BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014D08

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADI87417.1|  fructokinase-like protein 1                             449   1e-153   Gossypium hirsutum [American cotton]
gb|KJB36871.1|  hypothetical protein B456_006G180000                    448   2e-153   Gossypium raimondii
gb|KHG25437.1|  hypothetical protein F383_06753                         448   2e-153   Gossypium arboreum [tree cotton]
gb|ADI87421.1|  fructokinase-like protein 1                             438   3e-152   Nicotiana tabacum [American tobacco]
gb|KHN26222.1|  Fructokinase-2                                          434   7e-151   Glycine soja [wild soybean]
ref|XP_011077603.1|  PREDICTED: fructokinase-like 1, chloroplastic      441   2e-150   Sesamum indicum [beniseed]
gb|KHM98942.1|  Fructokinase-2                                          432   7e-150   Glycine soja [wild soybean]
ref|XP_009772599.1|  PREDICTED: probable fructokinase-4                 438   2e-149   Nicotiana sylvestris
ref|XP_009629251.1|  PREDICTED: fructokinase-1                          438   3e-149   Nicotiana tomentosiformis
ref|NP_001275447.1|  fructokinase-like protein 1                        437   4e-149   Solanum tuberosum [potatoes]
ref|XP_004506641.1|  PREDICTED: fructokinase-2-like                     436   5e-149   Cicer arietinum [garbanzo]
ref|XP_010515923.1|  PREDICTED: fructokinase-like 1, chloroplastic      436   7e-149   Camelina sativa [gold-of-pleasure]
ref|XP_004246362.1|  PREDICTED: fructokinase-like 1, chloroplastic      436   8e-149   Solanum lycopersicum
emb|CDX78206.1|  BnaA09g34010D                                          432   1e-148   
ref|XP_010686350.1|  PREDICTED: fructokinase-like 1, chloroplastic      435   2e-148   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010504200.1|  PREDICTED: fructokinase-like 1, chloroplastic      434   4e-148   Camelina sativa [gold-of-pleasure]
ref|XP_006291033.1|  hypothetical protein CARUB_v10017145mg             434   4e-148   Capsella rubella
ref|XP_009116097.1|  PREDICTED: fructokinase-2                          434   5e-148   Brassica rapa
emb|CDX73510.1|  BnaC08g24930D                                          433   7e-148   
gb|ADI87420.1|  fructokinase-like protein 1                             434   7e-148   Vigna unguiculata
ref|XP_007026821.1|  Fructokinase-like 1                                439   1e-147   
emb|CDP06530.1|  unnamed protein product                                434   1e-147   Coffea canephora [robusta coffee]
ref|XP_010256724.1|  PREDICTED: fructokinase-like 1, chloroplastic      436   1e-147   Nelumbo nucifera [Indian lotus]
ref|XP_010427076.1|  PREDICTED: fructokinase-like 1, chloroplastic      433   2e-147   Camelina sativa [gold-of-pleasure]
gb|ADI87414.1|  fructokinase-like protein 1                             433   2e-147   Nicotiana benthamiana
ref|XP_003516930.1|  PREDICTED: fructokinase-2-like                     432   2e-147   Glycine max [soybeans]
ref|XP_007133958.1|  hypothetical protein PHAVU_010G006700g             432   3e-147   Phaseolus vulgaris [French bean]
ref|XP_006403618.1|  hypothetical protein EUTSA_v10010328mg             432   5e-147   Eutrema salsugineum [saltwater cress]
ref|XP_002876240.1|  pfkB-type carbohydrate kinase family protein       432   6e-147   
gb|KDP24506.1|  hypothetical protein JCGZ_25070                         432   1e-146   Jatropha curcas
ref|XP_010039172.1|  PREDICTED: fructokinase-1                          431   2e-146   Eucalyptus grandis [rose gum]
ref|NP_190977.1|  fructokinase-like 1                                   429   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006429264.1|  hypothetical protein CICLE_v10011551mg             430   4e-146   Citrus clementina [clementine]
ref|XP_008388106.1|  PREDICTED: probable fructokinase-4                 429   7e-146   
gb|EYU26634.1|  hypothetical protein MIMGU_mgv1a005440mg                429   1e-145   Erythranthe guttata [common monkey flower]
ref|XP_010528657.1|  PREDICTED: fructokinase-like 1, chloroplastic      434   1e-145   
gb|KEH28950.1|  pfkB family carbohydrate kinase                         427   2e-145   Medicago truncatula
ref|XP_002527877.1|  fructokinase, putative                             427   5e-145   Ricinus communis
ref|XP_006480938.1|  PREDICTED: probable fructokinase-4-like            426   1e-144   
gb|ADI87415.1|  fructokinase-like protein 1                             424   4e-144   Citrus clementina [clementine]
ref|XP_007205056.1|  hypothetical protein PRUPE_ppa004431mg             425   9e-144   Prunus persica
gb|KFK34655.1|  hypothetical protein AALP_AA5G174200                    422   2e-143   Arabis alpina [alpine rockcress]
ref|XP_002273576.2|  PREDICTED: fructokinase-like 1, chloroplastic      422   3e-143   Vitis vinifera
ref|XP_009358825.1|  PREDICTED: uncharacterized protein LOC103949435    424   1e-141   
ref|XP_004302649.2|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    423   2e-141   Fragaria vesca subsp. vesca
ref|XP_004137741.1|  PREDICTED: fructokinase-2-like                     419   2e-141   
ref|XP_010101836.1|  hypothetical protein L484_023626                   419   3e-141   Morus notabilis
ref|XP_004156589.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    416   2e-140   
ref|XP_008442480.1|  PREDICTED: uncharacterized protein LOC103486334    418   3e-139   
ref|XP_008239829.1|  PREDICTED: uncharacterized protein LOC103338406    417   8e-139   
gb|ADI87418.1|  fructokinase-like protein 1                             408   1e-137   Lactuca sativa [cultivated lettuce]
gb|EPS61748.1|  fructokinase-like protein 1                             398   7e-135   Genlisea aurea
ref|XP_010928949.1|  PREDICTED: fructokinase-like 1, chloroplastic      400   3e-134   Elaeis guineensis
gb|ADI87419.1|  fructokinase-like protein 1                             394   4e-133   Euphorbia esula [wolf's milk]
ref|XP_006848050.1|  hypothetical protein AMTR_s00029p00193780          385   1e-132   
ref|XP_011009152.1|  PREDICTED: fructokinase-like 1, chloroplastic      395   2e-132   Populus euphratica
ref|XP_009421323.1|  PREDICTED: fructokinase-1-like                     395   6e-132   
ref|XP_008798949.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    399   8e-132   
ref|XP_002322950.1|  hypothetical protein POPTR_0016s11690g             391   6e-131   Populus trichocarpa [western balsam poplar]
gb|EMS45106.1|  hypothetical protein TRIUR3_04898                       368   2e-124   Triticum urartu
ref|NP_001147575.1|  protein kinase                                     374   1e-123   
tpg|DAA56815.1|  TPA: protein kinase                                    374   1e-123   
ref|XP_002456644.1|  hypothetical protein SORBIDRAFT_03g040010          373   2e-123   Sorghum bicolor [broomcorn]
gb|EMT01230.1|  hypothetical protein F775_26429                         364   5e-123   
emb|CBI30446.3|  unnamed protein product                                376   9e-123   Vitis vinifera
ref|XP_004970597.1|  PREDICTED: fructokinase-2-like                     369   7e-122   
ref|NP_001044818.1|  Os01g0851000                                       369   1e-121   
emb|CBH32521.1|  protein kinase, putative, expressed                    367   4e-121   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564619.1|  PREDICTED: fructokinase-like 1, chloroplastic      364   7e-120   Brachypodium distachyon [annual false brome]
dbj|BAJ87729.1|  predicted protein                                      361   8e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009358994.1|  PREDICTED: fructokinase-2-like                     347   3e-117   
gb|EEE55679.1|  hypothetical protein OsJ_04093                          352   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002973268.1|  hypothetical protein SELMODRAFT_54157              290   1e-92    
ref|XP_002986741.1|  hypothetical protein SELMODRAFT_44136              288   4e-92    
ref|XP_001774794.1|  predicted protein                                  286   3e-91    
ref|XP_010675364.1|  PREDICTED: cytochrome P450 81D1-like               242   2e-74    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN44929.1|  Fructokinase-2                                          228   7e-67    Glycine soja [wild soybean]
ref|XP_006573158.1|  PREDICTED: putative fructokinase-5-like            228   1e-66    Glycine max [soybeans]
ref|XP_004490214.1|  PREDICTED: uncharacterized protein LOC101493906    226   7e-66    Cicer arietinum [garbanzo]
ref|XP_004144690.1|  PREDICTED: fructokinase-2-like                     221   4e-65    
ref|XP_004160828.1|  PREDICTED: putative fructokinase-5-like            221   3e-64    
ref|XP_010257983.1|  PREDICTED: fructokinase-like 2, chloroplastic      223   5e-64    Nelumbo nucifera [Indian lotus]
gb|KGN54881.1|  hypothetical protein Csa_4G571770                       221   5e-64    Cucumis sativus [cucumbers]
gb|KHN29971.1|  Fructokinase-2                                          220   6e-64    Glycine soja [wild soybean]
ref|XP_003518781.1|  PREDICTED: probable fructokinase-2-like            220   6e-64    Glycine max [soybeans]
ref|XP_008442238.1|  PREDICTED: uncharacterized protein LOC103486152    220   1e-63    Cucumis melo [Oriental melon]
ref|XP_010551378.1|  PREDICTED: fructokinase-like 2, chloroplastic      220   2e-63    Tarenaya hassleriana [spider flower]
gb|KHG26530.1|  Fructokinase-2                                          219   2e-63    Gossypium arboreum [tree cotton]
ref|XP_002273674.2|  PREDICTED: fructokinase-like 2, chloroplasti...    219   2e-63    Vitis vinifera
emb|CDY54150.1|  BnaCnng26300D                                          216   3e-63    Brassica napus [oilseed rape]
ref|XP_003614114.1|  Fructokinase-2                                     219   3e-63    Medicago truncatula
ref|XP_007045821.1|  Fructokinase-like 2 isoform 1                      218   4e-63    
