNQLDSIDQT  208



>ref|XP_002320470.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
 gb|ABK92570.1| unknown [Populus trichocarpa]
 gb|EEE98785.1| hypothetical protein POPTR_0014s15290g [Populus trichocarpa]
Length=218

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 152/191 (80%), Gaps = 5/191 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+ PLRK +I+ LDR KRGRGP+VVK+VA T+ VL++  VYS+  +Q+R +E+  +NPT+
Sbjct  21   FRNPLRKFVIMGLDRVKRGRGPVVVKTVAGTILVLLLSNVYSIGNMQNRKMEAGALNPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+A Q+LQASL+GF+LFLSLMIDRLHHYIRELRLLRKAMEAAKK +R F++GKNG   
Sbjct  81   EVLMAMQLLQASLLGFLLFLSLMIDRLHHYIRELRLLRKAMEAAKKQNRSFEDGKNG---  137

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E   L EE+ +++SK+KKLESE EAK +E +A +  +E+ + QSE  LL+Y  LLE+NQ 
Sbjct  138  EGKGLGEEVETLRSKVKKLESEYEAKVKEAEAAEAKAEALRKQSEGSLLQYDHLLEDNQS  197

Query  34   LRSQLHALDEN  2
            LR+QL ++D+ 
Sbjct  198  LRNQLDSIDQT  208



>ref|XP_010926189.1| PREDICTED: uncharacterized protein LOC105048548 [Elaeis guineensis]
Length=221

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTPLRKL I+ LDR KRGRGP++VK+VA TV V++  +VYS+ +I+ R  E+  + PTD
Sbjct  21   FKTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLVVLASSVYSMLKIRDRSAETGFLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL++Q +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK+MEA  K +R  +  KNGG +
Sbjct  81   QVLMSQNLLEASLMGYSLFLALIIDRLHHYIRELRGLRKSMEAVMKQNRALEETKNGGSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++ S  +E   +  +IK+L+ E +A  +E KA + N+ +   QSE LL EY +LLE+N++
Sbjct  141  DLKSRDKETTDLNEQIKQLKLELDAISKEAKAAEANATALGKQSEGLLQEYDRLLEDNKN  200

Query  34   LRSQLHALD  8
            LR+QL ++D
Sbjct  201  LRNQLQSID  209



>emb|CDY34616.1| BnaC08g41750D [Brassica napus]
Length=224

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 141/192 (73%), Gaps = 5/192 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTP+RKLLI+SLDRAKRGRGP+VV++V+ATV V+++ +VYS+ +IQ R +E  + NPTD
Sbjct  21   FKTPIRKLLIMSLDRAKRGRGPVVVQTVSATVCVVLVASVYSMMKIQKRWVEEGATNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSL---MIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  224
            +V++++ +L+++LMG   F S+   MIDRLHHY+RELR+ RK ME  KK     +  K  
Sbjct  81   EVIMSKHLLESTLMGKSSFASVAAEMIDRLHHYMRELRMRRKTMEVIKKEGSVLEGEKAR  140

Query  223  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEE  44
              +EV SLK+EI +++ + K+L +E EA  +E++ ++ +  + + QSE  L+E+ +L EE
Sbjct  141  ASDEVKSLKQEITALQERQKQLAAEMEAMSKEIRTEETSGIALQKQSEGFLIEFNRLSEE  200

Query  43   NQHLRSQLHALD  8
            NQ LR+QLH +D
Sbjct  201  NQDLRNQLHTVD  212



>ref|XP_010089483.1| hypothetical protein L484_011937 [Morus notabilis]
 gb|EXB37876.1| hypothetical protein L484_011937 [Morus notabilis]
Length=253

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 150/223 (67%), Gaps = 34/223 (15%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTPLR+L++++LD+ KRGRGP++VK++A TVF+L + +V S   IQ+   E+   INPT
Sbjct  21   FKTPLRQLVLMALDKVKRGRGPVMVKTIAITVFLLFVVSVCSFVNIQNHITEAGGGINPT  80

Query  397  DQVLLAQQILQASLMGFVL-----FLSLMID--------------------------RLH  311
            DQVL+A+ +L+ASLMGF L     F +L ++                          RLH
Sbjct  81   DQVLMAKHLLEASLMGFQLEIIMNFPNLYVEGSHLGFASITAIMKDYAIIASVYKNYRLH  140

Query  310  HYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGE  131
            HYIRELR+LRK MEAAKK +RG +NGKNG   E+ + +++IA +K+ IKKLESEC+ K E
Sbjct  141  HYIRELRILRKTMEAAKKQNRGHENGKNGNAAELKASEQDIAQLKATIKKLESECKTKTE  200

Query  130  EVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALDEN  2
            E +A +  +E+ K QSE  L+EY  LL ENQ+LR+QL ++D++
Sbjct  201  EAEAAEGKAEALKKQSEGFLMEYDHLLAENQNLRNQLESIDQS  243



>ref|XP_010916117.1| PREDICTED: uncharacterized protein LOC105041025 [Elaeis guineensis]
Length=221

 Score =   185 bits (469),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FKTPLRKL I+ LDR KRGRGP++VK+VA TV +++  +VYS+ +I+S   E  S+ PTD
Sbjct  21   FKTPLRKLAILGLDRLKRGRGPVMVKTVAGTVLIVLASSVYSMAKIRSHSTEIGSLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+ASLMG+ LFL+L+IDRLHHYIRELR LRK MEA  K +R  +  K+GG +
Sbjct  81   QVLMSRHLLEASLMGYSLFLALIIDRLHHYIRELRGLRKNMEAVMKQNRALEETKSGGSD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+    +EI  +  +IK+L  + E+  +E KA + N+ + + QSE  LLEY +LLE+NQ+
Sbjct  141  ELKLRDKEITYLNEQIKQLNLKLESSTKEAKAAEANATALRKQSEGFLLEYDRLLEDNQN  200

Query  34   LRSQLHALD  8
            LR+QL ++D
Sbjct  201  LRNQLQSID  209



>ref|XP_008649481.1| PREDICTED: uncharacterized protein LOC103630179 [Zea mays]
 gb|AFW77553.1| hypothetical protein ZEAMMB73_124915 [Zea mays]
Length=221

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTD  395
            F TP+R+L ++++DRAKRGRGP++ K++A T+ ++++   YSV +I+ R   L  + PTD
Sbjct  21   FPTPVRRLALLAIDRAKRGRGPVMAKTIAGTMLLVLVSAFYSVAKIRRREGELGQLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMG+ LFL L+IDRLHHYIRELR+LRK MEA  +  R  +  K+G  +
Sbjct  81   QVLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRMLRKDMEAVTEQGRTLEAAKSGSTD  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+   ++E+AS+K ++++L+++ + K E +K  + NS + + QSE LL EY +L+ EN+ 
Sbjct  141  EIQGYQKEVASLKEQVQELQNQSQKKTERLKTAEANSVALQKQSEGLLAEYDRLIAENRD  200

Query  34   LRSQLHALD  8
            LR QL ++D
Sbjct  201  LRDQLQSID  209



>ref|XP_006647215.1| PREDICTED: B-cell receptor-associated protein 29-like [Oryza 
brachyantha]
Length=225

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 134/199 (67%), Gaps = 12/199 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------  413
            FKTPLRKL ++ +D  KRGR  P+ VK+VA  V  L+  T+YS+ EI  R          
Sbjct  21   FKTPLRKLAVLGIDCLKRGRRAPVAVKTVAGVVTALLTSTLYSMAEISGRAGGDPESGGG  80

Query  412  ----SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  245
                S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++ 
Sbjct  81   GGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKHNKM  140

Query  244  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  65
             +  K+G +EE    +EEIA++   +KKL+ + + K EE    +D + + + QSE LLLE
Sbjct  141  LEEAKHGSIEETKKYQEEIAALNEDMKKLKLQVQEKTEEAHIAEDKALAIRKQSESLLLE  200

Query  64   YGQLLEENQHLRSQLHALD  8
            Y +LLE+NQHLR QLH++D
Sbjct  201  YDRLLEDNQHLREQLHSID  219



>gb|EMT11422.1| hypothetical protein F775_31561 [Aegilops tauschii]
Length=222

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 137/195 (70%), Gaps = 8/195 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------  413
            FKTPLRKL ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       
Sbjct  21   FKTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVITLLASTLYSMAEISGRAGDPEAGGGA  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
            +++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + G
Sbjct  81   ALSPTDQVLFSRHLLEASLMGYTLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKTLEEG  140

Query  232  KNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  53
            K+G  +E+   +EE+A++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +L
Sbjct  141  KHGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTEEVHVAEDKALAIQKQSESLLLEYDRL  200

Query  52   LEENQHLRSQLHALD  8
            LE+NQHLR QL ++D
Sbjct  201  LEDNQHLREQLQSID  215



>dbj|BAK02060.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 138/195 (71%), Gaps = 8/195 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------  413
            FKTPLRKL ++ LDR KRGR  P+ VK+VA  VF L+  T+YS+ EI  R  +       
Sbjct  21   FKTPLRKLAMLGLDRLKRGRRAPVAVKTVAGVVFTLLASTLYSMAEISGRAGDPEGGGGA  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
            +++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  + G
Sbjct  81   ALSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVSKQNKMLEEG  140

Query  232  KNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  53
            K+G  +E+   +EE+A++  ++KKL+ + + K +EV   +D + + + QSE LLLEY +L
Sbjct  141  KHGRSQEIAKYQEEVATLNEEMKKLKLQVQEKTKEVHVAQDKTLAIQKQSESLLLEYDRL  200

Query  52   LEENQHLRSQLHALD  8
            LE+NQHLR QL ++D
Sbjct  201  LEDNQHLREQLQSID  215



>ref|NP_001055067.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|AAT85231.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16981.1| Os05g0272900 [Oryza sativa Japonica Group]
 gb|EAY97334.1| hypothetical protein OsI_19258 [Oryza sativa Indica Group]
 dbj|BAG97944.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63061.1| hypothetical protein OsJ_17869 [Oryza sativa Japonica Group]
Length=221

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 135/189 (71%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTD  395
            F+TP R+L ++++DRAKRGRGP++VK+VAAT+ V++  + YS+ +I+ R   L  + PTD
Sbjct  21   FRTPFRRLALLAIDRAKRGRGPVMVKTVAATMLVVLGSSGYSIAKIRRRVGDLGQLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMG+ LFL L+IDRLHHYIRELR ++K MEA  K  R  +  K+G VE
Sbjct  81   QVLASRHLLEASLMGYSLFLGLIIDRLHHYIRELRTMKKNMEAVTKQSRTLEEAKHGSVE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+   ++EI+ +  ++++ +   E K EE+K  + N+ + + QSE LL EY +L+ EN+ 
Sbjct  141  EIQQYQKEISRLNEQVQEFKRLSETKTEELKTAEANTLALQKQSEGLLTEYERLIAENEE  200

Query  34   LRSQLHALD  8
             R+QL ++D
Sbjct  201  FRNQLQSMD  209



>ref|NP_001046689.1| Os02g0321800 [Oryza sativa Japonica Group]
 dbj|BAD28852.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08603.1| Os02g0321800 [Oryza sativa Japonica Group]
 gb|EAZ22804.1| hypothetical protein OsJ_06479 [Oryza sativa Japonica Group]
 dbj|BAG92174.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 133/199 (67%), Gaps = 12/199 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------  413
            FKTPLRKL ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R          
Sbjct  21   FKTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGG  80

Query  412  ----SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG  245
                S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++ 
Sbjct  81   GGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVTKHNKM  140

Query  244  FDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLE  65
             +  K+G  EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLLE
Sbjct  141  LEEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLLE  200

Query  64   YGQLLEENQHLRSQLHALD  8
            Y +LLE+NQHLR QL ++D
Sbjct  201  YDRLLEDNQHLREQLQSID  219



>ref|XP_006654198.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=221

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 136/189 (72%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTD  395
            F+TP R+L +++LDRAKRGRGP++V++VAAT+ V++  + YS+ +I+ R   L  + PTD
Sbjct  21   FRTPARRLALLALDRAKRGRGPVMVRTVAATMIVVLGSSGYSIAKIRRRVGDLGQLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMG+ LFL ++IDRLHHYIRELR ++K MEA  K  R  +  K+G VE
Sbjct  81   QVLASRHLLEASLMGYSLFLGIIIDRLHHYIRELRTMKKNMEAVTKQSRVLEEAKHGSVE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
             +   ++EI+S+  ++++L+   E K EE+K  + N+ + + QSE LL EY +L+ EN+ 
Sbjct  141  GIQQYQKEISSLNEQVQELKRLSEKKTEELKTAEANALALQKQSEGLLTEYERLIAENEQ  200

Query  34   LRSQLHALD  8
             RSQL ++D
Sbjct  201  FRSQLQSMD  209



>ref|XP_011086195.1| PREDICTED: B-cell receptor-associated protein 31-like [Sesamum 
indicum]
Length=221

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 134/189 (71%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            FK PLRK +I+ LDR KRG GP+VV++V  TVFV+M+ T+Y+   I+ R +   + + TD
Sbjct  21   FKNPLRKTVIMGLDRIKRGSGPIVVQTVGGTVFVVMLATLYNAVAIKRRQMRDATTDSTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            Q+L A+ +L ASLMGF LFL L IDRLHHYIRELR+ RK++EA KK ++  ++ K    +
Sbjct  81   QILCARHLLGASLMGFSLFLVLTIDRLHHYIRELRIWRKSIEALKKQNQALEDEKPAVSK  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            ++  ++EE A+++ +IK+LE++ E K +E      ++ + K QS+  L+EY +LLEENQ 
Sbjct  141  QIKVMEEEKATLQERIKELETQLEEKSKEASRAGASAVALKKQSDGFLIEYERLLEENQK  200

Query  34   LRSQLHALD  8
            LRSQL +LD
Sbjct  201  LRSQLQSLD  209



>ref|XP_010234160.1| PREDICTED: uncharacterized protein LOC100839925 [Brachypodium 
distachyon]
Length=222