ref|XP_007045823.1|  Fructokinase-like 2 isoform 3                      218   4e-63    
ref|XP_004982464.1|  PREDICTED: putative fructokinase-5-like            218   4e-63    Setaria italica
ref|XP_002512061.1|  fructokinase, putative                             218   7e-63    
ref|XP_007045822.1|  Fructokinase-like 2 isoform 2                      218   1e-62    
ref|XP_006856418.1|  hypothetical protein AMTR_s00047p00218860          218   1e-62    Amborella trichopoda
ref|XP_010649953.1|  PREDICTED: fructokinase-like 2, chloroplasti...    218   2e-62    Vitis vinifera
gb|KDP41324.1|  hypothetical protein JCGZ_15731                         216   2e-62    Jatropha curcas
ref|XP_003562305.1|  PREDICTED: fructokinase-like 2, chloroplastic      216   4e-62    Brachypodium distachyon [annual false brome]
emb|CDY40900.1|  BnaC06g30380D                                          216   5e-62    Brassica napus [oilseed rape]
ref|XP_002466840.1|  hypothetical protein SORBIDRAFT_01g015030          215   8e-62    Sorghum bicolor [broomcorn]
ref|XP_002312288.2|  hypothetical protein POPTR_0008s09690g             215   9e-62    Populus trichocarpa [western balsam poplar]
gb|EEE59468.1|  hypothetical protein OsJ_11670                          215   1e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004297219.1|  PREDICTED: fructokinase-like 2, chloroplastic      214   1e-61    Fragaria vesca subsp. vesca
gb|AAT81682.1|  putative kinase                                         215   1e-61    Oryza sativa Japonica Group [Japonica rice]
gb|ABF97502.1|  pfkB-type carbohydrate kinase family protein, put...    214   1e-61    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA50254.1|  TPA: hypothetical protein ZEAMMB73_178722              216   1e-61    
emb|CDX95956.1|  BnaA07g27750D                                          214   2e-61    
ref|XP_009105465.1|  PREDICTED: uncharacterized protein LOC103831320    214   2e-61    Brassica rapa
ref|XP_010091598.1|  hypothetical protein L484_026446                   214   2e-61    Morus notabilis
ref|XP_006437893.1|  hypothetical protein CICLE_v10031077mg             213   3e-61    Citrus clementina [clementine]
gb|KDO70321.1|  hypothetical protein CISIN_1g0081612mg                  213   5e-61    Citrus sinensis [apfelsine]
gb|EEC75710.1|  hypothetical protein OsI_12536                          213   5e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_008665080.1|  PREDICTED: uncharacterized protein LOC103643674    215   5e-61    
ref|XP_006650283.1|  PREDICTED: uncharacterized protein LOC102700038    211   2e-60    Oryza brachyantha
gb|AAF27059.1|AC008262_8  F4N2.16                                       211   2e-60    Arabidopsis thaliana [mouse-ear cress]
gb|ADI87422.1|  fructokinase-like protein 2                             212   2e-60    Nicotiana benthamiana
ref|XP_006484232.1|  PREDICTED: uncharacterized protein LOC102617588    211   2e-60    Citrus sinensis [apfelsine]
ref|XP_010044389.1|  PREDICTED: uncharacterized protein LOC104433370    211   2e-60    Eucalyptus grandis [rose gum]
ref|XP_007222920.1|  hypothetical protein PRUPE_ppa003690mg             211   2e-60    Prunus persica
ref|XP_011018828.1|  PREDICTED: fructokinase-like 2, chloroplastic      211   4e-60    Populus euphratica
gb|KJB50552.1|  hypothetical protein B456_008G176200                    210   5e-60    Gossypium raimondii
ref|XP_007153496.1|  hypothetical protein PHAVU_003G040700g             210   5e-60    Phaseolus vulgaris [French bean]
emb|CDP00452.1|  unnamed protein product                                209   7e-60    Coffea canephora [robusta coffee]
ref|NP_177080.2|  fructokinase-like 2                                   210   7e-60    
sp|F4I0K2.2|SCKL2_ARATH  RecName: Full=Fructokinase-like 2, chlor...    210   7e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008243824.1|  PREDICTED: uncharacterized protein LOC103342040    209   8e-60    Prunus mume [ume]
ref|XP_008389397.1|  PREDICTED: probable fructokinase-1 isoform X1      209   1e-59    
ref|XP_008389398.1|  PREDICTED: probable fructokinase-1 isoform X2      208   1e-59    
ref|XP_009356432.1|  PREDICTED: probable fructokinase-4 isoform X1      208   2e-59    Pyrus x bretschneideri [bai li]
ref|XP_009356434.1|  PREDICTED: probable fructokinase-4 isoform X2      208   2e-59    Pyrus x bretschneideri [bai li]
ref|XP_009356435.1|  PREDICTED: probable fructokinase-4 isoform X3      208   2e-59    Pyrus x bretschneideri [bai li]
ref|XP_008777340.1|  PREDICTED: putative fructokinase-5                 207   3e-59    Phoenix dactylifera
ref|XP_009786224.1|  PREDICTED: uncharacterized protein LOC104234369    209   3e-59    Nicotiana sylvestris
ref|XP_011075683.1|  PREDICTED: fructokinase-like 2, chloroplastic      207   4e-59    Sesamum indicum [beniseed]
ref|XP_010511945.1|  PREDICTED: fructokinase-like 2, chloroplastic      208   4e-59    
ref|XP_002887225.1|  pfkB-type carbohydrate kinase family protein       207   8e-59    
ref|XP_010415548.1|  PREDICTED: fructokinase-like 2, chloroplasti...    207   1e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010415552.1|  PREDICTED: fructokinase-like 2, chloroplasti...    207   1e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010470895.1|  PREDICTED: fructokinase-like 2, chloroplasti...    207   1e-58    Camelina sativa [gold-of-pleasure]
ref|XP_010470894.1|  PREDICTED: fructokinase-like 2, chloroplasti...    207   1e-58    Camelina sativa [gold-of-pleasure]
ref|XP_009628355.1|  PREDICTED: uncharacterized protein LOC104118730    207   1e-58    Nicotiana tomentosiformis
gb|EMS49265.1|  hypothetical protein TRIUR3_05313                       204   2e-58    Triticum urartu
ref|XP_006301975.1|  hypothetical protein CARUB_v10022455mg             206   4e-58    
ref|XP_006348670.1|  PREDICTED: uncharacterized protein LOC102589995    206   4e-58    Solanum tuberosum [potatoes]
ref|XP_010680662.1|  PREDICTED: fructokinase-like 2, chloroplastic      204   6e-58    Beta vulgaris subsp. vulgaris [field beet]
gb|EMS47290.1|  hypothetical protein TRIUR3_20910                       203   8e-58    Triticum urartu
ref|XP_004239035.1|  PREDICTED: fructokinase-like 2, chloroplastic      205   9e-58    Solanum lycopersicum
gb|EYU28879.1|  hypothetical protein MIMGU_mgv1a003579mg                204   1e-57    Erythranthe guttata [common monkey flower]
gb|EMT14724.1|  hypothetical protein F775_09742                         204   9e-57    
ref|XP_010937787.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    200   2e-56    Elaeis guineensis
gb|KFK41343.1|  hypothetical protein AALP_AA2G117900                    201   2e-56    Arabis alpina [alpine rockcress]
ref|NP_001050625.2|  Os03g0602600                                       169   4e-48    
gb|KDO58032.1|  hypothetical protein CISIN_1g040065mg                   164   1e-47    Citrus sinensis [apfelsine]
gb|KDO70322.1|  hypothetical protein CISIN_1g0081612mg                  174   4e-47    Citrus sinensis [apfelsine]
ref|XP_007222921.1|  hypothetical protein PRUPE_ppa003690mg             166   2e-44    
gb|EPS69174.1|  hypothetical protein M569_05592                         162   1e-43    Genlisea aurea
ref|XP_006391043.1|  hypothetical protein EUTSA_v100183771mg            144   3e-38    
ref|XP_008786156.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase-2     142   2e-37    
ref|XP_010313061.1|  PREDICTED: probable fructokinase-5                 134   2e-33    Solanum lycopersicum
ref|XP_006362721.1|  PREDICTED: putative fructokinase-5-like            134   2e-33    Solanum tuberosum [potatoes]
ref|XP_009602080.1|  PREDICTED: putative fructokinase-5                 132   1e-32    Nicotiana tomentosiformis
ref|XP_008790605.1|  PREDICTED: fructokinase-1-like                     130   3e-32    Phoenix dactylifera
ref|XP_009783705.1|  PREDICTED: putative fructokinase-5                 130   4e-32    Nicotiana sylvestris
ref|XP_009787481.1|  PREDICTED: fructokinase-2 isoform X2               127   6e-32    Nicotiana sylvestris
ref|XP_011074982.1|  PREDICTED: probable fructokinase-5                 129   2e-31    
gb|AEK21796.1|  fructokinase                                            129   2e-31    Dimocarpus longan [longan]
ref|XP_010999528.1|  PREDICTED: probable fructokinase-5                 127   8e-31    Populus euphratica
ref|XP_009787480.1|  PREDICTED: fructokinase-2 isoform X1               127   1e-30    Nicotiana sylvestris
ref|XP_009605011.1|  PREDICTED: fructokinase-2                          126   1e-30    Nicotiana tomentosiformis
gb|AIE16180.1|  fructokinase                                            125   3e-30    Nicotiana tabacum [American tobacco]
gb|AAQ10000.1|  putative fructokinase 2                                 125   4e-30    Petunia integrifolia subsp. inflata
gb|AAQ09999.1|  putative fructokinase 2                                 125   4e-30    Petunia integrifolia subsp. inflata
ref|XP_010526109.1|  PREDICTED: probable fructokinase-4                 125   5e-30    Tarenaya hassleriana [spider flower]
ref|XP_008460045.1|  PREDICTED: probable fructokinase-4                 124   1e-29    Cucumis melo [Oriental melon]
gb|AIL30505.1|  fructokinase-2                                          124   1e-29    Nicotiana tabacum [American tobacco]
ref|XP_010930218.1|  PREDICTED: fructokinase-1-like                     123   2e-29    Elaeis guineensis
emb|CDY06000.1|  BnaA09g37800D                                          123   2e-29    
ref|XP_008800140.1|  PREDICTED: fructokinase-1-like                     123   3e-29    Phoenix dactylifera
ref|XP_009116612.1|  PREDICTED: probable fructokinase-4                 122   4e-29    Brassica rapa
gb|AAM64445.1|  fructokinase-like protein                               122   5e-29    Arabidopsis thaliana [mouse-ear cress]
gb|KDP41134.1|  hypothetical protein JCGZ_03625                         122   6e-29    Jatropha curcas
ref|XP_007201273.1|  hypothetical protein PRUPE_ppa008482mg             122   6e-29    Prunus persica
emb|CDX98377.1|  BnaC06g17380D                                          122   7e-29    
emb|CDX71907.1|  BnaC08g29670D                                          121   8e-29    
emb|CDP17143.1|  unnamed protein product                                119   9e-29    Coffea canephora [robusta coffee]
ref|XP_006443006.1|  hypothetical protein CICLE_v10021105mg             121   9e-29    Citrus clementina [clementine]
ref|XP_010696263.1|  PREDICTED: probable fructokinase-5                 121   1e-28    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010469311.1|  PREDICTED: probable fructokinase-4                 121   1e-28    Camelina sativa [gold-of-pleasure]
emb|CDX67798.1|  BnaA07g18380D                                          121   1e-28    
gb|AIE16179.1|  fructokinase                                            122   1e-28    Nicotiana tabacum [American tobacco]
ref|XP_011041646.1|  PREDICTED: probable fructokinase-7 isoform X1      121   1e-28    Populus euphratica
ref|XP_011041647.1|  PREDICTED: probable fructokinase-7 isoform X2      121   1e-28    Populus euphratica
ref|XP_002521094.1|  fructokinase, putative                             121   1e-28    Ricinus communis
ref|XP_002318851.2|  pfkB-type carbohydrate kinase family protein       121   1e-28    Populus trichocarpa [western balsam poplar]
gb|AIL30508.1|  fructokinase                                            122   1e-28    Nicotiana tabacum [American tobacco]
ref|XP_002321869.1|  pfkB-type carbohydrate kinase family protein       121   2e-28    
ref|XP_009104208.1|  PREDICTED: probable fructokinase-4                 120   2e-28    Brassica rapa
ref|XP_010907694.1|  PREDICTED: LOW QUALITY PROTEIN: fructokinase...    120   2e-28    Elaeis guineensis
ref|XP_009396809.1|  PREDICTED: fructokinase-1-like                     120   2e-28    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252313.1|  PREDICTED: fructokinase-2 isoform X2               120   2e-28    Nelumbo nucifera [Indian lotus]
ref|XP_009393498.1|  PREDICTED: fructokinase-2                          120   2e-28    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_191507.1|  probable fructokinase-4                               120   2e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252312.1|  PREDICTED: probable fructokinase-5 isoform X1      120   3e-28    Nelumbo nucifera [Indian lotus]
ref|XP_007143920.1|  hypothetical protein PHAVU_007G113500g             120   3e-28    Phaseolus vulgaris [French bean]
ref|XP_002876506.1|  pfkB-type carbohydrate kinase family protein       120   3e-28    Arabidopsis lyrata subsp. lyrata
ref|XP_004145029.1|  PREDICTED: probable fructokinase-4-like            120   3e-28    Cucumis sativus [cucumbers]
gb|AHE93349.1|  fructokinase                                            119   4e-28    Camellia sinensis [black tea]
ref|XP_011030019.1|  PREDICTED: probable fructokinase-7 isoform X2      120   4e-28    Populus euphratica
ref|XP_006371336.1|  pfkB-type carbohydrate kinase family protein       119   4e-28    
ref|XP_011016156.1|  PREDICTED: probable fructokinase-7 isoform X2      120   4e-28    Populus euphratica
gb|AFO84081.1|  fructokinase                                            119   4e-28    Actinidia chinensis
ref|XP_011030018.1|  PREDICTED: probable fructokinase-7 isoform X1      120   4e-28    Populus euphratica
ref|XP_011073890.1|  PREDICTED: fructokinase-2-like                     118   4e-28    
ref|XP_011016155.1|  PREDICTED: probable fructokinase-7 isoform X1      120   4e-28    Populus euphratica
gb|KHN30534.1|  Putative fructokinase-5                                 119   4e-28    Glycine soja [wild soybean]
ref|XP_007033923.1|  PfkB-like carbohydrate kinase family protein       119   5e-28    
ref|NP_001233888.1|  fructokinase-2                                     119   5e-28    Solanum lycopersicum
ref|XP_003535409.1|  PREDICTED: putative fructokinase-5-like            119   6e-28    Glycine max [soybeans]
gb|EEC71816.1|  hypothetical protein OsI_04455                          120   6e-28    Oryza sativa Indica Group [Indian rice]
ref|XP_008234319.1|  PREDICTED: fructokinase-1                          119   6e-28    Prunus mume [ume]
gb|ACN40355.1|  unknown                                                 119   7e-28    Picea sitchensis
ref|XP_010512210.1|  PREDICTED: probable fructokinase-4                 119   8e-28    Camelina sativa [gold-of-pleasure]
gb|EMT27421.1|  hypothetical protein F775_08291                         117   8e-28    
ref|XP_009370536.1|  PREDICTED: putative fructokinase-5                 119   8e-28    Pyrus x bretschneideri [bai li]
ref|XP_006402684.1|  hypothetical protein EUTSA_v10006096mg             119   9e-28    Eutrema salsugineum [saltwater cress]
ref|XP_011091648.1|  PREDICTED: fructokinase-2                          119   9e-28    Sesamum indicum [beniseed]
ref|XP_004306875.1|  PREDICTED: probable fructokinase-7                 119   1e-27    Fragaria vesca subsp. vesca
gb|EYU36729.1|  hypothetical protein MIMGU_mgv1a009780mg                119   1e-27    Erythranthe guttata [common monkey flower]
ref|XP_007218097.1|  hypothetical protein PRUPE_ppa006628mg             119   1e-27    
ref|XP_003597523.1|  Fructokinase                                       118   1e-27    Medicago truncatula
ref|XP_010111956.1|  Putative fructokinase-5                            118   1e-27    Morus notabilis
ref|XP_010909223.1|  PREDICTED: fructokinase-1-like                     118   1e-27    Elaeis guineensis
ref|XP_009618746.1|  PREDICTED: fructokinase-1-like                     119   2e-27    Nicotiana tomentosiformis
emb|CDY00619.1|  BnaC04g23060D                                          118   2e-27    
ref|XP_009138911.1|  PREDICTED: probable fructokinase-4                 118   2e-27    Brassica rapa
ref|XP_008467254.1|  PREDICTED: fructokinase-1                          118   2e-27    Cucumis melo [Oriental melon]
ref|XP_004495435.1|  PREDICTED: putative fructokinase-5-like isof...    118   2e-27    Cicer arietinum [garbanzo]
ref|XP_009379916.1|  PREDICTED: probable fructokinase-1                 117   2e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008777085.1|  PREDICTED: fructokinase-2-like                     118   2e-27    Phoenix dactylifera
gb|AAK44144.2|AF370329_1  putative fructokinase                         115   2e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237799.1|  PREDICTED: putative fructokinase-5                 118   2e-27    Prunus mume [ume]
ref|XP_009782121.1|  PREDICTED: fructokinase-1-like                     118   2e-27    Nicotiana sylvestris
emb|CBI36689.3|  unnamed protein product                                115   2e-27    Vitis vinifera
ref|XP_003622348.1|  Fructokinase-2                                     117   2e-27    
ref|XP_010908109.1|  PREDICTED: fructokinase-2-like                     117   2e-27    Elaeis guineensis
ref|XP_001762258.1|  predicted protein                                  118   2e-27    
ref|XP_009404933.1|  PREDICTED: fructokinase-2-like                     117   3e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290279.1|  PREDICTED: probable fructokinase-5                 117   3e-27    Fragaria vesca subsp. vesca
ref|XP_008376501.1|  PREDICTED: fructokinase-1-like                     117   3e-27    Malus domestica [apple tree]
gb|KFK40243.1|  hypothetical protein AALP_AA3G348700                    117   3e-27    Arabis alpina [alpine rockcress]
gb|KFK35169.1|  hypothetical protein AALP_AA5G248700                    117   3e-27    Arabis alpina [alpine rockcress]
sp|Q7XJ81.1|SCRK2_SOLHA  RecName: Full=Fructokinase-2                   117   3e-27    Solanum habrochaites
ref|XP_009371257.1|  PREDICTED: fructokinase-1                          117   3e-27    Pyrus x bretschneideri [bai li]
gb|AFW90586.1|  fructokinase                                            116   3e-27    Solanum tuberosum [potatoes]
gb|AAN41289.1|  putative fructokinase                                   115   3e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456837.1|  PREDICTED: probable fructokinase-5                 117   3e-27    Camelina sativa [gold-of-pleasure]
gb|ABB29956.1|  fructokinase-like                                       117   3e-27    Solanum tuberosum [potatoes]
ref|XP_002533363.1|  fructokinase, putative                             117   3e-27    Ricinus communis
ref|XP_008791838.1|  PREDICTED: fructokinase-1-like                     117   4e-27    
ref|XP_003543564.1|  PREDICTED: fructokinase-2-like                     117   4e-27    Glycine max [soybeans]
ref|XP_010268185.1|  PREDICTED: probable fructokinase-1                 117   4e-27    Nelumbo nucifera [Indian lotus]
ref|XP_006347302.1|  PREDICTED: fructokinase-2                          117   4e-27    Solanum tuberosum [potatoes]
emb|CBI16962.3|  unnamed protein product                                117   4e-27    Vitis vinifera
gb|KDP37795.1|  hypothetical protein JCGZ_06697                         117   4e-27    Jatropha curcas
ref|NP_001234206.1|  fructokinase                                       117   4e-27    Solanum lycopersicum
gb|EYU38801.1|  hypothetical protein MIMGU_mgv1a009756mg                117   4e-27    Erythranthe guttata [common monkey flower]
ref|XP_006397085.1|  hypothetical protein EUTSA_v10029371mg             116   5e-27    
gb|KJB10970.1|  hypothetical protein B456_001G234200                    116   5e-27    Gossypium raimondii
gb|KFK32007.1|  hypothetical protein AALP_AA6G187900                    116   5e-27    Arabis alpina [alpine rockcress]
ref|XP_002263733.1|  PREDICTED: probable fructokinase-5                 116   5e-27    Vitis vinifera
ref|XP_010414131.1|  PREDICTED: probable fructokinase-1                 116   5e-27    Camelina sativa [gold-of-pleasure]
ref|XP_001756304.1|  predicted protein                                  116   6e-27    