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 135/195 (69%), Gaps = 8/195 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------  413
            FKTPLRKL ++ LDR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R  +       
Sbjct  21   FKTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVVLTLLASTLYSMAEISGRTGDPESGGGG  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
            +++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  K ++  +  
Sbjct  81   ALSPTDQVLFSRHLLEASLMGYSLFLALIIDRLHQYIRELRGLKKNVEAVSKQNKMLEET  140

Query  232  KNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  53
            K+G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LLLEY +L
Sbjct  141  KHGRNEETIKYQEEIATLNEEMKKLKLQVQEKTEEVHVAEDKALAIRKQSENLLLEYDRL  200

Query  52   LEENQHLRSQLHALD  8
            LE+NQHLR QL ++D
Sbjct  201  LEDNQHLREQLQSID  215



>gb|EAY85610.1| hypothetical protein OsI_06982 [Oryza sativa Indica Group]
Length=227

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 133/200 (67%), Gaps = 13/200 (7%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRP---------  419
            FKTPLRKL ++ +DR KRGR  P+ VK+VA  V  L+  T+YS+ EI  R          
Sbjct  21   FKTPLRKLAVMGIDRLKRGRRAPVAVKTVAGVVLALLASTLYSMAEISGRAGGDPESGGG  80

Query  418  ---LESINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  248
                 S++PTDQVL ++ +L+ASLMG+ LFL+L+IDRLH YIRELR L+K +EA  KH++
Sbjct  81   GGGGASLSPTDQVLFSRHLLEASLMGYSLFLALVIDRLHQYIRELRGLKKNVEAVIKHNK  140

Query  247  GFDNGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLL  68
              +  K+G  EE    +EEI ++   +KKL+ + + K EEV   +D + + + QSE LLL
Sbjct  141  MLEEAKHGRSEETKKYQEEIGALNEDMKKLKLQVQEKTEEVHVAEDKALAIRKQSESLLL  200

Query  67   EYGQLLEENQHLRSQLHALD  8
            EY +LLE+NQHLR QL ++D
Sbjct  201  EYDRLLEDNQHLREQLQSID  220



>ref|XP_010057913.1| PREDICTED: B-cell receptor-associated protein 31-like [Eucalyptus 
grandis]
 gb|KCW75271.1| hypothetical protein EUGRSUZ_E04024 [Eucalyptus grandis]
Length=223

 Score =   180 bits (456),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (76%), Gaps = 4/191 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE----SINP  401
            FKTPLRKL I+ LDR KRG GP+VV +VAATV V++   VYS+ +I+ R  E    + NP
Sbjct  21   FKTPLRKLAIVGLDRVKRGHGPVVVTTVAATVCVVLGSGVYSMVKIRRRGAEDGGGAANP  80

Query  400  TDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            TDQVL+A+ +L+ +LMG  LFL+LMIDRLHHYIRELRL RK+MEA KK  R F++GKNG 
Sbjct  81   TDQVLMAKHLLECTLMGATLFLALMIDRLHHYIRELRLRRKSMEAVKKQTRAFEDGKNGN  140

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
            +EE+ +L+EE   ++ K+K+LES+ + + ++V A + NS + + QSE  LLEY +LLEEN
Sbjct  141  LEELKNLEEETRVLREKVKQLESDLDTRTKDVHAAEANSVALRKQSEGFLLEYDRLLEEN  200

Query  40   QHLRSQLHALD  8
            Q+LR+QL +LD
Sbjct  201  QNLRNQLQSLD  211



>ref|XP_004287957.1| PREDICTED: B-cell receptor-associated protein 31-like [Fragaria 
vesca subsp. vesca]
Length=218

 Score =   179 bits (455),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 141/189 (75%), Gaps = 5/189 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FK+PLRKL+I+ LD+ KRG+GP+VVK+V  TV  ++   +Y++ E++SR  E+  +NPTD
Sbjct  21   FKSPLRKLVILGLDKLKRGKGPVVVKTVGGTVAAVLCANIYNLNELKSRTNEAGMLNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL++ ++L+ SLMGF LFLSLMIDRLHHYIRELR LRKAMEAAKK ++     K+ G +
Sbjct  81   EVLMSMKLLEISLMGFFLFLSLMIDRLHHYIRELRFLRKAMEAAKKQNQPTQEEKSEGHK  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
               +L +E  ++++K+K LESE E K ++ KA     ++ K QSE LLLEY +LLEENQH
Sbjct  141  ---TLVQENETLRAKVKNLESEHETKEKKAKATGAEVQALKKQSEGLLLEYDRLLEENQH  197

Query  34   LRSQLHALD  8
            LR QL ++D
Sbjct  198  LRDQLKSID  206



>ref|XP_008384089.1| PREDICTED: B-cell receptor-associated protein 29-like [Malus 
domestica]
Length=222

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 144/190 (76%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            F+TP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I+   ++    ++PT
Sbjct  21   FRTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVLMTNVYSIVKIRGSRIDKAAVLSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +RG ++GK+  +
Sbjct  81   DQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNRGSEDGKSSSL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LLEY +LLEENQ
Sbjct  141  DKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSILALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            +L+  L ++D
Sbjct  201  NLKXXLQSVD  210



>ref|NP_001170289.1| LOC100384252 [Zea mays]
 gb|ACG36076.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|AFW71005.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=220

 Score =   177 bits (450),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 133/193 (69%), Gaps = 6/193 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES-----I  407
            FKTPLRKL ++ +DR KRGR  P+VVK+VA  +  L+  T+YS+ +I     +S      
Sbjct  21   FKTPLRKLAVLVIDRLKRGRHAPVVVKTVAGVILALLASTLYSMTQIAGSTSDSDSGGGP  80

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
             PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+
Sbjct  81   TPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKH  140

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
            G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE
Sbjct  141  GNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  200

Query  46   ENQHLRSQLHALD  8
            +NQHLR+QL ++D
Sbjct  201  DNQHLRTQLLSID  213



>gb|KHN36526.1| ATP-dependent helicase rhp16 [Glycine soja]
Length=1121

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = -1

Query  505   PLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFVLFLS  332
             P+VVK+VAAT+ V++  ++YS+ +I+ R L++   NPTDQVL+ + +L+ASLMGFVLFLS
Sbjct  942   PVVVKTVAATLLVVLASSLYSIAKIRHRNLDAPVANPTDQVLVYKHMLEASLMGFVLFLS  1001

Query  331   LMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKKLES  152
             LMIDRLHHYIRELRLLRKAMEAAKK  R F+ GK+    E  +L EEIA +K KI+KLES
Sbjct  1002  LMIDRLHHYIRELRLLRKAMEAAKKQSRSFEGGKSVSAAEHKALVEEIAMLKPKIEKLES  1061

Query  151   ECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALDEN  2
             ECE +  + KA +   E+ + QSE  L+EY +LL +NQ+LRSQ+ A+D +
Sbjct  1062  ECEMEASKAKALETEVEALRKQSEGFLMEYDRLLADNQNLRSQVQAIDHS  1111



>ref|XP_009358864.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=222

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 147/190 (77%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTP RKL+I+ LD+ KRGRGP+VVK+VAATVFV+++  VYS+ +I++  ++    ++PT
Sbjct  21   FKTPFRKLVILGLDQIKRGRGPVVVKTVAATVFVVVMTNVYSIVKIRASRIDKAAVLSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK+MEA KK +RG ++GK+  +
Sbjct  81   DQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKSMEALKKQNRGSEDGKSSIL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++   + E+A++++++K+LESE E K ++V   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  DQMKVSENEMATLRTRLKQLESEIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
             L++QL +LD
Sbjct  201  KLKNQLKSLD  210



>ref|NP_001154328.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
 gb|AEE28812.1| B-cell receptor-associated protein 31-like protein [Arabidopsis 
thaliana]
Length=220

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 141/189 (75%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPTD
Sbjct  21   FKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LM  VL L L+   LHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMVRVLELCLL-LWLHHYMRELRIRRKNMEVIKKEGALLEGVKARGLD  139

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV +L EEI S++ + ++L+SE EA+ +E++ +K ++ + + QSE  L+E+ +LLEENQ 
Sbjct  140  EVKNLMEEITSLRKRQEQLDSELEARSKEIRTEKTSAVALQKQSEGFLIEFNRLLEENQV  199

Query  34   LRSQLHALD  8
            LR QLH +D
Sbjct  200  LRDQLHTVD  208



>ref|XP_009357471.1| PREDICTED: uncharacterized protein LOC103948199 [Pyrus x bretschneideri]
Length=222

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            F+TP RKL+I+ LD+ KRGRGP+VVK+VAATV V+++  VYS+ +I+   ++    ++PT
Sbjct  21   FRTPFRKLVILGLDQIKRGRGPVVVKTVAATVLVVLMTNVYSIVKIRGSRIDKAAVLSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVL+ + +L A+LMG  LFL+LMIDRLHHYIRELR+ RK MEA KK +RG ++GK+  +
Sbjct  81   DQVLMIKHLLDATLMGCSLFLALMIDRLHHYIRELRIRRKGMEALKKQNRGSEDGKSSSL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++  L+ E+A++ +++K+LESE E K ++V   + +  + + QSE  LLEY +LLEENQ
Sbjct  141  DKMKVLENEMATLHTRLKQLESEIETKTKDVHTAESSVLALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
            + +++L + D
Sbjct  201  NFKNRLQSFD  210



>ref|XP_004952370.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=219

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 128/193 (66%), Gaps = 6/193 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-----SI  407
            FKTPLRKL ++ LDR KRGR  P+ VK+VA     L+  T+YS+ EI  R  +      +
Sbjct  21   FKTPLRKLAVLGLDRLKRGRRAPVAVKTVAGVFLALLASTLYSMAEISGRASDPDSGGGL  80

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
             PTDQVL ++ +L+ASLMG+ LFL L+IDRLH YIR+LR  +K +EA  KH+   +  K 
Sbjct  81   TPTDQVLFSRHLLEASLMGYTLFLMLVIDRLHQYIRDLRGFKKNLEAVSKHNNMLEEAKV  140

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
            G  EE    +EEIA++  ++ KL+ + + K EEV   +D + + + QSE LL+EY +LLE
Sbjct  141  GISEETKKYQEEIANLNKEMNKLKLQVQEKTEEVHVAEDKALAIQKQSEGLLIEYDRLLE  200

Query  46   ENQHLRSQLHALD  8
            +NQHLR QL ++D
Sbjct  201  DNQHLRIQLQSID  213



>ref|XP_008371075.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=222

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 143/190 (75%), Gaps = 3/190 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES---INPT  398
            FKTP RKL+I+ LD+ KRGRGP+VV +VAATVFV+++  VY   +I++  ++    ++PT
Sbjct  21   FKTPFRKLVILGLDQIKRGRGPVVVATVAATVFVVLMTNVYGXVKIRASRIDKAAVLSPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGV  218
            DQVLL + +L A+LMG  LFL+LMIDRLHHYIRELR  RK+MEA KK +RG ++GK+  +
Sbjct  81   DQVLLIKHLLDATLMGCSLFLALMIDRLHHYIRELRJRRKSMEALKKQNRGSEDGKSSIL  140

Query  217  EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQ  38
            +++   + E+A++++++K+LES+ E K ++V   + N  + + QSE  LLEY +LLEENQ
Sbjct  141  DQMKVSENEMATLRARLKQLESDIETKTKDVHTAESNVLALRKQSEGFLLEYDRLLEENQ  200

Query  37   HLRSQLHALD  8
             L++QL +LD
Sbjct  201  KLKNQLKSLD  210



>ref|XP_003580219.1| PREDICTED: B-cell receptor-associated protein 31-like [Brachypodium 
distachyon]
Length=221

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 136/189 (72%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTD  395
            F+TP R+L ++++DR+KRGRGP++ ++VAAT+F+++  + YS+ +I+ R      + PTD
Sbjct  21   FRTPARRLALLAVDRSKRGRGPIMARTVAATMFMVLGSSGYSIAKIRRREGDFAQLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMG+ LFL L+IDRLHHYIR++R ++K+MEA  K  +  +  K  G E
Sbjct  81   QVLASRHLLEASLMGYSLFLGLVIDRLHHYIRQIRTMKKSMEAVTKQSKTLEEAKLQGAE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+   +++I+S+  +++ ++ + E K EE+K  + N+ + + QSE LL EY +L+ EN+ 
Sbjct  141  EIQGYQKKISSLNEQVQAVKHQYETKTEELKTAEANTLALRKQSEGLLTEYERLIAENEE  200

Query  34   LRSQLHALD  8
            LR++L +++
Sbjct  201  LRNKLQSME  209



>ref|XP_006847259.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
 gb|ERN08840.1| hypothetical protein AMTR_s00015p00062110, partial [Amborella 
trichopoda]
Length=219

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 139/189 (74%), Gaps = 3/189 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTD  395
             +TPLRKL+++ LDR KRGRGP VVK++A TVFV+++ +V SV +IQ R   + SI PTD
Sbjct  21   VRTPLRKLVLLGLDRVKRGRGPAVVKTLATTVFVVLVSSVNSVMKIQRRASAVGSITPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL+++ +L+AS+MG+ LFL+LMIDR+HH++ ELR+LRK + ++ +      +G N    
Sbjct  81   QVLMSKHMLEASMMGYALFLTLMIDRMHHHMTELRILRKQIRSSGEGKSAGGSGDNSNSN  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
               +L+E+IA+++ K+K+L+ E EAK  E K  + N+ + + QSE  LLEY +LLE+NQ+
Sbjct  141  R-RALEEDIAALQEKVKELQLESEAKDREAKTAETNAMALRKQSEGFLLEYDRLLEDNQN  199

Query  34   LRSQLHALD  8
            LRSQL ++D
Sbjct  200  LRSQLQSVD  208



>dbj|BAJ86435.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=221

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 133/189 (70%), Gaps = 2/189 (1%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+TP R+L ++++D +KRGRGP++ ++VAAT+ V++  + YS+ +I+ R  E   + PTD
Sbjct  21   FRTPARRLALLAVDCSKRGRGPVMARTVAATMLVVLGSSGYSIAKIRRREGEFAQLTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            QVL ++ +L+ASLMG+ LFL L+IDRLHHYIR+LR ++K MEA  K  R  +  K G  E
Sbjct  81   QVLASRHLLEASLMGYSLFLGLIIDRLHHYIRQLRAMKKNMEAVTKQSRVLEETKLGDSE  140

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+   +++I S+  +++ L+ + E++ EE+K  + N+ + + QSE LL EY +L+ EN+ 
Sbjct  141  EIQRYQKKIDSLNEQVQALKHQSESQTEELKTAEINNLALRKQSEGLLTEYERLIAENEE  200

Query  34   LRSQLHALD  8
            LR++L  ++
Sbjct  201  LRNKLQTME  209



>ref|XP_002453641.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
 gb|EES06617.1| hypothetical protein SORBIDRAFT_04g009770 [Sorghum bicolor]
Length=222

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 133/195 (68%), Gaps = 8/195 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGR-GPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESI-----  407
            FKTPLRKL ++ +DR KRGR  P+VVK+VA  V  L+  T+YS+ +I     +S      
Sbjct  21   FKTPLRKLAVLVVDRLKRGRHAPVVVKTVAGVVLALLASTLYSMSQISGGASDSDSGSGG  80

Query  406  --NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
               PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR+ +K +EA +KH++  +  
Sbjct  81   GPTPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRVFKKDLEAVRKHNKMLEET  140

Query  232  KNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQL  53
            K+G  E+    +EEIA +  ++KKL+ + + K EEV   +D + + + QSE LL+EY +L
Sbjct  141  KHGNSEDAKKYQEEIAILNKEMKKLKLQVQEKIEEVHVAEDKALTIQKQSEGLLIEYDRL  200

Query  52   LEENQHLRSQLHALD  8
            LE+NQHLR QL ++D
Sbjct  201  LEDNQHLRDQLMSID  215



>ref|XP_003563854.1| PREDICTED: B-cell receptor-associated protein 29 [Brachypodium 
distachyon]
Length=226

 Score =   157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP-------LES  410
            FKTPLRKL +++LDR KRG+GP++V++VAATV V++  +++S+ +I             +
Sbjct  21   FKTPLRKLAMLALDRLKRGKGPVMVRTVAATVLVVLASSLHSMAKIHGHASGGELDAPGA  80

Query  409  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  230
            + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  K
Sbjct  81   LTPTDQVLLARHLLEASLMGYSLFLALIIDRLHRYIREMRGLKKNLEAVSKQNKTLEEVK  140

Query  229  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  50
                +     +++IAS+  +IKKL  + + K +EVK  +  + + + QSE L+L+Y +LL
Sbjct  141  LVTSDGSKPYQKDIASLNEEIKKLRLQLKEKADEVKDAEARAVAAQTQSEGLMLKYDRLL  200

Query  49   EENQHLRSQLHALD  8
            E+ +HL  QL + D
Sbjct  201  EDKKHLHDQLQSGD  214



>gb|KHG00718.1| separin [Gossypium arboreum]
 gb|KJB67240.1| hypothetical protein B456_010G182000 [Gossypium raimondii]
Length=160

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 113/142 (80%), Gaps = 4/142 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINP--TD  395
            FKTPLRKL+++ LDRAKRGRGP++VK+V  TV V+M+  ++S+  ++ R +   N   TD
Sbjct  21   FKTPLRKLVLMVLDRAKRGRGPVIVKTVGGTVSVVMLSYIFSMMMLKKRWIVDGNASLTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            ++L+A+ +L+ +LMG +LFLSL+ID+LHHYI+ELR+ RK ME AKK  +GF++   GG +
Sbjct  81   EILMAKNLLETTLMGGLLFLSLIIDKLHHYIKELRIRRKTMETAKKQGQGFEDA--GGSD  138

Query  214  EVNSLKEEIASMKSKIKKLESE  149
            +V +L+EEIA+++++IK+LES+
Sbjct  139  KVTALEEEIATLRARIKQLESD  160



>gb|ADE75913.1| unknown [Picea sitchensis]
Length=228

 Score =   155 bits (393),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 126/192 (66%), Gaps = 8/192 (4%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLRKL+I  LD+ K G+G  +VK++  T+ V++  ++ S+ +IQ+R ++  +I PTDQ+L
Sbjct  25   PLRKLIIKILDQTKTGKGSAIVKTLGGTMLVILASSITSILKIQTRSVKMGTIAPTDQIL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD------NGKNG  224
            +   +L+ASLMGF LFL+++IDRLHHYIREL  LR  ME+ +K  +           +  
Sbjct  85   MRTHLLEASLMGFALFLAIIIDRLHHYIRELSGLRMNMESLRKQAKSSQEEYFRLKEEKE  144

Query  223  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEE  44
            G  E+  LK+EIA +K K++KL  E + K  E +  + N+ + + QSE  LLEY +LLE+
Sbjct  145  GSNEMTLLKDEIADLKQKLQKLTLESKEKEREAEVAESNALALRKQSEGFLLEYDRLLED  204

Query  43   NQHLRSQLHALD  8
            NQ+LRSQL   D
Sbjct  205  NQNLRSQLATFD  216



>ref|NP_001057612.2| Os06g0367500 [Oryza sativa Japonica Group]
 dbj|BAD69146.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG88794.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF19526.2| Os06g0367500 [Oryza sativa Japonica Group]
Length=199

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 129/187 (69%), Gaps = 9/187 (5%)
 Frame = -1

Query  541  IISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--------SINPTDQVL  386
            ++ LDR KRGRGP++V++VAATV V++  +V+S+ +I+ R           ++ PTDQVL
Sbjct  1    MLGLDRLKRGRGPVMVRTVAATVLVVLASSVHSMNKIRGRAAGELDGAGAGTLTPTDQVL  60

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-NGGVEEV  209
            LA+ +L+ASLMG+ LFL+L+IDRLH+YIRE+R L++ +EAA K ++  D  K  G  +E 
Sbjct  61   LARHLLEASLMGYSLFLALVIDRLHNYIREVRGLKRNLEAASKLNKTLDEAKLIGSSDES  120

Query  208  NSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLR  29
             + +++IAS+  +IKK++ + + K  E K  +  + + + QSE L++EY  L+E+N+HL 
Sbjct  121  KTYQKDIASLNEEIKKMKRQLKEKANEAKDAEAKALAAQKQSEGLMIEYNHLVEDNKHLH  180

Query  28   SQLHALD  8
             QL + D
Sbjct  181  DQLESAD  187



>gb|AAC17626.1| Contains similarity to BAP31 protein gb|X81816 from Mus musculus 
[Arabidopsis thaliana]
 gb|ACB88825.1| At1g11905 [Arabidopsis thaliana]
Length=228

 Score =   151 bits (382),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            FKTP+RKLLI+SLDR+KRGRGP+V+++V+ATV VL++ +VY++  IQ R +E   +NPTD
Sbjct  21   FKTPIRKLLIMSLDRSKRGRGPVVIQTVSATVIVLLVTSVYNMMGIQKRWIEDGVVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +V++A+ +L+++LMG  LFL LMIDRLHHY+RELR+ RK ME  KK     +  K  G++
Sbjct  81   EVIMAKHLLESTLMGGFLFLGLMIDRLHHYMRELRIRRKNMEVIKKEGALLEGVKARGLD  140

Query  214  EVNSLKEEIAS  182
            EV +L EEI S
Sbjct  141  EVKNLMEEITS  151



>dbj|BAJ87002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score =   149 bits (377),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 130/190 (68%), Gaps = 7/190 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-------S  410
            FKTPLRKL +++LDR KRG+ P++V++VAATV V++  +++S+ +I             +
Sbjct  21   FKTPLRKLAMLALDRLKRGQAPVMVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGA  80

Query  409  INPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  230
            ++PTDQVLLA+ +L+ASLMG++LFL+L+IDRLH YIRE+R L+K +EA  K ++  +  +
Sbjct  81   LSPTDQVLLARHLLEASLMGYILFLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAR  140

Query  229  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  50
            +G  +E      ++AS+  +IKKL+ + + K +E K  +  + + + QSE L  +Y  LL
Sbjct  141  SGKSDESKPHHNDMASLNEEIKKLKLQLKEKAQEAKDAEAKAVAAQTQSEGLARKYDSLL  200

Query  49   EENQHLRSQL  20
            E+N+HL  QL
Sbjct  201  EDNKHLHEQL  210



>ref|XP_008229970.1| PREDICTED: B-cell receptor-associated protein 31-like [Prunus 
mume]
Length=241

 Score =   142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 122/188 (65%), Gaps = 6/188 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSV--QEIQSRPLES--I  407
            F TP+ K  I  LD  K  +G+G L+VK V  T+F++++   YS+    +++R  E   +
Sbjct  32   FDTPVTKTAISELDSLKLNQGKGLLLVKIVTGTLFLVVMANFYSLLRMNMKNRTNEGSGL  91

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
            NPT++VL +  ILQ SL+G VLFL LMID LHHYI+ L  L  AMEAAK  ++ F   K 
Sbjct  92   NPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIKGLPSLVMAMEAAKTQNQSFRKEKT  151

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
            G V+++N++ +E  ++++K+K LESECE++  E    +  +E+ + +SE  L EY +LL 
Sbjct  152  GSVQKLNTMVQEKDTLRTKLKYLESECESEANEANKARAEAEALRQESEGFLKEYDRLLA  211

Query  46   ENQHLRSQ  23
            +NQ+ R+Q
Sbjct  212  DNQNFRNQ  219



>ref|XP_007215894.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
 gb|EMJ17093.1| hypothetical protein PRUPE_ppa010667mg [Prunus persica]
Length=241

 Score =   141 bits (356),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 122/188 (65%), Gaps = 6/188 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAK--RGRGPLVVKSVAATVFVLMIYTVYSVQEI--QSRPLES--I  407
            F  P+ K  I+ LD  K  +G+G L+VK V  T+F++++   YSV  I  ++R  E   +
Sbjct  32   FDAPMTKTAILELDSLKLNQGKGLLIVKIVTGTLFLVLMANFYSVLRITMKNRTNEGGGL  91

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
            NPT++VL +  ILQ SL+G VLFL LMID LHHYIR L  L  AMEAAK  ++ F   K 
Sbjct  92   NPTEEVLKSMNILQISLIGIVLFLVLMIDSLHHYIRGLPSLVMAMEAAKTQNQSFRKEKT  151

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
              V+++N++ +E  ++++K+K LESEC+++  E    +  +E+ + +SE+ L EY +LL 
Sbjct  152  ESVQKLNTMVQEKDTLRTKLKYLESECKSEANEANKARAEAEALRQESEEFLKEYDRLLA  211

Query  46   ENQHLRSQ  23
            +NQ+ R+Q
Sbjct  212  DNQNFRNQ  219



>ref|NP_001051893.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|AAO37960.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99895.1| B-cell receptor-associated protein 31-like containing protein, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF13807.1| Os03g0848400 [Oryza sativa Japonica Group]
 gb|EAZ29303.1| hypothetical protein OsJ_13364 [Oryza sativa Japonica Group]
 dbj|BAG90494.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87435.1| unnamed protein product [Oryza sativa Japonica Group]
Length=217

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 125/190 (66%), Gaps = 9/190 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR++ +  +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREVAMRGVEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-------DRGFDNGKN  227
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L +EIA +   +KKL+SE E    +V   + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSSEIKKLHQEIAKLNESMKKLKSESEDHERKVLEAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQLH  17
            +NQ L+SQLH
Sbjct  205  DNQILQSQLH  214



>ref|XP_006650891.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=217

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 125/190 (66%), Gaps = 9/190 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+  +  +++AK+G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREAAMRGVEQAKQGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  227
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLVTLRKAANTSREEVEKLQMENRSFHEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L++EIA +   +KKL+SE E   +     + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSGEIKKLQQEIAKLNESMKKLKSESEDHEKAALEAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQLH  17
            +NQ L+SQLH
Sbjct  205  DNQILQSQLH  214



>ref|XP_010247234.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   138 bits (348),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMKALDQLKTGKGPATVKTIAGTMSVILASSITSLLKIQNRGTKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMG+ LFL  +IDRLHHY+++L  LR     +K       K        + 
Sbjct  85   WRTHLLEASLMGYSLFLGFVIDRLHHYLQKLGGLRTTARYSKQEVEKLHKDHLQLKEKEV  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+  L+EEI+S+K  IKKL+ ECE K ++V++ + +  + + Q+E LLLEY +LLE
Sbjct  145  KASEEIKLLQEEISSLKENIKKLKLECEEKDKQVQSAEAHVTALQKQAEDLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>gb|EAY92582.1| hypothetical protein OsI_14323 [Oryza sativa Indica Group]
Length=217

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 123/190 (65%), Gaps = 9/190 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+  +  +++AK G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLREAAMRGVEQAKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  227
                +L+ASL+GF LFL+ +IDRLHHY+R+L  LRKA   +++        +R F   + 
Sbjct  85   WRTHLLEASLIGFTLFLAFVIDRLHHYLRKLITLRKAANTSREEVEKLQMENRLFREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L +EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSSEIKKLHQEIAKLNESMKKLKSESEDHERKALEAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQLH  17
            +NQ L+SQLH
Sbjct  205  DNQILQSQLH  214



>ref|XP_006479253.1| PREDICTED: B-cell receptor-associated protein 31-like isoform 
X1 [Citrus sinensis]
 gb|KDO65964.1| hypothetical protein CISIN_1g027820mg [Citrus sinensis]
Length=218

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 124/188 (66%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIAGTMFVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR       + +E  +K      + + 
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIRLRSNAGSSKEEVEQLQKEKMQLKDKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+EEI+++   +KKL+SECE K ++++    +  + + QS  LLLEY +LLE
Sbjct  145  KASKELKRLQEEISTLSVNLKKLKSECEQKDKQLETADAHVIALQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L+ Q
Sbjct  205  DNQNLQKQ  212