gb|KHN06200.1|  Fructokinase-2                                          115   6e-27    Glycine soja [wild soybean]
ref|XP_006341727.1|  PREDICTED: putative fructokinase-5-like            117   6e-27    Solanum tuberosum [potatoes]
ref|XP_010510201.1|  PREDICTED: probable fructokinase-1                 116   6e-27    Camelina sativa [gold-of-pleasure]
ref|XP_001770633.1|  predicted protein                                  117   7e-27    
ref|XP_006292538.1|  hypothetical protein CARUB_v10018769mg             116   7e-27    Capsella rubella
gb|AAS67872.1|  fructokinase                                            116   7e-27    
ref|XP_007038535.1|  PfkB-like carbohydrate kinase family protein...    116   7e-27    
emb|CAN61782.1|  hypothetical protein VITISV_012349                     117   7e-27    
dbj|BAD87551.1|  putative fructokinase                                  114   8e-27    
ref|XP_009382928.1|  PREDICTED: fructokinase-1-like                     116   8e-27    
ref|XP_001780342.1|  predicted protein                                  116   8e-27    
ref|XP_002974772.1|  hypothetical protein SELMODRAFT_102153             114   8e-27    
ref|XP_003555534.1|  PREDICTED: putative fructokinase-5-like            116   9e-27    
ref|XP_002511766.1|  fructokinase, putative                             116   9e-27    
gb|KHN31553.1|  Putative fructokinase-5                                 115   9e-27    
ref|XP_006443007.1|  hypothetical protein CICLE_v10020949mg             116   1e-26    
ref|XP_003548230.1|  PREDICTED: putative fructokinase-5-like isof...    116   1e-26    
ref|XP_009404276.1|  PREDICTED: fructokinase-1-like                     115   1e-26    
ref|XP_006659056.1|  PREDICTED: fructokinase-2-like                     115   1e-26    
ref|XP_006599638.1|  PREDICTED: putative fructokinase-5-like isof...    115   1e-26    
gb|AFO84082.1|  fructokinase                                            115   1e-26    
gb|KJB52887.1|  hypothetical protein B456_008G281900                    116   1e-26    
ref|XP_002994477.1|  hypothetical protein SELMODRAFT_236970             115   1e-26    
gb|KDO63084.1|  hypothetical protein CISIN_1g015777mg                   116   1e-26    
ref|XP_010469704.1|  PREDICTED: probable fructokinase-1                 115   1e-26    
gb|KDO60165.1|  hypothetical protein CISIN_1g018696mg                   114   1e-26    
emb|CDP08915.1|  unnamed protein product                                116   1e-26    
gb|KDO63085.1|  hypothetical protein CISIN_1g015777mg                   116   1e-26    
ref|XP_006482137.1|  PREDICTED: fructokinase-2-like                     116   1e-26    
gb|KJB37261.1|  hypothetical protein B456_006G196700                    115   2e-26    
gb|AJK93569.1|  fructokinase                                            115   2e-26    
ref|XP_004143645.1|  PREDICTED: fructokinase-1-like                     115   2e-26    
gb|AJK93568.1|  fructokinase                                            115   2e-26    
emb|CDY05089.1|  BnaC03g28870D                                          115   2e-26    
gb|ACG34312.1|  fructokinase-2                                          115   2e-26    
ref|XP_003537935.1|  PREDICTED: fructokinase-2-like                     115   2e-26    
ref|XP_006294594.1|  hypothetical protein CARUB_v10023630mg             115   2e-26    
ref|XP_006430625.1|  hypothetical protein CICLE_v10011546mg             116   2e-26    
gb|EPS66213.1|  hypothetical protein M569_08566                         115   2e-26    
gb|ABC01889.1|  fructokinase-like protein                               115   2e-26    
ref|XP_006441854.1|  hypothetical protein CICLE_v10021154mg             115   2e-26    
gb|KHN15693.1|  Putative fructokinase-5                                 115   2e-26    
ref|XP_007131942.1|  hypothetical protein PHAVU_011G053800g             115   2e-26    
ref|XP_003564826.1|  PREDICTED: fructokinase-1                          115   2e-26    
ref|XP_006478288.1|  PREDICTED: putative fructokinase-5-like            115   2e-26    
ref|XP_009134185.1|  PREDICTED: putative fructokinase-5                 114   2e-26    
ref|NP_564875.2|  pfkB-like carbohydrate kinase family protein          115   2e-26    
ref|XP_006589570.1|  PREDICTED: putative fructokinase-5-like            115   2e-26    
ref|XP_010661607.1|  PREDICTED: probable fructokinase-7 isoform X2      114   3e-26    
ref|XP_003534023.1|  PREDICTED: putative fructokinase-5-like isof...    115   3e-26    
ref|XP_008457065.1|  PREDICTED: probable fructokinase-4                 115   3e-26    
ref|XP_007131943.1|  hypothetical protein PHAVU_011G053800g             114   3e-26    
ref|XP_010932642.1|  PREDICTED: probable fructokinase-6, chloropl...    115   3e-26    
ref|XP_006587363.1|  PREDICTED: putative fructokinase-5-like isof...    114   3e-26    
gb|EPS68794.1|  fructokinase-like protein                               114   3e-26    
ref|XP_006587364.1|  PREDICTED: putative fructokinase-5-like isof...    114   3e-26    
gb|EAZ05375.1|  hypothetical protein OsI_27579                          114   3e-26    
ref|NP_001060837.1|  Os08g0113100                                       114   3e-26    
ref|XP_004309811.1|  PREDICTED: probable fructokinase-4                 114   4e-26    
gb|AFK41276.1|  unknown                                                 115   4e-26    
ref|XP_010045714.1|  PREDICTED: probable fructokinase-1                 114   4e-26    
gb|KHN02781.1|  Putative fructokinase-5                                 114   4e-26    
gb|AES76942.2|  pfkB family carbohydrate kinase                         114   4e-26    
ref|XP_002272526.2|  PREDICTED: probable fructokinase-7 isoform X1      114   4e-26    
ref|XP_008788183.1|  PREDICTED: fructokinase-1-like                     114   4e-26    
ref|XP_003555364.2|  PREDICTED: putative fructokinase-5-like            115   4e-26    
ref|XP_011037105.1|  PREDICTED: probable fructokinase-4                 114   4e-26    
ref|XP_007150435.1|  hypothetical protein PHAVU_005G153300g             114   4e-26    
ref|XP_006421810.1|  hypothetical protein CICLE_v10005308mg             114   4e-26    
ref|XP_006587362.1|  PREDICTED: putative fructokinase-5-like isof...    114   4e-26    
ref|XP_008376805.1|  PREDICTED: fructokinase-1-like                     114   4e-26    
gb|KHG22422.1|  hypothetical protein F383_26791                         114   4e-26    
gb|KJB71773.1|  hypothetical protein B456_011G141600                    114   4e-26    
ref|XP_010061753.1|  PREDICTED: fructokinase-1-like                     114   4e-26    
ref|XP_009341299.1|  PREDICTED: fructokinase-1-like                     114   5e-26    
ref|XP_010522182.1|  PREDICTED: probable fructokinase-1                 114   5e-26    
gb|AJK93567.1|  fructokinase                                            114   5e-26    
ref|NP_180697.1|  probable fructokinase-1                               114   5e-26    
ref|XP_009383349.1|  PREDICTED: fructokinase-1-like                     114   5e-26    
ref|XP_010557080.1|  PREDICTED: probable fructokinase-1                 114   5e-26    
ref|XP_001757300.1|  predicted protein                                  114   5e-26    
ref|XP_002881172.1|  pfkB-type carbohydrate kinase family protein       114   5e-26    
gb|AAK62446.1|AF387001_1  putative fructokinase                         114   5e-26    
gb|EEC71945.1|  hypothetical protein OsI_04762                          112   5e-26    
gb|KJB37262.1|  hypothetical protein B456_006G196700                    114   5e-26    
ref|XP_002268097.1|  PREDICTED: probable fructokinase-4                 114   5e-26    
ref|NP_001045068.2|  Os01g0894300                                       114   6e-26    
dbj|BAK07333.1|  predicted protein                                      113   6e-26    
ref|XP_002889581.1|  pfkB-type carbohydrate kinase family protein       114   6e-26    
gb|KHN23057.1|  Putative fructokinase-5                                 114   6e-26    
ref|XP_010927874.1|  PREDICTED: fructokinase-2-like                     113   7e-26    
ref|XP_010529702.1|  PREDICTED: probable fructokinase-5                 113   7e-26    
dbj|BAM13318.1|  fructokinase 1                                         113   7e-26    
dbj|BAM13316.1|  fructokinase 1                                         113   8e-26    
ref|XP_009625375.1|  PREDICTED: probable fructokinase-4                 114   8e-26    
ref|XP_010519220.1|  PREDICTED: probable fructokinase-7                 113   8e-26    
gb|KFK31217.1|  hypothetical protein AALP_AA6G083600                    113   8e-26    
gb|KDP22350.1|  hypothetical protein JCGZ_26181                         113   8e-26    
ref|XP_002963683.1|  hypothetical protein SELMODRAFT_165981             114   8e-26    
ref|XP_010437381.1|  PREDICTED: probable fructokinase-5                 113   9e-26    
gb|AFO84080.1|  fructokinase                                            113   9e-26    
ref|XP_006646557.1|  PREDICTED: fructokinase-1-like                     112   9e-26    
ref|XP_006410273.1|  hypothetical protein EUTSA_v10016928mg             113   9e-26    
gb|KCW90782.1|  hypothetical protein EUGRSUZ_A02848                     114   9e-26    
gb|KDP43855.1|  hypothetical protein JCGZ_20865                         113   9e-26    
ref|XP_010455423.1|  PREDICTED: probable fructokinase-5                 113   9e-26    
ref|XP_002874614.1|  predicted protein                                  113   1e-25    
gb|EMS57576.1|  hypothetical protein TRIUR3_24487                       110   1e-25    
ref|XP_007222617.1|  hypothetical protein PRUPE_ppa008494mg             113   1e-25    
ref|XP_010672224.1|  PREDICTED: probable fructokinase-4                 113   1e-25    
ref|XP_011002780.1|  PREDICTED: probable fructokinase-6, chloropl...    113   1e-25    
ref|XP_006289593.1|  hypothetical protein CARUB_v10003144mg             112   1e-25    
ref|XP_009771749.1|  PREDICTED: probable fructokinase-4                 113   1e-25    