>ref|XP_009802750.1| PREDICTED: uncharacterized protein LOC104248228 [Nicotiana sylvestris]
Length=145

 Score =   134 bits (338),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  ES  +NPTD
Sbjct  21   FRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRATESGTVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            QVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  81   QVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_009779153.1| PREDICTED: B-cell receptor-associated protein 31-like, partial 
[Nicotiana sylvestris]
Length=150

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -1

Query  352  GFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKS  173
            GF LFL+ MIDRLHHYIREL + RK MEA +K +R F++GK+G  EE+ +L+EE ++++ 
Sbjct  24   GFSLFLAFMIDRLHHYIRELSMRRKTMEAVRKQNRAFEDGKSGASEEIKTLEEEASALRG  83

Query  172  KIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALD  8
            KIK+LESE + K +E    + N+ + K QSE  LLEY +LLEENQ+LRSQL +LD
Sbjct  84   KIKQLESELQVKAKEASGAEANAVALKKQSEGFLLEYDRLLEENQNLRSQLQSLD  138



>gb|KHG09837.1| hypothetical protein F383_09194 [Gossypium arboreum]
Length=218

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 126/188 (67%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  227
                +L+ASL+GF LFL  +IDR+HHYI++L  LR  + ++K+     +  +       +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKEEAERIEKERIQLKEKDD  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LKEEI+++   +KKL+SE E K +++K  + +  S + QS  LLLEY +LLE
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKSESEEKDKKIKTAEAHVASLQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQNQ  212



>ref|XP_009599718.1| PREDICTED: uncharacterized protein LOC104095323 [Nicotiana tomentosiformis]
Length=145

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 89/106 (84%), Gaps = 2/106 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRK ++++LDR+K+GRGP++VKS   T+FV+++  +++V  IQ+R  +S  +NPTD
Sbjct  21   FRTPLRKPVLMALDRSKQGRGPVIVKSAGGTLFVVLVSILFNVTIIQNRATDSGTVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            QVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +EA KK
Sbjct  81   QVLLANHLLEASLLGFSLFLALVIDRLHYYIKELRLLRKTLEAEKK  126



>ref|XP_006365288.1| PREDICTED: uncharacterized protein LOC102597522 [Solanum tuberosum]
Length=147

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 93/118 (79%), Gaps = 2/118 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  +S  +NPTD
Sbjct  22   FRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRATDSGTVNPTD  81

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGG  221
            QVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK +E  KK ++  D  +N  
Sbjct  82   QVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTLEGEKKTNQSRDQVENAA  139



>ref|XP_004248701.1| PREDICTED: uncharacterized protein LOC101261860 [Solanum lycopersicum]
Length=147

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 91/112 (81%), Gaps = 2/112 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRK ++++LD++K+GRGP++VKS   T+FV+++  +++V  +Q+R  +S  +NPTD
Sbjct  22   FRTPLRKPVLMALDKSKQGRGPVIVKSAGGTLFVVLVSILFNVTLMQNRATDSGTVNPTD  81

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  239
            QVLLA  +L+ASL+GF LFL+L+IDRLH+YI+ELRLLRK ME  KK ++  D
Sbjct  82   QVLLANHLLEASLLGFTLFLALVIDRLHYYIKELRLLRKTMEGEKKMNQNRD  133



>ref|XP_009381320.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381321.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381322.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009381323.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L +  LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELAMRGLDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRGAKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +++ASL+G+ LFL+L+IDRLHHY+R+L  LR+        +E  KK  + F   + 
Sbjct  85   WRTHLVEASLIGYTLFLALVIDRLHHYLRKLINLRRTANSSQEEVENLKKEQQRFKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
              + E+  L EE+AS+K +++KL+SE     +  +  + +  + + QSE+LLLEY +LLE
Sbjct  145  TSLNEIKKLHEEVASLKERLQKLKSESAEHEKRAETAEAHVTALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ L++Q
Sbjct  205  DNQILQTQ  212



>ref|XP_009371858.1| PREDICTED: B-cell receptor-associated protein 31 [Pyrus x bretschneideri]
Length=219

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           +N
Sbjct  85   WRTHLLEASLMGFTLFLGFVIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKEN  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE
Sbjct  145  KSSQEIKELQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQTQ  212



>gb|ACN36491.1| unknown [Zea mays]
Length=157

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -1

Query  406  NPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN  227
             PTDQVL ++ +L+A LMG+ LFL+L+IDRLH YIR+LR  +K +EA +KH++  +  K+
Sbjct  18   TPTDQVLFSRHLLEACLMGYSLFLALVIDRLHQYIRDLRRFKKDLEAVRKHNKMLEEAKH  77

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
            G  EE    +EEIA++  ++KKL+ + + K EEV   +D + + + QSE LL EY +LLE
Sbjct  78   GNSEEAKKYQEEIATLNKEMKKLKLQVQEKTEEVHVSEDKALAIQKQSEGLLTEYDRLLE  137

Query  46   ENQHLRSQLHALD  8
            +NQHLR+QL ++D
Sbjct  138  DNQHLRTQLLSID  150



>gb|EAZ03537.1| hypothetical protein OsI_25672 [Oryza sativa Indica Group]
 gb|EAZ39454.1| hypothetical protein OsJ_23885 [Oryza sativa Japonica Group]
Length=214

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 123/188 (65%), Gaps = 5/188 (3%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L +  +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL
Sbjct  25   PLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSSVASILRIQNRGIKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD---NGKNGGVE  215
                +L+ASL+G++LFL+ +IDRLHHY R+L +L+K    +++          GK    +
Sbjct  85   WRTHLLEASLIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQIELQGKEDKSK  144

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            EV  L+ E+AS+  K+KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ 
Sbjct  145  EVKKLRAELASLSEKMKKLKSESEEHERQRLEAEAHVNALQKQSEELLLEYDRLLEDNQI  204

Query  34   LRSQLHAL  11
            L++Q+ +L
Sbjct  205  LQTQVLSL  212



>ref|XP_006830526.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
 gb|ERM97942.1| hypothetical protein AMTR_s00117p00045900 [Amborella trichopoda]
Length=220

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  LD+ K GRGP  VK++A T+ V+M  ++ S+ +IQ+R L+  ++ P DQVL
Sbjct  25   PLRELTMKGLDQLKMGRGPATVKTLACTMAVIMASSITSILKIQNRGLKIGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN-------GKN  227
                +L+ASL+G+ LFL+L+IDR+H+Y+ +L   +K +  +K+  + F          + 
Sbjct  85   WRTHLLEASLIGYSLFLALVIDRMHNYLSKLSGSKKTLGNSKQQAKKFQEEYALLKEKQE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+ +LKEEI+S+  +++KL+ E + K +  +A + N  + + QSE LLLEY +LLE
Sbjct  145  KASEEIRALKEEISSLTERLQKLKLESDEKEKRAQAAEANVIALQKQSEDLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ L+SQ
Sbjct  205  DNQILQSQ  212



>ref|XP_010069636.1| PREDICTED: B-cell receptor-associated protein 31 [Eucalyptus 
grandis]
 gb|KCW58050.1| hypothetical protein EUGRSUZ_H00780 [Eucalyptus grandis]
Length=218

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ SL++ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLEQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+++L  LR       + +E+ +K        + 
Sbjct  85   WRTHLLEASLMGFTLFLGFVIDRVHHYLQKLITLRSKEGVSKEEVESLRKEQLELKEKEG  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
              ++E+  L++EI++M   +KKL+ ECE K ++V+  + +  + + QS  LLLEY +LLE
Sbjct  145  KSLKEIKQLQKEISNMLEGLKKLKLECEEKDKKVETAESHVAALQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L+SQ
Sbjct  205  DNQNLQSQ  212



>gb|KJB26033.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=202

 Score =   133 bits (334),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL
Sbjct  11   PLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVL  70

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKN  227
                +L+ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +
Sbjct  71   WRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDD  130

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE
Sbjct  131  KASLEIKKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLE  190

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  191  DNQNLQNQ  198



>gb|KJB10919.1| hypothetical protein B456_001G232500 [Gossypium raimondii]
Length=218

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I S+D+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSIDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  227
                +L+ASL+GF LFL  +IDR+HHYI++L  LR  + ++K      +  +       +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYIKKLIGLRSRVGSSKDEAERIEKERIQLKEKDD  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LKEEI+++   +KKL+SE E K ++++  + +  S + QS  LLLEY +LLE
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKSESEEKDKKIEIAEAHVASLQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQNQ  212



>gb|ACG43219.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 gb|ACG44967.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
 tpg|DAA52496.1| TPA: b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 120/189 (63%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L++QL
Sbjct  205  DNQILQTQL  213



>ref|XP_002463520.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
 gb|EER90518.1| hypothetical protein SORBIDRAFT_01g001290 [Sorghum bicolor]
Length=217

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 118/189 (62%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E   L+ EIA +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSSETKKLQREIAKLNESMKKLKSETEEHERKASVAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L++QL
Sbjct  205  DNQILQTQL  213



>gb|KJB26032.1| hypothetical protein B456_004G226500 [Gossypium raimondii]
Length=216

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+  +++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIAGTMSAILLSSFMSILKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAM-----EAAKKHD--RGFDNGKN  227
                +L+ASL+GF LFL  +IDR+HHYI++L  LR ++     E  + H+  +      +
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRIHHYIKKLIRLRSSIGSSTEEVQRLHEERKQLKEKDD  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  LKEEI+++   +KKL+SE E K  +++  + +  S + QS  LLLEY +LLE
Sbjct  145  KASLEIKKLKEEISTLSQNLKKLKSESEEKDRKIETAEAHVASLQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQNQ  212



>ref|XP_009370674.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
 ref|XP_009334907.1| PREDICTED: B-cell receptor-associated protein 31-like [Pyrus 
x bretschneideri]
Length=218

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 120/188 (64%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ A+K       K        + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKETMQLKKQEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +EV  L+ +I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASQEVKQLQAKISTLTEDLKKLKLECAEKDKSIETAECHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQNQ  212



>ref|XP_008809940.1| PREDICTED: B-cell receptor-associated protein 31-like [Phoenix 
dactylifera]
Length=218

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 124/189 (66%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMRGLDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGVKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKN  227
                +L+ASL+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++
Sbjct  85   WRTHLLEASLIGYTLFLGLVIDRLHHYLRKMVSLKKTVGTSKEEVEKLKKEHHYFKDKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E++ L+ E+ S+  K++KL++ECE + +   + + +  S + QSE+LLLEY +LLE
Sbjct  145  KVSSEIHKLQGEVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L+ QL
Sbjct  205  DNQILQGQL  213



>ref|XP_008380294.1| PREDICTED: uncharacterized protein LOC103443257 [Malus domestica]
Length=150

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q R  E+  +NPTD
Sbjct  21   FRTPLRKLVIVGLDRSKQGRGPLVXKSVGGTILVFFSSTIYSVFSVQKRLSEAGFVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLR+ +E  K   + +++ K+    
Sbjct  81   EVLMAHRLLEASLIGFSLFLAMIIDRLHYYIKELHLLRERVEEVKNLKKDYEHKKSTDPA  140

Query  214  EVNSLKEEIA  185
            EV    + I+
Sbjct  141  EVKKATQRIS  150



>ref|XP_010927692.1| PREDICTED: B-cell receptor-associated protein 31-like [Elaeis 
guineensis]
Length=218

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 120/188 (64%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR++ +  LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLREMAMKGLDQLKSGKGPATVKTLACTLAVILVSSVTSILKIQNRGVKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+L+IDRLHHY R+L  LRK        +E  KK   GF   + 
Sbjct  85   WRTHLLEASLIGYTLFLALVIDRLHHYHRKLITLRKIVGTSSEEVEKLKKEHHGFKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+ E++++  K++KL+ E E + +     +    + + QSE+LLLEY +LLE
Sbjct  145  KSSDEIKELQMEVSNLTEKLQKLKCEFEEQEKRAITAEAYVTALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ L++Q
Sbjct  205  DNQILQTQ  212



>ref|XP_006657620.1| PREDICTED: B-cell receptor-associated protein 31-like [Oryza 
brachyantha]
Length=214

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 122/188 (65%), Gaps = 5/188 (3%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L +  +++AK G+GP  VK++A T+ V+ + +V S+  IQ+R   L +++P DQVL
Sbjct  25   PLRELAMRGVEQAKDGKGPAAVKTLACTLLVIFMSSVTSILRIQNRGAKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDN---GKNGGVE  215
                +L+ASL+G++LFL+ +IDRLHHY R+L +L+K    +++      N   GK    +
Sbjct  85   WRTHLLEASLIGYILFLAFVIDRLHHYHRKLTILKKTANTSREEVEKLQNELQGKEDNSK  144

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+  L+ E+A++  K+KKL+ E E         + +  + + QSE+LLLEY +LLE+NQ 
Sbjct  145  EIKKLRGELATLSEKMKKLKFESEEHERRRLEAEAHVNALQKQSEELLLEYDRLLEDNQI  204

Query  34   LRSQLHAL  11
            L++Q+ +L
Sbjct  205  LQTQVLSL  212



>ref|NP_001141677.1| uncharacterized protein LOC100273803 precursor [Zea mays]
 gb|ACF86841.1| unknown [Zea mays]
Length=217

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 119/189 (63%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSGVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LLLEY +LLE
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L++QL
Sbjct  205  DNQILQTQL  213



>ref|XP_003562352.1| PREDICTED: B-cell receptor-associated protein 31 [Brachypodium 
distachyon]
Length=217

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 123/190 (65%), Gaps = 9/190 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L + ++++ K G+GP  VK++A T+ V+ + +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRTVEQVKTGKGPATVKTLACTLSVIFMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK    +++        +R F   + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLQKLITLRKTANTSREEVEKLQMENRSFREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+++IA +   +KK++SE +    +    + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSSEIKKLQQDIAKLTEGMKKMKSESDDNERKALEAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQLH  17
            +NQ L+SQLH
Sbjct  205  DNQILQSQLH  214