gb|ACL53092.1|  unknown                                                 110   1e-25    
ref|XP_002305200.1|  pfkB-type carbohydrate kinase family protein       113   1e-25    
ref|XP_010262186.1|  PREDICTED: probable fructokinase-6, chloropl...    113   1e-25    
ref|XP_010421945.1|  PREDICTED: probable fructokinase-5                 112   2e-25    
ref|XP_010511466.1|  PREDICTED: probable fructokinase-6, chloropl...    113   2e-25    
emb|CAD31714.1|  fructokinase-like protein                              110   2e-25    
gb|AAA80675.1|  fructokinase                                            112   2e-25    
ref|XP_004970880.1|  PREDICTED: fructokinase-1-like                     112   2e-25    
ref|XP_001759326.1|  predicted protein                                  112   2e-25    
emb|CDP05266.1|  unnamed protein product                                112   2e-25    
ref|XP_009111012.1|  PREDICTED: probable fructokinase-2                 112   2e-25    
ref|XP_004490806.1|  PREDICTED: probable fructokinase-4-like            112   2e-25    
ref|XP_007143353.1|  hypothetical protein PHAVU_007G065200g             112   2e-25    
ref|XP_010415185.1|  PREDICTED: probable fructokinase-6, chloropl...    112   3e-25    
ref|NP_192764.1|  probable fructokinase-5                               112   3e-25    
gb|AHE93348.1|  fructokinase                                            112   3e-25    
ref|XP_004486913.1|  PREDICTED: probable fructokinase-4-like            112   3e-25    
ref|XP_010415184.1|  PREDICTED: probable fructokinase-6, chloropl...    112   3e-25    
gb|ABK28625.1|  unknown                                                 112   3e-25    
ref|XP_011470420.1|  PREDICTED: probable fructokinase-7 isoform X2      112   3e-25    
emb|CDY10801.1|  BnaA05g11350D                                          111   3e-25    
emb|CDY56614.1|  BnaCnng30740D                                          111   3e-25    
gb|AII73555.1|  fructokinase                                            111   3e-25    
ref|XP_004513694.1|  PREDICTED: putative fructokinase-5-like isof...    112   3e-25    
ref|XP_004513695.1|  PREDICTED: putative fructokinase-5-like isof...    111   3e-25    
ref|XP_009144211.1|  PREDICTED: probable fructokinase-1                 111   3e-25    
sp|A2WXV8.1|SCRK1_ORYSI  RecName: Full=Fructokinase-1; AltName: F...    111   4e-25    
ref|XP_001779049.1|  predicted protein                                  111   4e-25    
ref|XP_004308129.1|  PREDICTED: probable fructokinase-7 isoform X1      112   4e-25    
ref|XP_010442690.1|  PREDICTED: probable fructokinase-7 isoform X2      111   4e-25    
gb|EYU37375.1|  hypothetical protein MIMGU_mgv1a010047mg                111   4e-25    
gb|KHN33305.1|  Fructokinase-2                                          111   4e-25    
ref|XP_009778351.1|  PREDICTED: fructokinase-1 isoform X1               111   4e-25    
ref|XP_009384261.1|  PREDICTED: fructokinase-1-like                     111   4e-25    
ref|XP_009132781.1|  PREDICTED: probable fructokinase-1                 111   5e-25    
gb|KEH30339.1|  pfkB family carbohydrate kinase                         111   5e-25    
ref|XP_003546905.1|  PREDICTED: fructokinase-2-like                     111   5e-25    
ref|XP_009778352.1|  PREDICTED: fructokinase-1 isoform X2               111   5e-25    
ref|XP_008343250.1|  PREDICTED: putative fructokinase-5                 110   5e-25    
gb|KHG15213.1|  hypothetical protein F383_03322                         111   5e-25    
emb|CDY23944.1|  BnaC03g17470D                                          111   6e-25    
gb|KCW46326.1|  hypothetical protein EUGRSUZ_K00187                     110   6e-25    
gb|ACJ11715.1|  fructokinase                                            111   6e-25    
ref|XP_002263176.1|  PREDICTED: probable fructokinase-7                 111   6e-25    
ref|XP_008222483.1|  PREDICTED: probable fructokinase-4                 110   7e-25    
ref|XP_010099603.1|  putative fructokinase-4                            110   7e-25    
gb|ACG33449.1|  fructokinase-2                                          110   8e-25    
gb|AFW74311.1|  hypothetical protein ZEAMMB73_056885                    110   8e-25    
ref|XP_010475326.1|  PREDICTED: probable fructokinase-2                 110   8e-25    
ref|XP_010482526.1|  PREDICTED: probable fructokinase-7                 110   8e-25    
ref|XP_003620724.1|  Fructokinase                                       110   8e-25    
ref|NP_001266534.1|  fructokinase-2                                     110   8e-25    
ref|NP_172093.1|  probable fructokinase-2                               110   9e-25    
gb|EPS69686.1|  fructokinase 3                                          110   9e-25    
ref|XP_007152360.1|  hypothetical protein PHAVU_004G123400g             110   9e-25    
ref|XP_003541157.1|  PREDICTED: fructokinase-2-like                     110   9e-25    
ref|XP_004507340.1|  PREDICTED: fructokinase-2-like                     110   9e-25    
emb|CDX86540.1|  BnaC08g01630D                                          110   1e-24    
gb|KFK26793.1|  hypothetical protein AALP_AA8G294300                    110   1e-24    
ref|XP_010035062.1|  PREDICTED: probable fructokinase-1                 110   1e-24    
ref|NP_001105211.1|  fructokinase-2                                     110   1e-24    
gb|ACG36535.1|  fructokinase-2                                          110   1e-24    
gb|ABK94952.1|  unknown                                                 110   1e-24    
ref|XP_009385465.1|  PREDICTED: fructokinase-1-like                     110   1e-24    
ref|XP_002889582.1|  pfkB-type carbohydrate kinase family protein       110   1e-24    
ref|XP_010109032.1|  putative fructokinase-2                            110   1e-24    
ref|XP_007141895.1|  hypothetical protein PHAVU_008G234800g             110   1e-24    
dbj|BAJ53134.1|  JHL05D22.5                                             110   1e-24    
gb|KDP28712.1|  hypothetical protein JCGZ_14483                         110   1e-24    
gb|ABK92748.1|  unknown                                                 110   1e-24    
emb|CDY15383.1|  BnaC04g42400D                                          110   1e-24    
gb|KJB37965.1|  hypothetical protein B456_006G229100                    109   2e-24    
gb|ACG38926.1|  fructokinase-2                                          109   2e-24    
ref|XP_006304792.1|  hypothetical protein CARUB_v10012342mg             109   2e-24    
ref|XP_006372861.1|  pfkB-type carbohydrate kinase family protein       109   2e-24    
gb|ACC64524.1|  fructokinase                                            106   2e-24    
gb|ABR17236.1|  unknown                                                 110   2e-24    
gb|AIE16181.1|  fructokinase                                            109   2e-24    
ref|XP_010457717.1|  PREDICTED: probable fructokinase-2 isoform X2      109   2e-24    
ref|XP_002986057.1|  hypothetical protein SELMODRAFT_425086             109   2e-24    
ref|XP_011026435.1|  PREDICTED: probable fructokinase-1                 109   2e-24    
ref|XP_002989626.1|  hypothetical protein SELMODRAFT_428214             109   2e-24    
ref|XP_003616371.1|  Fructokinase-2                                     110   2e-24    
emb|CDY19092.1|  BnaA04g18320D                                          109   2e-24    
ref|XP_008378129.1|  PREDICTED: probable fructokinase-4                 109   2e-24    
ref|XP_004161610.1|  PREDICTED: putative fructokinase-5-like            109   3e-24    
ref|NP_172092.1|  putative fructokinase-3                               109   3e-24    
ref|XP_004149791.1|  PREDICTED: putative fructokinase-5-like            109   3e-24    
ref|XP_010101617.1|  hypothetical protein L484_003616                   109   3e-24    
gb|ACG39031.1|  fructokinase-2                                          108   3e-24    
gb|KHN41078.1|  Putative fructokinase-4                                 109   3e-24    
ref|NP_001240145.1|  uncharacterized protein LOC100797023               109   3e-24    
ref|XP_010501336.1|  PREDICTED: probable fructokinase-3                 108   3e-24    
ref|XP_002510869.1|  fructokinase, putative                             108   3e-24    
ref|XP_010528532.1|  PREDICTED: probable fructokinase-6, chloropl...    109   4e-24    
gb|KGN57838.1|  hypothetical protein Csa_3G345390                       109   4e-24    
emb|CDY51025.1|  BnaC09g52860D                                          108   4e-24    
dbj|BAM13317.1|  fructokinase 1                                         108   4e-24    
ref|XP_010528531.1|  PREDICTED: probable fructokinase-6, chloropl...    109   4e-24    
ref|XP_010443953.1|  PREDICTED: probable fructokinase-7                 108   4e-24    
ref|XP_010693442.1|  PREDICTED: probable fructokinase-7                 108   4e-24    
emb|CDY10167.1|  BnaC05g04100D                                          108   4e-24    
ref|XP_002310430.1|  hypothetical protein POPTR_0007s01850g             108   4e-24    
gb|AFN08698.1|  FRK2                                                    108   4e-24    
gb|EPS58176.1|  fructokinase                                            107   5e-24    
ref|XP_010485800.1|  PREDICTED: probable fructokinase-2                 108   5e-24    
gb|AJK93566.1|  fructokinase                                            108   5e-24    
ref|XP_006829109.1|  hypothetical protein AMTR_s00001p00265040          108   6e-24    
gb|ACG44849.1|  fructokinase-1                                          108   6e-24    
gb|ABK23155.1|  unknown                                                 106   7e-24    
ref|XP_009119097.1|  PREDICTED: probable fructokinase-2                 108   7e-24    
gb|EMS46497.1|  hypothetical protein TRIUR3_22532                       108   7e-24    
ref|XP_010475323.1|  PREDICTED: probable fructokinase-3                 108   8e-24    