>ref|XP_003532279.1| PREDICTED: B-cell receptor-associated protein 31 [Glycine max]
 gb|KHN10978.1| hypothetical protein glysoja_026713 [Glycine soja]
Length=218

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 123/191 (64%), Gaps = 15/191 (8%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE---  215
                +L+ASLMGF LFL  +IDR HHY+++L  LR    A+K+     +N K   V+   
Sbjct  85   WRSHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEE---LENLKKETVQLKE  141

Query  214  -------EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  56
                   E+  LKEE++ +   ++K++SE E K ++V+  + +  S + Q+  LLLEY +
Sbjct  142  KDEKASKEIKQLKEELSCLSKSLEKIKSESEEKDKKVETAEAHVASLQKQAADLLLEYDR  201

Query  55   LLEENQHLRSQ  23
            LLEENQ+L++Q
Sbjct  202  LLEENQNLQAQ  212



>ref|XP_008372494.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=219

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  +K++A T+ V++I    S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQIKMGKGPATIKTIAGTMSVILISDFISIVKIQNKGVKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  227
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR ++ A+K+  DR           ++
Sbjct  85   WRTHLLEASLLGFTLFLGFIIDRMHHYLSKLIGLRSSVGASKEELDRLQKEKIQLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+++I+++   +KKL+ EC  K + ++  + +  S + Q+  LLLEY +LLE
Sbjct  145  KSSQEIKQLQDKISTLTEDLKKLKLECAEKDKSIETAESHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQTQ  212



>gb|EMS49195.1| hypothetical protein TRIUR3_29235 [Triticum urartu]
Length=183

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 113/171 (66%), Gaps = 7/171 (4%)
 Frame = -1

Query  499  VVKSVAATVFVLMIYTVYSVQEIQSRPLE-------SINPTDQVLLAQQILQASLMGFVL  341
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPGALSPTDQVLLARHLLEASLMGYIL  60

Query  340  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  161
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K+G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKSGRSDESKPHHNDIASLNEEIKK  120

Query  160  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALD  8
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL  QL + D
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHLHDQLQSGD  171



>ref|XP_008382607.1| PREDICTED: B-cell receptor-associated protein 31-like [Malus 
domestica]
Length=218

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 121/188 (64%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V++I +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKGPATVKTIAGTMSVILISSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKH-DR------GFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++  +K+  DR           + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRXSVGXSKEELDRLQKETIQLKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +EV  L+ +I+++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASQEVKQLQAKISTLTEDLKKLKLECAEKDKSVETAECHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQNQ  212



>ref|XP_008226862.1| PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]
Length=153

 Score =   128 bits (322),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLR L+I+ LDR+K+GRGPLV KSV  TV V    T+Y V  +Q R  E+  +NPTD
Sbjct  21   FRTPLRTLVIVGLDRSKQGRGPLVAKSVGGTVLVFFSSTLYGVFSVQKRLTEAGFVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+A ++L+ASL+GF LFL L+IDRLH+YI+EL LLRK  E  K     F+  KN   E
Sbjct  81   EVLMAHRLLEASLIGFSLFLVLIIDRLHYYIKELNLLRKFNEEIKNLKNDFEQRKNADAE  140



>ref|XP_007049723.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
 gb|EOX93880.1| B-cell receptor-associated protein 31-like [Theobroma cacao]
Length=213

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  +K++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATMKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+R+L  LR  + ++K       K         +
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLRKLIGLRSKVGSSKEEVERLQKERIELKEKDD  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LKEEI+++   +KKL+ E E K ++++  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASKEIKLLKEEISTLSENLKKLKLESEEKDKKIETAEAHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ+L+ +L
Sbjct  205  DNQNLQIKL  213



>ref|XP_008385961.1| PREDICTED: uncharacterized protein LOC103448478 [Malus domestica]
Length=155

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TP+RKL+I+ LDR+K+GRGPLV KSV  T+ V    T+YSV  +Q+R  E+  +NPTD
Sbjct  21   FQTPVRKLVIVGLDRSKQGRGPLVAKSVGGTILVFFSSTIYSVFSVQNRLTETGFVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK  260
            +VL+A ++L+ASL+GF LFL+++IDRLH+YI+EL LLRK +E  K
Sbjct  81   EVLMAHRLLEASLIGFSLFLAMVIDRLHYYIKELXLLRKRVEEVK  125



>gb|EMT32966.1| hypothetical protein F775_31670 [Aegilops tauschii]
Length=183

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 112/171 (65%), Gaps = 7/171 (4%)
 Frame = -1

Query  499  VVKSVAATVFVLMIYTVYSVQEIQSRP-------LESINPTDQVLLAQQILQASLMGFVL  341
            +V++VAATV V++  +++S+ +I             +++PTDQVLLA+ +L+ASLMG++L
Sbjct  1    MVRTVAATVLVVLASSLHSMAKIHGHAGAGELDAPAALSPTDQVLLARHLLEASLMGYIL  60

Query  340  FLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASMKSKIKK  161
            FL+L+IDRLH YIRE+R L+K +EA  K ++  +  K G  +E      +IAS+  +IKK
Sbjct  61   FLALVIDRLHSYIREMRGLKKNLEAVSKQNKTLEEAKPGRSDESKPHHNDIASLNEEIKK  120

Query  160  LESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALD  8
            L+ + + K EE K  +  + + + QSE L  +Y +LLE+N+HL  QL + D
Sbjct  121  LKRQLKEKAEEAKDAEAKALAAQTQSEGLARKYDRLLEDNKHLHEQLQSGD  171



>gb|KDP26363.1| hypothetical protein JCGZ_17521 [Jatropha curcas]
Length=216

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVLKSLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK---NGGVE  215
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR  + ++K+        K    G  E
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLTKLISLRSNIGSSKEEVERLQKEKMQLKGKAE  144

Query  214  ----EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+E+I+++   +KKL+ E E K ++++  + +  + + QS  LLLEY +LLE
Sbjct  145  KASTEIKQLQEQISTLSESLKKLKLENEEKDKQIETAEAHVVALQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            ENQ+L++Q
Sbjct  205  ENQNLQAQ  212



>ref|XP_006452411.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475037.1| PREDICTED: uncharacterized protein LOC102621381 [Citrus sinensis]
 gb|ESR65651.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=131

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT+
Sbjct  21   FRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  248
            +VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E  K  ++
Sbjct  81   EVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEGLKNLNK  129



>ref|XP_007140653.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
 gb|ESW12647.1| hypothetical protein PHAVU_008G130500g [Phaseolus vulgaris]
Length=218

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+++L  LR +  A+       +K          
Sbjct  85   WRTHLLEASLMGFALFLGFLIDRIHHYLQKLVNLRSSTRASNEDLENLRKETVQLKGKGE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LKEE++ +   +K ++ E E K ++V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASKEIKQLKEELSRVSESLKNIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            ENQ+L++Q
Sbjct  205  ENQNLQAQ  212



>ref|XP_009361097.1| PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]
Length=153

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRKL+I+ LDR+K+GRGPLVVKSV  T+ V    T+YSV  +Q R  E+  +NPTD
Sbjct  21   FRTPLRKLVIVGLDRSKQGRGPLVVKSVGGTILVFFSSTIYSVFSVQKRLSEAGFVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE  215
            +VL+A ++L+ASL+GF LFL+++IDRLH+ I+ELRLLR  +E  K   +  ++ K+    
Sbjct  81   EVLMAHRLLEASLIGFSLFLAMIIDRLHYSIKELRLLRGLVEEVKNLKKDDEHRKSTAPA  140

Query  214  EVNSLKEEIA  185
            EV    + I+
Sbjct  141  EVKKATQMIS  150



>ref|XP_004981056.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=217

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 119/189 (63%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  S++P DQVL
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLTVILMSDVASILKIQNRGLKLGSVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK        +E  +  ++     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLMTLRKTSSTSREEVEKLQMENQSLREKEG  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+ EIA +   +KKL+ E E    +  A + +  + + QSE+LLLEY +LLE
Sbjct  145  NSSGEMKKLQREIAKLNESMKKLKFENEEHERKASAAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L++QL
Sbjct  205  DNQILQTQL  213



>ref|XP_007134124.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
 gb|ESW06118.1| hypothetical protein PHAVU_010G021100g [Phaseolus vulgaris]
Length=219

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 118/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L+I +LD+ K G+GP  VK++A T+ V++  ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKTLDQMKMGKGPATVKTIAGTMSVILFSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF-------DNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+++L  LR    A+K+               + 
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRVHHYLQKLNKLRSNAGASKEEVESIEKEKVELKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LKE+I+ +   +KK + ECE K + V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASKEIMQLKEQISGLSESLKKTKVECEEKDKRVETAEVHVTSLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            ENQ+L++Q
Sbjct  205  ENQNLQAQ  212



>ref|XP_003552124.1| PREDICTED: B-cell receptor-associated protein 31-like [Glycine 
max]
 gb|KHN41384.1| hypothetical protein glysoja_032570 [Glycine soja]
Length=218

 Score =   127 bits (320),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 122/191 (64%), Gaps = 15/191 (8%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L+I SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQLKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVE---  215
                +L+ASLMGF LFL  +IDR HHY+++L  LR    A+K+     +N K   V+   
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRTHHYLQKLINLRSNAGASKEE---LENLKKETVQLKE  141

Query  214  -------EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQ  56
                   E+  LKEE++ +   ++K++ E E K ++V+  + +  S + Q+  LLLEY +
Sbjct  142  KDEKASKEIKQLKEELSHLSKSLEKIKLESEEKDKKVETAEAHVASLQKQAADLLLEYDR  201

Query  55   LLEENQHLRSQ  23
            LLE+NQ+L++Q
Sbjct  202  LLEDNQNLQAQ  212



>ref|XP_008794596.1| PREDICTED: B-cell receptor-associated protein 31 [Phoenix dactylifera]
Length=218

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 123/189 (65%), Gaps = 11/189 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR++ +  LD+ K G+GP  VK++A T+ V+++ +V ++ +IQ+R   L ++ P DQVL
Sbjct  25   PLREMAMKGLDQLKSGKGPATVKTLACTLSVILVSSVATILKIQNRGVKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK--------KHDRGFDNGK  230
                +L+ASL+G+ LFL+L+IDRLHHY+++L  LRK +  ++        +H R F   +
Sbjct  85   WRTHLLEASLIGYSLFLALVIDRLHHYLQKLINLRKTVGTSREEVEKLKMEHHR-FKEKE  143

Query  229  NGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLL  50
                +E+  L+ E++++  K++KL+SE E + +     +    S + QSE+LLLEY +LL
Sbjct  144  EKSSDEIKKLQVEVSNLTEKLQKLKSEFEEQEQRAITAEAYVASLRKQSEELLLEYDRLL  203

Query  49   EENQHLRSQ  23
            E+NQ L++Q
Sbjct  204  EDNQILQTQ  212



>gb|KDO62065.1| hypothetical protein CISIN_1g045614mg, partial [Citrus sinensis]
Length=123

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT+
Sbjct  21   FRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEA  266
            +VL+A  +LQASLMGF LFL+++ DRLH+YI+EL L+R+ +E 
Sbjct  81   EVLMANLLLQASLMGFSLFLAMITDRLHYYIKELHLVRQTLEG  123



>ref|XP_002303054.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
 gb|ABK95486.1| unknown [Populus trichocarpa]
 gb|EEE82327.2| hypothetical protein POPTR_0002s24670g [Populus trichocarpa]
Length=218

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 121/188 (64%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR+++ ++K       K        ++
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGLRRSVGSSKEEVERLQKEKMQLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L E+I+++   +KKL+ E E K +++K  + +  S + Q   LLLEY +LLE
Sbjct  145  KASMEIKLLLEQISTLSENLKKLKLESENKDKQIKTAEAHVVSLQKQCADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>ref|XP_008802267.1| PREDICTED: B-cell receptor-associated protein 29-like [Phoenix 
dactylifera]
Length=221

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 118/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  LD+ K G+GP +VK++A T+ V++  ++  +  IQ+R L+  S+ PTDQVL
Sbjct  25   PLRELAMKGLDKLKTGKGPAMVKALACTLSVILASSITGILRIQNRGLKLGSVTPTDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+L+IDRLHH ++++  LRK        +E  KK    F + + 
Sbjct  85   WRTHLLEASLIGYTLFLALLIDRLHHCLQKVINLRKTVGTSRDEVEKLKKEHHHFKDEEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E   L+EE+ ++  K++KL+SE E   +     + +  + + Q EKLLLEY +LLE
Sbjct  145  KSSNERTELREEVCNLTEKLQKLKSEIEELKKRALTAEAHVAALQKQFEKLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ L++Q
Sbjct  205  DNQILQTQ  212



>emb|CDP15777.1| unnamed protein product [Coffea canephora]
Length=134

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+TPLRK  ++ +D+ K+GRGP+V K+VA T+F++ I T+ ++ +IQ+R +E  +INPTD
Sbjct  21   FRTPLRKPTVMMVDKMKQGRGPVVAKTVAGTLFMIFISTLNNIMKIQNRAVEAGTINPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD  239
            Q+LL   IL+A L+GF LFL +MIDRLH+YI+EL  LRK++EA KK +   D
Sbjct  81   QILLVNHILEAILLGFSLFLGVMIDRLHYYIKELHRLRKSLEATKKSNYETD  132



>gb|EYU27354.1| hypothetical protein MIMGU_mgv1a015673mg [Erythranthe guttata]
Length=149

 Score =   124 bits (312),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 96/127 (76%), Gaps = 8/127 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F+TPLRK L+I LDR K+GRGP+V  +   T+FV+M+  +Y++  IQ+R LE+  +NPTD
Sbjct  21   FRTPLRKPLLILLDRLKQGRGPVVATTAGGTLFVIMVSLLYNITTIQNRSLEAGGVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF------DNG  233
            QVLLA Q+L+ASL+GF LFL+LMIDR+H+YIRE+R+LRK MEA KK D+        D G
Sbjct  81   QVLLANQLLEASLLGFALFLALMIDRIHYYIREVRMLRKHMEAIKKSDQESEELKIKDKG  140

Query  232  KNGGVEE  212
            KN  VE+
Sbjct  141  KNKVVED  147



>ref|XP_002266257.2| PREDICTED: B-cell receptor-associated protein 31 [Vitis vinifera]
Length=218

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K G+GP  VK++A T+ V+++ +V S+ +IQ++   L ++ P DQVL
Sbjct  25   PLRELVMKGLDQVKMGKGPATVKTIAGTMSVILLSSVTSILKIQNKGAKLGTMTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ SLMGF LFL  +IDR+HHY+++L  LR    A+K       K        + 
Sbjct  85   WRTHLLETSLMGFSLFLGFLIDRMHHYLQKLNRLRGNAGASKEEFEKLQKERAQLKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E+I+++   +KKL+ E E K ++V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  QASKEIKLLQEQISTLTQDLKKLKLEAEEKDKKVETAEAHVVSLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQTQ  212



>ref|XP_009410623.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410624.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410625.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410626.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410627.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410629.1| PREDICTED: B-cell receptor-associated protein 31-like [Musa acuminata 
subsp. malaccensis]
Length=218

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 118/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--LESINPTDQVL  386
            PLR+L +  LD+ K G+GP  VK++A T+ V++  +V S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELAMRGLDQLKTGKGPATVKTLACTMSVILASSVASILKIQNRAAKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLL-------RKAMEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+L+IDRLHHY+R+L  L       R+ ++  KK  + F   + 
Sbjct  85   WRTHLLEASLIGYTLFLALVIDRLHHYLRKLVSLKTTVGTSREEVDNLKKEQQSFKEKEK  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
              + E   L EE+  +K +++KL+ + E   +  +  + +  + + QSE+LLLEY  LLE
Sbjct  145  TSLSERKKLHEEVTRLKERLQKLKLDSEEHEKRAQTAEAHVAALQKQSEELLLEYDHLLE  204

Query  46   ENQHLRSQ  23
            +NQ L+++
Sbjct  205  DNQILQTR  212



>ref|XP_004987306.1| PREDICTED: uncharacterized protein LOC101775823 [Setaria italica]
Length=163

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 100/143 (70%), Gaps = 9/143 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LE  413
            FKTPLRKL +++LDR KRGRGP++V++VAATV V++  +++S+ +I+ R         + 
Sbjct  21   FKTPLRKLAVLALDRLKRGRGPVMVRTVAATVLVVLASSLHSMAQIRGRAEGELDGAGVV  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-FDN  236
             + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E+R L+K +EA  K ++   + 
Sbjct  81   GLTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKEIRRLKKNLEAVSKQNKTMLEE  140

Query  235  GKNGGVEEVNSLKEEIASMKSKI  167
              +G  EE     ++I+  K  +
Sbjct  141  ATHGRSEESERDLKDISDAKKDV  163



>gb|ACG37455.1| B-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=216

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 117/188 (62%), Gaps = 8/188 (4%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE-SINPTDQVLL  383
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+ +++P DQVL 
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLTVSPMDQVLW  84

Query  382  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKNG  224
               +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     +  
Sbjct  85   RTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEEK  144

Query  223  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEE  44
               E   L+ E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE+
Sbjct  145  SSGETKRLQREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLED  204

Query  43   NQHLRSQL  20
            NQ L++QL
Sbjct  205  NQILQTQL  212



>ref|XP_011011172.1| PREDICTED: uncharacterized protein LOC105115831 [Populus euphratica]
Length=218

 Score =   125 bits (313),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 121/188 (64%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L+I SLD+ K G+GP  VK++A T+ V++  ++ S+ +IQS+   L +++P DQVL
Sbjct  25   PLRDLVIKSLDQVKMGKGPATVKTIAGTMSVILFSSLMSIVKIQSKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK------NG  224
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR ++ ++K+        K       G
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLSKLIGLRSSVGSSKEEVERLQKEKMQLKEEEG  144

Query  223  GV-EEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
             V +E+  L+E+ +++   +KKL+ E E K ++++  + +  +   +S  LLLEY +LLE
Sbjct  145  KVSKEMKLLQEQFSTLSENLKKLKLESEQKDKQIETAEAHVVALHKRSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>ref|XP_006281079.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
 gb|EOA13977.1| hypothetical protein CARUB_v10027107mg [Capsella rubella]
Length=217

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V++   + ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMNIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKN-------  227
                +L+ASL+G VLFL  +IDR+HHY+ +L  LR    ++K+     +  +        
Sbjct  85   WRTHLLEASLLGVVLFLGFIIDRMHHYLSKLINLRSNAGSSKEELEQLEKERTELKEKDE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E ++S+  K+KK E+E + K ++++  + + E+ + QS +LLLEY +LLE
Sbjct  145  KASKEIKKLQENLSSILEKLKKAEAESKEKDKKLETAETHVEALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQHL+SQ+
Sbjct  205  DNQHLQSQI  213



>ref|NP_001136567.1| uncharacterized LOC100216689 precursor [Zea mays]
 ref|XP_008645522.1| PREDICTED: LOW QUALITY PROTEIN: B-cell receptor-associated protein 
31-like [Zea mays]
 gb|ACF82188.1| unknown [Zea mays]
 gb|AFW66986.1| b-cell receptor-associated protein 31-like containing protein 
[Zea mays]
Length=217

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 117/189 (62%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++  V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRVVDQVKTGKGPATVKTLACTLSVILMSNVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKA-------MEAAKKHDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+++L  LRK        +E  +  +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLQKLMTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E   L+ E+  +   +KKL+SE +    +    + +  + + QSE+LLLEY +LLE
Sbjct  145  KSSGETKRLQREVVRLNESMKKLKSEAKEHERKASVAEAHVNALQKQSEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L++QL
Sbjct  205  DNQILQTQL  213



>gb|KHN38264.1| hypothetical protein glysoja_003929 [Glycine soja]
Length=154

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F  P+RKL++I LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD
Sbjct  21   FANPIRKLVVIGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDASIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK  230
            +VL+A ++L+A+ +GF LFL L+IDR H+YIRE+ LLRK +E  KK +   D+ K
Sbjct  81   EVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLRKNLETWKKRNHNHDSLK  135



>ref|XP_010685051.1| PREDICTED: B-cell receptor-associated protein 31-like [Beta vulgaris 
subsp. vulgaris]
Length=217

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 125/188 (66%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLDQVKMGKGPATVKTIAGTMSVILLSSLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAA-------KKHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+R+L  +R  + ++       +K  +   + + 
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLRKLINIRSKVGSSKEEVEKLEKEKQQLKDKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+ +L++E++ + +++KKL+ E + K + ++    +  + + Q+  LLLEY +LLE
Sbjct  145  KASKEITALQDELSKVSNEVKKLKIESQEKDKTIETADAHVVALQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQTQ  212



>ref|XP_006452412.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 gb|ESR65652.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 81/109 (74%), Gaps = 2/109 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTD  395
            F+ PLRK +I+ LDR KRGRGPLV KSV ATV V++   VYS  EIQ R  E  +INPT+
Sbjct  21   FRNPLRKFVIMGLDRLKRGRGPLVAKSVGATVLVVLCSAVYSAMEIQRRAREGGAINPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  248
            +VL+A  +LQASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  81   EVLMANLLLQASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>ref|XP_010099686.1| hypothetical protein L484_025117 [Morus notabilis]
 gb|EXB80263.1| hypothetical protein L484_025117 [Morus notabilis]
Length=216

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 122/188 (65%), Gaps = 11/188 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K  RG ++  ++A T+F + + + +S+ +IQ+R   L S++P DQVL
Sbjct  25   PLRELVIKSLDQLKMKRGTVL--TIAGTMFAIFMSSFFSIVKIQNRGAKLGSMSPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHYIR+L  LR ++ ++K       K        + 
Sbjct  83   WRTHLLEASLMGFTLFLGFIIDRMHHYIRKLIGLRSSVGSSKEELEKLQKEKMQLKEKEQ  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  LK+E++++   +KKL+ + E K ++V+  + + ++ + Q+  LLLEY +LLE
Sbjct  143  KYSKEIKLLKDEVSTLSESLKKLKIKSEEKDKKVETAEAHVQALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  203  DNQNLQNQ  210



>ref|NP_001143481.1| hypothetical protein [Zea mays]
 gb|ACF83647.1| unknown [Zea mays]
 gb|ACG32480.1| hypothetical protein [Zea mays]
 gb|AFW77082.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_955327 [Zea 
mays]
Length=161

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LE  413
            FKTPLR+L +++LD  KRGRGP++V+++AATV V++  +++S+ +I+           + 
Sbjct  21   FKTPLRRLAVLALDHLKRGRGPVMVRTIAATVLVVLASSLHSMAKIRGHAEGELDGSGVV  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
             + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K ++  +  
Sbjct  81   GLTPTDQVLLARHLLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVLKQNKALEEA  140

Query  232  KNGGVEE  212
             NG +EE
Sbjct  141  TNGKLEE  147



>gb|KHN11907.1| hypothetical protein glysoja_019880 [Glycine soja]
Length=139

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F  PLRKL++  LD  K+GRGPLV K+VAAT+ V++  TVY++ +IQ R  ++  +NPTD
Sbjct  21   FANPLRKLVVKGLDLLKQGRGPLVTKTVAATMCVVLSSTVYTITKIQKRSKDAGIVNPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            +VL+A ++L+A+ +GF LFL L+IDR H+YIRE+ LLRK ME AKK
Sbjct  81   EVLMAHRLLEAAFLGFSLFLGLVIDRQHYYIREINLLRKNMETAKK  126



>gb|EMS58132.1| hypothetical protein TRIUR3_00710 [Triticum urartu]
Length=190

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 113/183 (62%), Gaps = 22/183 (12%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L +  +++ K G+GP  VK++A T+ V+++ +V ++  IQ R   + +++P DQVL
Sbjct  25   PLRELAMRGVEQVKTGKGPATVKTLACTLSVILMSSVAAIVRIQDRGHKIGNVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK+   ++                  
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLITLRKSANTSR------------------  126

Query  205  SLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRS  26
              +E++A +   +KKL+SE E    +    + +  + + QSE+LLLEY +LLE+NQ L+S
Sbjct  127  --EEDMAKLSEDMKKLKSESEDHQRKASDAEAHVNALQKQSEELLLEYDRLLEDNQILQS  184

Query  25   QLH  17
            QLH
Sbjct  185  QLH  187



>ref|XP_002863915.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40174.1| hypothetical protein ARALYDRAFT_494932 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 126/189 (67%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASL+G VLFL  +IDR+HHY+R+L  LR  + ++K       K   G    ++
Sbjct  85   WRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINLRSNVGSSKDELEQLQKERAGLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+EE++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE
Sbjct  145  KASKEIKQLQEELSSILERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQHL+SQ+
Sbjct  205  DNQHLQSQI  213



>ref|XP_008460368.1| PREDICTED: B-cell receptor-associated protein 31-like [Cucumis 
melo]
Length=219

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 120/187 (64%), Gaps = 9/187 (5%)
 Frame = -1

Query  556  LRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLL  383
            LR+ +I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL 
Sbjct  26   LREFVIKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLW  85

Query  382  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNG  224
              Q+L+ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +  
Sbjct  86   RTQLLEASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEK  145

Query  223  GVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEE  44
              +++  L+EEI+ +   +KK++ E E K + ++    +  S + Q+  LLLEY +LLE+
Sbjct  146  CSKQIKELREEISILSENLKKVKQESEEKDKRIETADAHVTSLQKQAADLLLEYDRLLED  205

Query  43   NQHLRSQ  23
            NQ+L++Q
Sbjct  206  NQNLQNQ  212



>ref|XP_002437063.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
 gb|EER88430.1| hypothetical protein SORBIDRAFT_10g020520 [Sorghum bicolor]
Length=160

 Score =   119 bits (298),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 89/123 (72%), Gaps = 8/123 (7%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRP--------LE  413
            FKTPLR+L +++LDR K+GRGP++V+++AATV V++  +++S+ +I+SR         + 
Sbjct  21   FKTPLRRLSVVALDRLKQGRGPVMVRTIAATVLVVLASSLHSMTKIRSRADGELDGAGIV  80

Query  412  SINPTDQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNG  233
             + PTDQVLLA+ +L+ASLMG+ LFL+L+IDRLH+Y++E R LRK +E   K +      
Sbjct  81   GLTPTDQVLLARHVLEASLMGYSLFLALVIDRLHNYVKENRRLRKKLEEVSKQNETMLEA  140

Query  232  KNG  224
             +G
Sbjct  141  THG  143



>ref|XP_004491710.1| PREDICTED: B-cell receptor-associated protein 31-like [Cicer 
arietinum]
Length=218

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 117/188 (62%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L++ SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVMKSLDQLKMGKGPATVKTIAGTMSVILLSSFMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+ASL+GF LFL  +IDR+HHY+++L  LR  M A+K+             E+  
Sbjct  85   WRTHLLEASLIGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKETMEFKEKEE  144

Query  205  S-------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                    LK+E++++   +KK + E E K + V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASKEIKQLKKELSTLSEGLKKAKMESEEKDKRVETAESHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>ref|XP_002521067.1| bcr-associated protein, bap, putative [Ricinus communis]
 gb|EEF41218.1| bcr-associated protein, bap, putative [Ricinus communis]
Length=292

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 123/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A+T+ V+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIASTMSVILLSSLMSIIKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASL+GF LFL  +IDR+HHY+ +L  LR  + ++K       K        ++
Sbjct  85   WRTHLLEASLIGFTLFLGFIIDRMHHYLTKLIGLRINIGSSKEEVERLQKEKMQLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+++++++   ++KL+ E E K ++++  + +  S + QS  LLLEY +LLE
Sbjct  145  KSSMEIEQLRKQVSTLSENLEKLKLENEQKDKQIETAEAHVVSLQKQSADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>ref|XP_011095414.1| PREDICTED: uncharacterized protein LOC105174881 [Sesamum indicum]
Length=149