>gb|ADI87417.1| fructokinase-like protein 1 [Gossypium hirsutum]
Length=480

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+
Sbjct  241  SELNLAVLKEARIFHFNSEVLTSPSMRSTLFKAIAWSKKFGGLIFFDLNLPLPLWRSRDK  300

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYHY+R
Sbjct  301  TREVIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYHYTR  360

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  361  EEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  420

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  421  MRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  480



>gb|KJB36871.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
 gb|KJB36872.1| hypothetical protein B456_006G180000 [Gossypium raimondii]
Length=480

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+
Sbjct  241  SELNLAVLKEARIFHFNSEVLTSPSMRSTLFKAITWSKKFGGLIFFDLNLPLPLWRSRDK  300

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYHY+R
Sbjct  301  TREVIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYHYTR  360

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  361  EEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  420

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  421  MRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  480



>gb|KHG25437.1| hypothetical protein F383_06753 [Gossypium arboreum]
Length=480

 Score =   448 bits (1153),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 210/240 (88%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPLPLW+SRD+
Sbjct  241  SELNLAVLKEARIFHFNSEVLTSPSMRSTLFKAIAWSKKFGGLIFFDLNLPLPLWRSRDK  300

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+K R+YYHY+R
Sbjct  301  TREVIKKAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKKRRDYYHYTR  360

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  361  EEISPLWHDGLKFLFVTDGTLRIHYYTPLFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  420

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  421  MRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  480



>gb|ADI87421.1| fructokinase-like protein 1 [Nicotiana tabacum]
Length=288

 Score =   438 bits (1126),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEARIFHFNSEVLTS +M STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  49   SELNLDVLKEARIFHFNSEVLTSSSMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDE  108

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYHY+ 
Sbjct  109  TRNLIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYHYTP  168

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
             E+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  169  AEIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  228

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  229  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  288



>gb|KHN26222.1| Fructokinase-2 [Glycine soja]
Length=292

 Score =   434 bits (1117),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNLAVLKEARIFHFNSE+LT P+M STLF+AI W+KKFGGL+FFDLNLPLPLW+SRDE
Sbjct  53   TELNLAVLKEARIFHFNSEILTCPSMESTLFRAIKWTKKFGGLVFFDLNLPLPLWRSRDE  112

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +ADIIEVSRSELEFLLDE++YE  RNY+PQYFAE ++QT+  + YYHY+ 
Sbjct  113  TREIIKKAWNEADIIEVSRSELEFLLDEEYYERNRNYRPQYFAESYEQTKNRQEYYHYTA  172

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G VVGTEDVLITP+TCDRTGSGDAVVA I
Sbjct  173  EEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVVGTEDVLITPYTCDRTGSGDAVVAAI  232

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPS+W
Sbjct  233  LRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSLW  292



>ref|XP_011077603.1| PREDICTED: fructokinase-like 1, chloroplastic [Sesamum indicum]
Length=490

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 229/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL+VLKEARIFHFNSEVLTS +M STLFKA++WSKKFGGL+FFDLNLPLPLWKSRDE
Sbjct  251  SELNLSVLKEARIFHFNSEVLTSTSMRSTLFKALAWSKKFGGLVFFDLNLPLPLWKSRDE  310

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AWEQADIIEV++ ELEFLLDE++YE +RNY+PQY+AE ++QT+  R+YYHY+R
Sbjct  311  TREVIKEAWEQADIIEVTKQELEFLLDEEYYERRRNYRPQYYAESYEQTKNRRDYYHYAR  370

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD+LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  371  EEILPLWHDQLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  430

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEMF+NQD+LERQLRFAI+AGIISQWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  431  MRKLTTQPEMFDNQDLLERQLRFAIAAGIISQWTIGAVRGFPTESAAQNLKEQVYVPSMW  490



>gb|KHM98942.1| Fructokinase-2 [Glycine soja]
Length=293

 Score =   432 bits (1111),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNLAVLKEARIFHFNSEVLT P+M STLF+AI W+KKF GL+FFDLNLPLPLW+S DE
Sbjct  54   NELNLAVLKEARIFHFNSEVLTCPSMESTLFRAIKWTKKFDGLVFFDLNLPLPLWRSHDE  113

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE+++QT+  + YYHY+ 
Sbjct  114  TREIIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAENYEQTKNRQEYYHYTA  173

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G V+GTEDVLITP+TCDRTGSGDAVVA I
Sbjct  174  EEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVMGTEDVLITPYTCDRTGSGDAVVAAI  233

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPS+W
Sbjct  234  LRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSLW  293



>ref|XP_009772599.1| PREDICTED: probable fructokinase-4 [Nicotiana sylvestris]
Length=486

 Score =   438 bits (1127),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEARIFHFNSEVLTS +M STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  247  SELNLDVLKEARIFHFNSEVLTSSSMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDE  306

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYHY+ 
Sbjct  307  TRNLIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYHYTP  366

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
             E+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  367  AEIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  426

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  427  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  486



>ref|XP_009629251.1| PREDICTED: fructokinase-1 [Nicotiana tomentosiformis]
Length=487

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEARIFHFNSEVLTS TM STLFKAIS SKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  248  SELNLDVLKEARIFHFNSEVLTSSTMRSTLFKAISLSKKFGGLVFFDLNLPLPLWRSRDE  307

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWEQA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+F+QT++ R+YYHY+ 
Sbjct  308  TRNLIKEAWEQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENFEQTKQRRDYYHYTP  367

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD +K LFVTDGTLR+HYY+P+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  368  EEIAPLWHDGMKLLFVTDGTLRVHYYSPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  427

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+ +QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  428  MRKLTTQPEMYNDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  487



>ref|NP_001275447.1| fructokinase-like protein 1 [Solanum tuberosum]
 gb|ADI87416.1| fructokinase-like protein 1 [Solanum tuberosum]
Length=479

 Score =   437 bits (1124),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 227/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEAR+FHFNSEVLTS +M STLFKAI+ SKKFGGLIFFDLNLPLPLW+SRDE
Sbjct  240  SELNLDVLKEARMFHFNSEVLTSSSMRSTLFKAITLSKKFGGLIFFDLNLPLPLWRSRDE  299

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW+QA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+++QT++ RNYYHY+ 
Sbjct  300  TRDLIKKAWQQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENYEQTKQRRNYYHYTP  359

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD LK LFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  360  EEIAPLWHDGLKLLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  419

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  420  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  479



>ref|XP_004506641.1| PREDICTED: fructokinase-2-like [Cicer arietinum]
Length=458

 Score =   436 bits (1122),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTS +M STLFKAI WSKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  219  SELNLAVLKEARIFHFNSEVLTSSSMESTLFKAIKWSKKFGGLVFFDLNLPLPLWRSRDE  278

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+I+ AW +ADIIEVSR+ELEFLLDE+HYE KRNY+PQY+AED++ T+  R YYHY+ 
Sbjct  279  TREIIRKAWHEADIIEVSRTELEFLLDEEHYERKRNYEPQYYAEDYEHTKNRREYYHYTA  338

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD+LKFLFVTDGT+R+HYYTPSF+GVVVGTEDVLITP+TCDRTGSGDAVVA I
Sbjct  339  EEISPLWHDKLKFLFVTDGTIRIHYYTPSFDGVVVGTEDVLITPYTCDRTGSGDAVVAAI  398

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQDVLE+QLRFA++AGIISQWTIG VRGFPTESATQNLKEQVYVPSMW
Sbjct  399  MRKLTTCPEMFENQDVLEKQLRFAVAAGIISQWTIGGVRGFPTESATQNLKEQVYVPSMW  458



>ref|XP_010515923.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   436 bits (1122),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  236  SELNLAVLKEARIFHFNSEVLTSPTMESTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  295

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW++ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYHY+ 
Sbjct  296  TRKLIKKAWDEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTP  355

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  415

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  416  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKEQVYVPSMW  475



>ref|XP_004246362.1| PREDICTED: fructokinase-like 1, chloroplastic [Solanum lycopersicum]
Length=478

 Score =   436 bits (1122),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 227/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEAR+FHFNSEVLTS +M STLFKAI+ SKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  239  SELNLDVLKEARMFHFNSEVLTSSSMRSTLFKAITLSKKFGGLVFFDLNLPLPLWRSRDE  298

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW+QA+IIEVSR ELEFLLDE+HYE KRNY+PQYFAE+++QT++ RNYYHY+ 
Sbjct  299  TRDLIKEAWQQANIIEVSRQELEFLLDEEHYERKRNYRPQYFAENYEQTKQRRNYYHYTP  358

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD LK LFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  359  EEIAPLWHDGLKLLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  418

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+ +QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  419  MRKLTTQPEMYHDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  478



>emb|CDX78206.1| BnaA09g34010D [Brassica napus]
Length=378

 Score =   432 bits (1111),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  139  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  198

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW+ A+IIEVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYHY+ 
Sbjct  199  TRKLIKKAWDTANIIEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYHYTP  258

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  259  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  318

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  319  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  378



>ref|XP_010686350.1| PREDICTED: fructokinase-like 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   435 bits (1119),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL+LAVLKEARIFHFNSEVLTSP MH +LFKAI  SK FGGL+FFD NLPLPLWKSRDE
Sbjct  242  TELDLAVLKEARIFHFNSEVLTSPCMHLSLFKAIKISKFFGGLVFFDPNLPLPLWKSRDE  301

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AWE+A+IIEVSR ELEFLLDEDHYE +RNY+PQY+AED++Q++  R+YYHY+R
Sbjct  302  TREVIKEAWEEANIIEVSRQELEFLLDEDHYEKRRNYRPQYYAEDYEQSKNRRDYYHYTR  361

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD LKFLFVTDGT R+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDA+VAGI
Sbjct  362  EEITPLWHDGLKFLFVTDGTFRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAIVAGI  421

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLT+ PEM+E+QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  422  MRKLTSHPEMYEDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  481



>ref|XP_010504200.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=471

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLF+AI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  232  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFRAIQWSKKFGGLIFFDLNLPLPLWRSRNE  291

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYHY+ 
Sbjct  292  TRKLIKKAWNEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTP  351

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  352  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  411

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  412  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKEQVYVPSMW  471



>ref|XP_006291033.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
 gb|EOA23931.1| hypothetical protein CARUB_v10017145mg [Capsella rubella]
Length=475