 Score =   118 bits (296),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = -1

Query  517  RGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLLAQQILQASLMGFV  344
            +GRGP+V  + A T+FV+M+  ++++  IQ R +ES  +NPTDQVLLA Q+L+ASL+GF 
Sbjct  38   QGRGPIVSSTAAGTLFVIMVSILFNITSIQKRSMESASVNPTDQVLLANQLLEASLLGFA  97

Query  343  LFLSLMIDRLHHYIRELRLLRKAMEAAKKHD------RGFDNGKNGGVEE  212
            LFL LMIDR+H+YI+E+R+LRK +EA K+ D      R  + GK+  VEE
Sbjct  98   LFLWLMIDRIHYYIKEVRMLRKHLEAVKRMDQKSEEVRSKEKGKSKAVEE  147



>ref|XP_010552045.1| PREDICTED: B-cell receptor-associated protein 31 [Tarenaya hassleriana]
Length=219

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 123/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ SLD+ K G+GP  VK++A T+ V+++ T+ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLDQLKMGKGPATVKTIAGTMSVILLSTLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+ASLMG VLFL  +IDR+HHY+ +L  LR  +  +K+        +    E+  
Sbjct  85   WRTHLLEASLMGVVLFLGFVIDRMHHYLTKLLYLRSNIGMSKEELEKLQKERTELKEKEE  144

Query  205  S-------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                    L+E+++S+   ++KLE+E + K ++++  + +  + + QS +LLLEY +LLE
Sbjct  145  KASKEMKQLQEKLSSLSQNLEKLEAESKDKDKKLETAEAHVSALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ+L++Q+
Sbjct  205  DNQNLQTQI  213



>gb|KEH22623.1| B-cell receptor-associated-like protein [Medicago truncatula]
Length=218

 Score =   120 bits (300),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 118/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L++ SLD+ K G+ P  VK++A T+FV+++ ++ S+ +IQ++   L +++P DQVL
Sbjct  25   PLRDLVMKSLDQLKMGKAPATVKTIAGTMFVILLSSLMSLVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+A L+GF LFL  +IDR+HHY+++L  LR  M A+K+             E+  
Sbjct  85   WRTHLLEAYLLGFTLFLGFLIDRMHHYLQKLINLRSNMGASKEEVENLKKENVELKEKEE  144

Query  205  S-------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                    LK+E++++   +KK++ E E K + V+  + +  S + Q+  LLLEY +LLE
Sbjct  145  KASKEIKQLKKELSTLTEGLKKVKMESEEKDKRVETAEAHVASLQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>gb|KDO62066.1| hypothetical protein CISIN_1g046403mg [Citrus sinensis]
Length=117

 Score =   117 bits (292),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  ES  +NPT+
Sbjct  9    FESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRESGALNPTE  68

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  248
            +VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  69   EVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  117



>ref|XP_010274041.1| PREDICTED: B-cell receptor-associated protein 31-like [Nelumbo 
nucifera]
Length=218

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 118/189 (62%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR L++  +D+ K G+G   +K++A T+ V++  ++ S+  IQ++   L ++ P DQVL
Sbjct  25   PLRDLVMKGMDQLKTGKGSATLKTIAGTMSVILASSIISLLNIQNKGTKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-------NGKN  227
                +L+ASLMG  LFL  +IDR+HHY+++L  LR A  ++KK               + 
Sbjct  85   WRSHLLEASLMGCSLFLGFVIDRIHHYLQKLIALRTAARSSKKEVEKLQIEHIQLKEKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+EEI+S+K  +K L+ + + K +++K+ + +  + + Q+E LLLEY +LL+
Sbjct  145  KASYEIKLLQEEISSLKENLKNLKLQSDEKDKQIKSAESHVTALEKQTEDLLLEYDRLLD  204

Query  46   ENQHLRSQL  20
            ++QHL++Q+
Sbjct  205  DSQHLQAQV  213



>ref|XP_006452413.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
 ref|XP_006475036.1| PREDICTED: uncharacterized protein LOC102621108 [Citrus sinensis]
 gb|ESR65653.1| hypothetical protein CICLE_v10009874mg [Citrus clementina]
Length=129

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F++PLRKLLI+ LD+ K+GRGPLV KSV ATV V++   VY+V EI  R  ES  +NPT+
Sbjct  21   FESPLRKLLILGLDKLKQGRGPLVAKSVGATVLVVLSSAVYNVVEIHKRSRESGALNPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDR  248
            +VL+A  +L+ASLMGF LFL++M+DRLH YI+  ++L + +   K+H++
Sbjct  81   EVLMADLLLEASLMGFSLFLAVMMDRLHSYIKRKQILEEVINPNKQHNQ  129



>ref|XP_004491413.1| PREDICTED: uncharacterized protein LOC101509893 [Cicer arietinum]
Length=140

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F  P+RK+++  LD  KRG+GPL+ K+VA+TVFV+   T+Y++ +I  R  ++  INPT+
Sbjct  21   FANPIRKMMVRVLDVLKRGKGPLITKTVASTVFVVFGSTIYTILKIHKRSKDAGMINPTE  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            +VL+A  +L+ASLMGF LF  LMIDR H+Y++E+  LRK ME AKK
Sbjct  81   EVLMAHHLLEASLMGFSLFFGLMIDRQHYYVKEITSLRKNMEIAKK  126



>ref|XP_009151666.1| PREDICTED: uncharacterized protein LOC103874978 [Brassica rapa]
Length=217

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 126/189 (67%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERTEFKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE
Sbjct  145  KASKEIKQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L+SQ+
Sbjct  205  DNQKLQSQI  213



>emb|CDX86287.1| BnaA06g30040D [Brassica napus]
Length=217

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 126/189 (67%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E+++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE
Sbjct  145  KASKEIKQLQEKLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L+SQ+
Sbjct  205  DNQKLQSQI  213



>ref|XP_004144386.1| PREDICTED: uncharacterized protein LOC101213598 [Cucumis sativus]
 ref|XP_004162649.1| PREDICTED: uncharacterized LOC101213598 [Cucumis sativus]
 gb|KGN58366.1| hypothetical protein Csa_3G629240 [Cucumis sativus]
Length=219

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 119/186 (64%), Gaps = 9/186 (5%)
 Frame = -1

Query  553  RKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVLLA  380
            R+ +I SLD+ K G+GP  VK++AAT+ V+++ ++ ++ +IQ++   L +++P DQVL  
Sbjct  27   REFVIKSLDQLKMGKGPATVKTIAATMSVILLSSLMNIVKIQNKGAKLGTMSPMDQVLWR  86

Query  379  QQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKNGG  221
             Q+L+ASL+GF LFL  +IDR+HHY ++L  LR+ + ++K       K        +   
Sbjct  87   TQLLEASLIGFTLFLGFIIDRMHHYFQKLIGLRENIGSSKEEVERLQKEKTELAQKEEKC  146

Query  220  VEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEEN  41
             +++  L+EEI+ + + +KK++ E   K + ++    +  S + Q+  LLLEY +LLE+N
Sbjct  147  SKQIKELREEISILSANLKKVKQESVEKDKRIETADAHVTSLQKQAADLLLEYDRLLEDN  206

Query  40   QHLRSQ  23
            Q+L++Q
Sbjct  207  QNLQNQ  212



>emb|CDX85356.1| BnaC07g26670D [Brassica napus]
Length=217

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 125/189 (66%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++  + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILLSNLMSIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR       + +E  +K    F   ++
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRMHHYLRKLINLRGNVGSSKEELEQLQKERNEFKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E ++S+  ++KK E+E + K ++++  + +  + + QS +LLLEY +LLE
Sbjct  145  KASKEIKQLQETLSSVSERLKKAETESKEKEKKLETAETHVTALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L+SQ+
Sbjct  205  DNQKLQSQI  213



>ref|XP_004295837.1| PREDICTED: uncharacterized protein LOC101305253 [Fragaria vesca 
subsp. vesca]
Length=152

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 78/100 (78%), Gaps = 3/100 (3%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEI-QSRPLES--INPT  398
            F++PLR+L+I+ LD +K+GRGPLV KSV  T+ V  I T+YSV  + + R  E+  INPT
Sbjct  21   FRSPLRQLVIMGLDCSKQGRGPLVAKSVGGTILVFFISTIYSVFNVHKKRSTEAGFINPT  80

Query  397  DQVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRK  278
            ++VL+A +IL+ASL GF LFL+LMIDRLH+YI+EL  LRK
Sbjct  81   NEVLMAHRILEASLTGFSLFLALMIDRLHYYIKELYRLRK  120



>ref|XP_009388739.1| PREDICTED: uncharacterized protein LOC103975489 [Musa acuminata 
subsp. malaccensis]
Length=139

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTD  395
            F TPLRKLL++ LDR KRGR  ++VK++AAT  +++  ++YS+ EI+ R   L +  PTD
Sbjct  21   FNTPLRKLLVLGLDRLKRGRSTVMVKTLAATAVLVLASSIYSMAEIRLRFAELGAPTPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNG  224
            Q+L+++ +L+ASL+G+ LFL+L+IDRLH YI EL  LR +M+A  K +R     K G
Sbjct  81   QILMSRHLLEASLLGYSLFLALIIDRLHLYIGELHGLRNSMKAVMKQNRVIGTAKTG  137



>gb|KDP39157.1| hypothetical protein JCGZ_00914 [Jatropha curcas]
Length=104

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = -1

Query  556  LRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQVLL  383
            +RK+L++ +D  KRGRG LV K+VAAT+F +    +YSV +IQ R LES  +NPTD+VLL
Sbjct  1    MRKVLMVGIDYMKRGRGQLVAKTVAATLFGVFSAILYSVMQIQKRTLESGVVNPTDEVLL  60

Query  382  AQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            A+++L+A+LMGF LFL++M DRLH+YI+EL  +RK +E  K+
Sbjct  61   AERLLEATLMGFSLFLAMMADRLHYYIKELYRVRKEVEQLKR  102



>ref|XP_007216855.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
 gb|EMJ18054.1| hypothetical protein PRUPE_ppa021600mg [Prunus persica]
Length=192

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 99/179 (55%), Gaps = 31/179 (17%)
 Frame = -1

Query  544  LIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLESINPTDQVLLAQQILQ  365
            + I++DR KRGRGPLVV+ +A +V  +++  VY                           
Sbjct  30   VTIAVDRLKRGRGPLVVRIIAGSVLFVLVARVY---------------------------  62

Query  364  ASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIA  185
                GF+LFLS+++DRLHHY RE+ LLR  MEAA++ ++     KNG   E+  L +EIA
Sbjct  63   ----GFLLFLSVILDRLHHYTREVSLLRTEMEAAQRENQTLKEEKNGRAMELKILGQEIA  118

Query  184  SMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALD  8
             +++ I   E+E E K +  K +K  + + + Q E LL E  ++ E+NQ LRSQL  +D
Sbjct  119  KLRTNIMNTETEYETKAKGAKLEKTKAYALRKQYEGLLAEIDRVQEDNQILRSQLEWVD  177



>emb|CDP03896.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 114/188 (61%), Gaps = 11/188 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K  +G   V ++A T   +++   +S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKGLDQVKMRKGT--VLTIAGTFAAILLSNFFSIVKIQNKGAKLGTMSPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  227
                +L+ASLMGF LFL  +IDR+HHY+R+L  LR    A +K +   +  K        
Sbjct  83   WRTNLLEASLMGFCLFLGFLIDRMHHYLRKLIGLRSTAGALRKENERLEKDKLQLKEKAE  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+  +K+EI+S+   + KLE E   K ++V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KADEEIKVMKKEISSLTENLNKLEMESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  203  DNQNLQNQ  210



>ref|XP_008235454.1| PREDICTED: B-cell receptor-associated protein 31 [Prunus mume]
Length=218

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 122/188 (65%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V+++ +  S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQLKMGKGPATVKTIACTMSVILLSSFISIVKIQNKGVKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+ +L  LR  + A+K       K        ++
Sbjct  85   WRTHLLEASLMGFTLFLGFIIDRMHHYLSKLIGLRSNVGASKEEVDRLQKETMQLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               +E+  L+E+I+++   +KKL+ EC+ K + ++  + +  + + Q+  LLLEY +LLE
Sbjct  145  KSSQEIKQLQEKISTLSEDLKKLKLECKEKDKNIETAEAHVAALQKQAADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQTQ  212



>gb|EYU40619.1| hypothetical protein MIMGU_mgv1a013665mg [Erythranthe guttata]
Length=213

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 121/193 (63%), Gaps = 19/193 (10%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  LD+ K  R    V ++AATVFV+++  ++S+ +IQ++  +  ++ P DQVL
Sbjct  25   PLRELGMKGLDQVKMRRAT--VLTIAATVFVILLSDLFSIFKIQNKGAKHGAMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFD-----------  239
                +L+A+LMGF LFL L+IDR+HH++R+L  L+ +   +K+    FD           
Sbjct  83   WRTNVLEATLMGFFLFLGLLIDRMHHHMRKLDELKSSNGVSKEE---FDRVEREKLQLKE  139

Query  238  NGKNGGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYG  59
            N +  G+ EV  L++EI+ +   +KKL+ E   K + VK+ +    S + Q+ +LLLEY 
Sbjct  140  NQEKTGL-EVERLRKEISGLTENVKKLKLESTEKDKSVKSAEARVASLQKQTAELLLEYD  198

Query  58   QLLEENQHLRSQL  20
            +LLE+NQ+L++Q+
Sbjct  199  RLLEDNQNLQNQV  211



>ref|XP_011089080.1| PREDICTED: uncharacterized protein LOC105170143 [Sesamum indicum]
Length=216

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 116/189 (61%), Gaps = 11/189 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L+I  LD+ K  R    V ++A T+FV+++  ++S+ +IQ++  +  ++ P DQVL
Sbjct  25   PLRELVIKGLDQVKMRRA--TVLTIAGTIFVILLSNLFSILKIQNKGAKHGTMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+A+LMGF LFL  +IDR+HHY+R+L  LR       + +E  +K        + 
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYMRKLIKLRSNTGVSKQEVEMLEKEKLQLKEKEE  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                EV  L++E++S+   + KL SE   K ++V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KAAGEVKRLQKEMSSLTENLNKLRSESAEKDKKVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQL  20
            +NQ+L++Q+
Sbjct  203  DNQNLQTQV  211



>ref|XP_009775442.1| PREDICTED: uncharacterized protein LOC104225364 [Nicotiana sylvestris]
Length=216

 Score =   114 bits (286),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 115/191 (60%), Gaps = 11/191 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K  +G   V ++A T+  ++     S+ +IQ++   L ++ P DQVL
Sbjct  25   PLRELVMKCLDQVKMRKGT--VLTIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+A+LMGF LFL  +IDR+HHY+R+L +LR       K  E+ +K    F    +
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVLRNNAGSSKKEFESLEKEKLQFKEKAD  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+   ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KAAEEMKQSQKEISSLTESLKKVKLQLEQKNKLVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQLHA  14
            +NQ+L++Q H 
Sbjct  203  DNQNLQNQAHG  213



>ref|XP_009610381.1| PREDICTED: uncharacterized protein LOC104104089 [Nicotiana tomentosiformis]
Length=216

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/191 (35%), Positives = 115/191 (60%), Gaps = 11/191 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K  +G ++  ++A T+  ++     S+ +IQ++   L ++ P DQVL
Sbjct  25   PLRELVMKCLDQVKMRKGTVL--TIAGTIAAILFSNFISIIKIQNKGAKLGTMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLR-------KAMEAAKKHDRGFDNGKN  227
                +L+A+LMGF LFL  +IDR+HHY+R+L +LR       K  E  +K    F    +
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVLRNSAGSSKKEFERLEKEKLQFKEKAD  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+   ++EI+S+   +KK++ + E K + V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KAAEEMKQSQKEISSLTESLKKVKLQMEEKDKRVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQLHA  14
            +NQ+L++Q H 
Sbjct  203  DNQNLQNQAHG  213



>ref|XP_004963921.1| PREDICTED: B-cell receptor-associated protein 31-like [Setaria 
italica]
Length=134

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = -1

Query  358  LMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVNSLKEEIASM  179
            L G+ LFL L+IDRLHHYIRELR + K MEA  K  R  +  K GG EE+   ++EIAS+
Sbjct  6    LAGYSLFLGLIIDRLHHYIRELRTMNKNMEAVTKQSRTLEEAKLGGTEEIQGYQKEIASL  65

Query  178  KSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQHLRSQLHALD  8
            K +++ L+++ + K EE+K  + NS + + QSE LL+EY +L+ EN  LR+QL ++D
Sbjct  66   KEQVELLKNQSQKKTEELKTAEANSVALQKQSEGLLMEYDRLIAENGDLRNQLQSID  122



>ref|XP_004290194.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458169.1| PREDICTED: B-cell receptor-associated protein 31 [Fragaria vesca 
subsp. vesca]
Length=214

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 112/185 (61%), Gaps = 5/185 (3%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K GRGP+ +  +A T+ V+++    S+ ++Q++   L +++P DQVL
Sbjct  25   PLRELVLKILDQLKVGRGPVTLIGIAGTMGVILLSRFISIVKMQNKGEKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLL---RKAMEAAKKHDRGFDNGKNGGVE  215
                IL+ASLM F +FL  +IDR H Y+ +L  L   ++ +E  +K        +    +
Sbjct  85   YRTHILEASLMSFAVFLGFIIDRTHDYLTKLDGLTSTKEEVERLQKEKVQLTEKEEKSSK  144

Query  214  EVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLEENQH  35
            E+  L+E+IA++   +KKL+ EC  K + V+  + +  S + Q+  LLLEY  LLE+NQ 
Sbjct  145  EIKQLQEKIATLSEDLKKLKLECAEKDKAVETAESHVTSLQKQAADLLLEYDHLLEDNQK  204

Query  34   LRSQL  20
            L++Q 
Sbjct  205  LQTQF  209



>ref|XP_006340009.1| PREDICTED: B-cell receptor-associated protein 31-like [Solanum 
tuberosum]
Length=216

 Score =   112 bits (280),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K  +G   V ++A T+  +++    S+ +IQ++   + ++ P DQVL
Sbjct  25   PLRELVMKCLDQVKMRKGT--VLTIAGTISAILVSNFISIIKIQNKGAKIGTMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  227
                +L+A+LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKAD  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+   +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KAAEEIKLSQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQLHA  14
            +NQ+L++Q H 
Sbjct  203  DNQNLQNQAHG  213



>ref|XP_004247073.1| PREDICTED: uncharacterized protein LOC101251810 [Solanum lycopersicum]
Length=216

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 116/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K  +G   V ++A T+  ++     S+ +IQ++   + ++ P DQVL
Sbjct  25   PLRELVMKCLDQVKMRKGT--VLTIAGTISAILFSNFISIIKIQNKGAKIGTMTPMDQVL  82

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGK-------N  227
                +L+A+LMGF LFL  +IDR+HHY+R+L +LR +  ++KK     +  K       +
Sbjct  83   WRTNLLEATLMGFSLFLGFLIDRMHHYLRKLIVLRSSAGSSKKEFERLEKEKLQLKEKAD  142

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
               EE+   +++++S+   +KK++ E E K + V+  + +  + + Q+  LLLEY +LLE
Sbjct  143  KAAEEIKLSQKQLSSLTETLKKVKLESEEKDKRVETAEAHVAALQKQAADLLLEYDRLLE  202

Query  46   ENQHLRSQLHA  14
            +NQ+L++Q H 
Sbjct  203  DNQNLQNQAHG  213



>ref|XP_008674143.1| PREDICTED: B-cell receptor-associated protein 31-like [Zea mays]
Length=270

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 110/189 (58%), Gaps = 14/189 (7%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE--SINPTDQVL  386
            PLR+L +  +D+ K G+GP  VK++A T+ V+++ +V S+ +IQ+R L+  +++P DQVL
Sbjct  25   PLRELAMRGVDQVKTGKGPATVKTLACTLSVILMSSVASILKIQNRGLKLGTVSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK-------HDRGFDNGKN  227
                +L+ASL+G+ LFL+ +IDRLHHY+R+L  LRK    +++        +R     + 
Sbjct  85   WRTHLLEASLIGYTLFLAFVIDRLHHYLRKLLTLRKTSSTSREEVEKLQMENRSLREKEE  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLL-----LEY  62
                E   L+ EIA +   +KKL+SE E    +    + + ++ + QSE+LL       +
Sbjct  145  KSSSETKRLQREIARLNEGMKKLKSETEEHERKASVAEAHVDALQKQSEELLHSFLAARH  204

Query  61   GQLLEENQH  35
            GQL     H
Sbjct  205  GQLPSVADH  213



>ref|XP_010913045.1| PREDICTED: B-cell receptor-associated protein 29-like [Elaeis 
guineensis]
Length=218

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 122/189 (65%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++  LD+ K G+GP  VK++A T+ VL+  ++ S+ +IQ+R   L ++ P DQVL
Sbjct  25   PLRELVMRGLDQLKTGKGPATVKTLACTLSVLLASSITSILKIQNRGTKLGTVTPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRG-------FDNGKN  227
                +L+ASL+G+ LFL L+IDRLHHY+R++  L+K +  +K+           F + ++
Sbjct  85   WRTHLLEASLIGYTLFLGLVIDRLHHYLRKMVTLKKTVGTSKEEVEKLKKEHLHFKDKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L+ E+ S+  K++KL++ECE + +   + + +  S + Q E+LLLEY +LLE
Sbjct  145  KASSEMQKLQREVGSLTEKLQKLKTECEQQEKRAVSAEAHVVSLQKQLEELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQ L+ QL
Sbjct  205  DNQILQGQL  213



>ref|XP_011024634.1| PREDICTED: uncharacterized protein LOC105125752 [Populus euphratica]
Length=218

 Score =   110 bits (275),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 119/188 (63%), Gaps = 9/188 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+ P  VK++A T+ V++ +++ ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQVKMGKRPATVKTIAGTMSVILFFSLMNIVKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAK-------KHDRGFDNGKN  227
                +L+ASLMGF LFL  +IDR+HHY+  L  LR+ + ++K       K        ++
Sbjct  85   WRTHLLEASLMGFTLFLGFLIDRMHHYLSRLIGLRRCVGSSKEEVERLQKEKMQLKEKED  144

Query  226  GGVEEVNSLKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                E+  L E+I+++   +KKL+ E E K ++++  + +  S + Q   LLLEY +LLE
Sbjct  145  KASMEIKLLLEQISTLSESLKKLKLESEKKDKQIETAEAHVVSLQKQCADLLLEYDRLLE  204

Query  46   ENQHLRSQ  23
            +NQ+L++Q
Sbjct  205  DNQNLQAQ  212



>ref|XP_007020770.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
 gb|EOY12295.1| F-box family protein with a domain of Uncharacterized protein 
function, putative [Theobroma cacao]
Length=543

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = -1

Query  562  TPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTDQV  389
            +PLR L+I  LD+ K GRGP++ K+VA T+FV+ I   Y+  EIQ R LE   INPTD+V
Sbjct  410  SPLRNLVIKVLDKIKEGRGPVISKTVAGTLFVVFISISYNAIEIQKRALEGGVINPTDEV  469

Query  388  LLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKK  257
            LLA +IL+ASLMGF LFL+L+  RLH++I+EL   R+ +EA +K
Sbjct  470  LLANRILEASLMGFALFLALVTYRLHYHIKELNPARRRLEADEK  513



>ref|XP_009778813.1| PREDICTED: uncharacterized protein LOC104228107 [Nicotiana sylvestris]
Length=108

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 65/79 (82%), Gaps = 3/79 (4%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLE---SINPT  398
            FKTPLRKL+I+ LDR KRGRGP++VK+VA TVFV+M+ T+YS+  I++R ++    I PT
Sbjct  21   FKTPLRKLVIMGLDRVKRGRGPIIVKTVAGTVFVVMLSTIYSIASIRTRWMDEGGDITPT  80

Query  397  DQVLLAQQILQASLMGFVL  341
            DQ+LLAQ +L+ASLMG VL
Sbjct  81   DQILLAQHLLEASLMGIVL  99



>ref|XP_010063029.1| PREDICTED: uncharacterized protein LOC104450251 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70201.1| hypothetical protein EUGRSUZ_F03480 [Eucalyptus grandis]
Length=155

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = -1

Query  568  FKTPLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSRPLES--INPTD  395
            F +PLR LL++ LDR KRG+G L+  +VA T+ V+   TVY++  +Q R  ++  I+PTD
Sbjct  21   FGSPLRTLLMLGLDRLKRGQGQLIAGTVATTMVVVFSATVYNLLGVQRRLTDATMISPTD  80

Query  394  QVLLAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGF  242
            Q+LLA  +L+ASLMGF LFL ++IDRLH+Y  EL  LR  +E  K   R +
Sbjct  81   QILLANSLLEASLMGFSLFLGILIDRLHYYASELYRLRNHLEETKSKQRDY  131



>ref|XP_010464329.1| PREDICTED: uncharacterized protein LOC104744901 [Camelina sativa]
Length=220

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 115/202 (57%), Gaps = 31/202 (15%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L++ SLD+ K G+ P  VK++A T+FV  +  + ++ +IQ++   L +++P DQVL
Sbjct  25   PLRELVMKSLDQLKLGKAPATVKTIAGTMFVNFLSNLMNIIKIQNKGAKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+ASLMG VLF   +IDR HHY+ +L  LR             D    G ++++ 
Sbjct  85   WRTHLLEASLMGVVLFFGFIIDRTHHYLGKLITLRSN-----------DGSSKGELDQLR  133

Query  205  S------------------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSE  80
                               LKE+++ +   +KK E+E + K  +++  + +  + + QS 
Sbjct  134  KERTELKEKEEKASKEIKQLKEKLSCVLENLKKAENEAKEKETKLETAEAHVTALQKQSS  193

Query  79   KLLLEYGQLLEENQHLRSQLHA  14
            +LLLEY +LLE+NQ+L++Q+ A
Sbjct  194  ELLLEYDRLLEDNQNLQTQILA  215



>ref|XP_010493705.1| PREDICTED: B-cell receptor-associated protein 31-like [Camelina 
sativa]
Length=219

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 124/189 (66%), Gaps = 9/189 (5%)
 Frame = -1

Query  559  PLRKLLIISLDRAKRGRGPLVVKSVAATVFVLMIYTVYSVQEIQSR--PLESINPTDQVL  386
            PLR+L+I SLD+ K G+GP  VK++A T+ V++   + S+ +IQ++   L +++P DQVL
Sbjct  25   PLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSNLMSIVKIQNKGSKLGTMSPMDQVL  84

Query  385  LAQQILQASLMGFVLFLSLMIDRLHHYIRELRLLRKAMEAAKKHDRGFDNGKNGGVEEVN  206
                +L+ASLMG VLFL  +IDR+HHY+R+L  LR  + ++K+        +    E+  
Sbjct  85   WRTHLLEASLMGVVLFLGFIIDRVHHYLRKLINLRSNVGSSKEELEELQKERTEMKEKEE  144

Query  205  S-------LKEEIASMKSKIKKLESECEAKGEEVKAQKDNSESFKGQSEKLLLEYGQLLE  47
                    L+E+++S+  ++KK E+E + K ++++  + + E+ + QS +LLLEY +LLE
Sbjct  145  KASKEIKLLQEKLSSILERLKKAETESKEKEKKLETAETHVEALQKQSAELLLEYDRLLE  204

Query  46   ENQHLRSQL  20
            +NQHL+SQ+
Sbjct  205  DNQHLQSQI  213



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960