 Score =   434 bits (1117),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  236  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  295

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF+QT+  R+YYHY+ 
Sbjct  296  TRKLIKKAWNEANIIEVSQQELEFLLDEDYYEKRRNYTPQYFAEDFEQTKNRRDYYHYTP  355

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  415

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QD+LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  416  MRKLTTCPEMFEDQDMLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEQVYVPSMW  475



>ref|XP_009116097.1| PREDICTED: fructokinase-2 [Brassica rapa]
Length=463

 Score =   434 bits (1115),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  224  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  283

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW++A+I+EVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYHY+ 
Sbjct  284  TRKLIKKAWDEANIVEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYHYTP  343

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  344  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  403

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  404  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  463



>emb|CDX73510.1| BnaC08g24930D [Brassica napus]
Length=463

 Score =   433 bits (1114),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  224  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  283

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW++A+IIE S+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYHY+ 
Sbjct  284  TRKLIKKAWDEANIIEASQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYHYTP  343

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD LK L VTDGTLRLHYYTP F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  344  EEIKPLWHDNLKLLVVTDGTLRLHYYTPKFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  403

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  404  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  463



>gb|ADI87420.1| fructokinase-like protein 1 [Vigna unguiculata]
Length=468

 Score =   434 bits (1115),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLT PTM STLF+AI W++KFGGL+FFDLNLPL LW+SRDE
Sbjct  229  SELNLAVLKEARIFHFNSEVLTCPTMESTLFRAIKWTRKFGGLVFFDLNLPLSLWRSRDE  288

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE ++QT+ ++ YYHY+ 
Sbjct  289  TREIIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAESYEQTKNLQEYYHYTP  348

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EEVAPLWHDRLKFLFVTDGT+R+HYYTPSF G VVGTEDVLITPFTCDRTGSGDA+VA I
Sbjct  349  EEVAPLWHDRLKFLFVTDGTIRIHYYTPSFHGSVVGTEDVLITPFTCDRTGSGDAIVAAI  408

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVLERQLRFA++AGII+QWTIGA+RGFPTESATQNLKEQVYVPSMW
Sbjct  409  LRKLTTCPEMFENQDVLERQLRFAVAAGIIAQWTIGAIRGFPTESATQNLKEQVYVPSMW  468



>ref|XP_007026821.1| Fructokinase-like 1 [Theobroma cacao]
 gb|EOY07323.1| Fructokinase-like 1 [Theobroma cacao]
Length=647

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKE RIFHFNSEVLTSP+M STLFKAI+WSKKFGGLIFFDLNLPL LW+SRDE
Sbjct  408  SELNLAVLKETRIFHFNSEVLTSPSMQSTLFKAIAWSKKFGGLIFFDLNLPLLLWRSRDE  467

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+AE F QT+  R+ YHY+ 
Sbjct  468  TREVIKEAWNKADIIEVSRQELEFLLDEEYYERKRNYRPQYYAESFDQTKNRRDCYHYTS  527

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LK+LFVTDGTLR+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  528  EEISPLWHDGLKYLFVTDGTLRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  587

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQD LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  588  MRKLTTYPEMFENQDTLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  647



>emb|CDP06530.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   434 bits (1116),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEAR+FHFNSEVLT P+MHS LF+AISWSKKFG L+FFD N PLPLW+SRD 
Sbjct  264  SELNLAVLKEARMFHFNSEVLTCPSMHSALFRAISWSKKFGALVFFDPNFPLPLWESRDM  323

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EV+K AWEQADIIEVS+ ELEFLLDE+HYE +RNY PQY+AE+F+QT K+R+YYHY+R
Sbjct  324  TREVLKKAWEQADIIEVSKQELEFLLDEEHYERRRNYTPQYYAENFEQTSKLRDYYHYTR  383

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  384  EEISPLWHDGLKFLFVTDGTLRIHYYAPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  443

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT  EMFENQD+LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVY PSMW
Sbjct  444  MRKLTTVSEMFENQDILERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYAPSMW  503



>ref|XP_010256724.1| PREDICTED: fructokinase-like 1, chloroplastic [Nelumbo nucifera]
Length=541

 Score =   436 bits (1120),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE++ AVLKEARIFHFNSEVLTSP+MHS LF+AI  +KKFGGL+FFDLNLPLPLW+SRDE
Sbjct  302  SEVDFAVLKEARIFHFNSEVLTSPSMHSALFRAIRLTKKFGGLVFFDLNLPLPLWRSRDE  361

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            +WEVIK AW +A+I+EVS+ ELEFLLDE+HYE KRNY+PQY+AE F+QT+  R+YYHY+R
Sbjct  362  SWEVIKKAWNEANIVEVSKQELEFLLDEEHYERKRNYRPQYYAESFEQTKNRRDYYHYTR  421

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            +E++PLWHD +KFLFVTDGT R+HYY+PSF+G VVGTEDVLITP+TCDRTGSGDAVVAGI
Sbjct  422  DEISPLWHDGIKFLFVTDGTFRIHYYSPSFDGAVVGTEDVLITPYTCDRTGSGDAVVAGI  481

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQD LERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  482  MRKLTTHPEMFENQDALERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  541



>ref|XP_010427076.1| PREDICTED: fructokinase-like 1, chloroplastic [Camelina sativa]
Length=475

 Score =   433 bits (1113),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLF+A+ WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  236  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFRAVQWSKKFGGLIFFDLNLPLPLWRSRNE  295

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +ADIIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYHY+ 
Sbjct  296  TRKLIKKAWNEADIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTP  355

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  356  EEIKPLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  415

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE QDVLERQLRFA++AGII+QWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  416  MRKLTTCPEMFEEQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESAAQNLKEQVYVPSMW  475



>gb|ADI87414.1| fructokinase-like protein 1 [Nicotiana benthamiana]
Length=486

 Score =   433 bits (1114),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEARIFHFNSEV TS +M STL KAIS SKKFGGL+FFDLNLPLPLW+SRDE
Sbjct  247  SELNLDVLKEARIFHFNSEVSTSSSMRSTLLKAISLSKKFGGLVFFDLNLPLPLWRSRDE  306

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWEQA+IIEVSR ELEFLL E+HYE KRNY+PQYFAE+F+QT++ R+YYHY+ 
Sbjct  307  TRNLIKEAWEQANIIEVSRQELEFLLGEEHYERKRNYRPQYFAENFEQTKQRRDYYHYTP  366

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD LK LFVTDGTLRLHYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  367  EEIAPLWHDGLKLLFVTDGTLRLHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  426

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTTQPEM+++QDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  427  MRKLTTQPEMYDDQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  486



>ref|XP_003516930.1| PREDICTED: fructokinase-2-like [Glycine max]
Length=467

 Score =   432 bits (1112),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNLAVLKEARIFHFNSE+LT P+M STLF+AI W+KKFGGL+FFDLNLPLPLW+SRDE
Sbjct  228  TELNLAVLKEARIFHFNSEILTCPSMESTLFRAIKWTKKFGGLVFFDLNLPLPLWRSRDE  287

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +ADIIEVSRSELEFLLDE++YE  RNY+PQYFAE ++QT+  + YYHY+ 
Sbjct  288  TREIIKKAWNEADIIEVSRSELEFLLDEEYYERNRNYRPQYFAESYEQTKNRQEYYHYTA  347

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EEV+PLWHDRLKFLFVTDGTLR+HYYTPSF+G VVGTEDVLITP+TCDRTGSGDAVVA I
Sbjct  348  EEVSPLWHDRLKFLFVTDGTLRIHYYTPSFDGSVVGTEDVLITPYTCDRTGSGDAVVAAI  407

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPS+W
Sbjct  408  LRKLTTCPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSLW  467



>ref|XP_007133958.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
 gb|ESW05952.1| hypothetical protein PHAVU_010G006700g [Phaseolus vulgaris]
Length=470

 Score =   432 bits (1111),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLT PTM STLF+AI W++KFGGL+FFDLNLPL LW+SRDE
Sbjct  231  SELNLAVLKEARIFHFNSEVLTCPTMESTLFRAIKWTRKFGGLVFFDLNLPLSLWRSRDE  290

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW +ADIIEVSRSELEFLLDE++YE KRNY+PQYFAE ++QT+ ++ YYHY+ 
Sbjct  291  TRERIKKAWNEADIIEVSRSELEFLLDEEYYERKRNYRPQYFAESYEQTKNLQEYYHYTP  350

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHDRLKFLFVTDGT+R+HYYTPSF+G VVGTEDVLITPFTCDRTGSGDA+VA I
Sbjct  351  EEIAPLWHDRLKFLFVTDGTIRIHYYTPSFDGSVVGTEDVLITPFTCDRTGSGDAIVAAI  410

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVLERQLRFA++AGII+QWTIGA+RGFPTESATQNLKEQVYVPSMW
Sbjct  411  LRKLTTCPEMFENQDVLERQLRFAVAAGIIAQWTIGAIRGFPTESATQNLKEQVYVPSMW  470



>ref|XP_006403618.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
 gb|ESQ45071.1| hypothetical protein EUTSA_v10010328mg [Eutrema salsugineum]
Length=481

 Score =   432 bits (1110),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  242  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFMAIQWSKKFGGLIFFDLNLPLPLWRSRNE  301

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +A+IIEVS+ ELEFLLDE++YE +RNY PQYFAEDF+QT+  R+YYHY+ 
Sbjct  302  TRKLIKKAWNEANIIEVSQQELEFLLDEEYYERRRNYTPQYFAEDFEQTKNRRDYYHYTP  361

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWH+ LK L VTDGTLRLHYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  362  EEIKPLWHEGLKLLVVTDGTLRLHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  421

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  422  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  481



>ref|XP_002876240.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52499.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=477

 Score =   432 bits (1110),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  238  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFTAIQWSKKFGGLIFFDLNLPLPLWRSRNE  297

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYHY+ 
Sbjct  298  TRRLIKKAWNEANIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTA  357

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EEV  LWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  358  EEVKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  417

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  418  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  477



>gb|KDP24506.1| hypothetical protein JCGZ_25070 [Jatropha curcas]
Length=504

 Score =   432 bits (1111),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL+VLKEARIFHF SEVLTSP+M STLF+AI  SKKFGGLIFFDLNLPLPLW+SRDE
Sbjct  265  SELNLSVLKEARIFHFTSEVLTSPSMQSTLFRAIKLSKKFGGLIFFDLNLPLPLWRSRDE  324

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +A+IIEVSR ELEFLLDED YE KRNY+PQY+AE+F+QT+  R+YYHY+R
Sbjct  325  TREVIKKAWNEANIIEVSRRELEFLLDEDFYERKRNYRPQYYAENFEQTKNWRDYYHYTR  384

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LK L VTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VA I
Sbjct  385  EEISPLWHDGLKLLVVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVAAI  444

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVY+PSMW
Sbjct  445  MRKLTTYPEMFENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYIPSMW  504



>ref|XP_010039172.1| PREDICTED: fructokinase-1 [Eucalyptus grandis]
 gb|KCW49483.1| hypothetical protein EUGRSUZ_K03004 [Eucalyptus grandis]
Length=503

 Score =   431 bits (1109),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHF SEVLTSP M+ TLF+AI WSKKFG LIFFDLN+PLPLW+SRDE
Sbjct  264  SELNLAVLKEARIFHFTSEVLTSPLMNVTLFRAIKWSKKFGSLIFFDLNMPLPLWRSRDE  323

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW++A+IIEVSR ELEFLLDEDHYE KRNY+PQYFAE+F+QT+  R+YYHY+R
Sbjct  324  TREMIKRAWDEAEIIEVSRQELEFLLDEDHYERKRNYRPQYFAENFEQTKDRRDYYHYTR  383

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD+LKF+FVTDGTLR+HYY P F+GVVVGTED LITPFTCDRTGSGDAVVA I
Sbjct  384  EEISPLWHDKLKFIFVTDGTLRIHYYAPEFDGVVVGTEDALITPFTCDRTGSGDAVVAAI  443

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMF NQDVLERQLRFA++AGIISQWTIGA+RGFPTESA QNLKEQVYVPSMW
Sbjct  444  LRKLTTCPEMFNNQDVLERQLRFAVAAGIISQWTIGAIRGFPTESAAQNLKEQVYVPSMW  503



>ref|NP_190977.1| fructokinase-like 1 [Arabidopsis thaliana]
 sp|Q9M394.1|SCKL1_ARATH RecName: Full=Fructokinase-like 1, chloroplastic; AltName: Full=PEP-associated 
protein 6; AltName: Full=pfkB-type carbohydrate 
kinase family protein 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB70983.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM13160.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AAM91217.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|AEE79187.1| fructokinase-like 1 [Arabidopsis thaliana]
Length=471

 Score =   429 bits (1104),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTSPTM STLF AI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  232  SELNLAVLKEARIFHFNSEVLTSPTMQSTLFTAIQWSKKFGGLIFFDLNLPLPLWRSRNE  291

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +A+IIEVS+ ELEFLLDED+YE +RNY PQYFAEDF QT+  R+YYHY+ 
Sbjct  292  TRKLIKKAWNEANIIEVSQQELEFLLDEDYYERRRNYTPQYFAEDFDQTKNRRDYYHYTP  351

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+  LWHD+LK L VTDGTLRLHYYTP+F+GVV+GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  352  EEIKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVIGTEDVLITPFTCDRTGSGDAVVAGI  411

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDV+ERQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  412  MRKLTTCPEMFEDQDVMERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  471



>ref|XP_006429264.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
 gb|ESR42504.1| hypothetical protein CICLE_v10011551mg [Citrus clementina]
Length=496

 Score =   430 bits (1106),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLKEA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSRDE
Sbjct  257  SELNVPVLKEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRDE  316

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYHY+R
Sbjct  317  TRELIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYHYTR  376

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  377  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  436

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  437  LRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  496



>ref|XP_008388106.1| PREDICTED: probable fructokinase-4 [Malus domestica]
 ref|XP_008350508.1| PREDICTED: probable fructokinase-4 [Malus domestica]
Length=499

 Score =   429 bits (1104),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEAR+FHF SEVLTSP+M  TLF+A+S+SKKFGGL+FFDLNLPLPLWKSRDE
Sbjct  260  SELNLAVLKEARMFHFTSEVLTSPSMRPTLFRAMSYSKKFGGLVFFDLNLPLPLWKSRDE  319

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + I+ AW QADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F+QT+K R+YYHY+ 
Sbjct  320  TRKYIERAWNQADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFEQTKKRRDYYHYTP  379

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  380  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  439

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+E+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  440  MRKLTTHPEMYEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  499



>gb|EYU26634.1| hypothetical protein MIMGU_mgv1a005440mg [Erythranthe guttata]
Length=483

 Score =   429 bits (1102),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 199/232 (86%), Positives = 218/232 (94%), Gaps = 0/232 (0%)
 Frame = -1

Query  728  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  549
            KEARIFHFNSEVLTS  M STLFKAI  SKKFGGL+FFDLNLPLPLWKSRDET EVIK A
Sbjct  252  KEARIFHFNSEVLTSTAMRSTLFKAIKLSKKFGGLVFFDLNLPLPLWKSRDETREVIKEA  311

Query  548  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVAPLWH  369
            WEQADIIEV++ ELEFLLDEDHYE +RNY+PQY+AE ++QT+K R+YYHY+REE++PLWH
Sbjct  312  WEQADIIEVTKQELEFLLDEDHYEKRRNYRPQYYAESYEQTKKRRDYYHYTREEISPLWH  371

Query  368  DRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLTTQP  189
            DRLKFLFVTDGTLRLHYY+PSF+GVV+GTEDVLITPFTCDRTGSGDAVVA IMRKLTTQP
Sbjct  372  DRLKFLFVTDGTLRLHYYSPSFDGVVIGTEDVLITPFTCDRTGSGDAVVAAIMRKLTTQP  431

Query  188  EMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +M+ENQD L RQLRFAISAGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  432  DMYENQDTLVRQLRFAISAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  483



>ref|XP_010528657.1| PREDICTED: fructokinase-like 1, chloroplastic [Tarenaya hassleriana]
Length=654

 Score =   434 bits (1117),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL+LAVLKEARIFHFNSEVLTSPTM STLFKAI WS KFGGLIFFDLNLPLPLWKSRDE
Sbjct  415  SELSLAVLKEARIFHFNSEVLTSPTMRSTLFKAIQWSVKFGGLIFFDLNLPLPLWKSRDE  474

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +A+IIEVSR ELEFLLDED YE KRNY PQY+AE F+QT+  R+YYHY+R
Sbjct  475  TRELIKKAWNKANIIEVSRQELEFLLDEDDYERKRNYTPQYYAEKFEQTKNRRDYYHYTR  534

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+ PLWHD LKFLFVTDGTLR+HYY PSF+GVVVGTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  535  EEIEPLWHDGLKFLFVTDGTLRIHYYAPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAGI  594

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+ DV ERQLRFAI+AGII+QWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  595  MRKLTTCPEMFEDGDVTERQLRFAIAAGIIAQWTIGAVRGFPTESAAQNLKEQVYVPSMW  654



>gb|KEH28950.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=462

 Score =   427 bits (1098),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNLAVLKEARIFHFNSEVLTS +M STLFKAI W KKFGGL+FFD+NLPLPLW+SRDET
Sbjct  224  ELNLAVLKEARIFHFNSEVLTSLSMESTLFKAIKWFKKFGGLVFFDINLPLPLWRSRDET  283

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E+IK AW++ADIIEVSR+ELEFLLDE+HYE KRNYKPQY+AE+++QT+  + YYHY+ E
Sbjct  284  REIIKKAWQEADIIEVSRTELEFLLDEEHYERKRNYKPQYYAEEYEQTKNHQEYYHYTAE  343

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            +++PLWHD LKFLFVTDGT+R+HYYTPSF+GVVVGTEDVLITP+TCDRTGSGDA+VA IM
Sbjct  344  DISPLWHDGLKFLFVTDGTIRIHYYTPSFDGVVVGTEDVLITPYTCDRTGSGDAIVAAIM  403

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKLTT PEMFE+QDVLERQLRFA++AGIISQWTIG VRGFPTESA QNLKEQVYVPSMW
Sbjct  404  RKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGGVRGFPTESAAQNLKEQVYVPSMW  462



>ref|XP_002527877.1| fructokinase, putative [Ricinus communis]
 gb|EEF34508.1| fructokinase, putative [Ricinus communis]
Length=500

 Score =   427 bits (1099),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL VLKEAR+FHFNSEVLTSP+M  TLFKAI  SKK GGLIFFD NLPLP+W+SRDE
Sbjct  261  SELNLPVLKEARMFHFNSEVLTSPSMQPTLFKAIKLSKKSGGLIFFDPNLPLPMWRSRDE  320

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            TWEVIK AW +ADIIEVSR ELEFLLDED+YE KRNYKPQY+AE ++QT+K R+YYHY+ 
Sbjct  321  TWEVIKKAWNEADIIEVSRRELEFLLDEDYYEKKRNYKPQYYAESYEQTKKWRDYYHYTP  380

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LK L VTDGTLR+HYYTPSF+G VVGTEDVLITPFTCDRTGSGDAVVA +
Sbjct  381  EEISPLWHDGLKLLAVTDGTLRIHYYTPSFDGAVVGTEDVLITPFTCDRTGSGDAVVAAM  440

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  441  MRKLTTCPEMFEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  500



>ref|XP_006480938.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
Length=496

 Score =   426 bits (1096),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLKEA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSR E
Sbjct  257  SELNVPVLKEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRVE  316

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYHY+R
Sbjct  317  TRELIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYHYTR  376

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  377  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  436

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  437  LRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  496



>gb|ADI87415.1| fructokinase-like protein 1 [Citrus clementina]
Length=479

 Score =   424 bits (1091),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VL EA+IFHFNSEVL SPTM STL KAI WSKKFGGLIFFDLNLPLPLWKSR E
Sbjct  240  SELNVPVLXEAKIFHFNSEVLMSPTMGSTLLKAIEWSKKFGGLIFFDLNLPLPLWKSRVE  299

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+IK AW +AD+IEVSR ELEFLLDE+ YE KRNY PQY+AE ++QT+  R+YYHY+R
Sbjct  300  TRELIKKAWNEADVIEVSRQELEFLLDEECYERKRNYVPQYYAESYEQTKNRRDYYHYTR  359

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  360  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  419

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  420  LRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  479



>ref|XP_007205056.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
 gb|EMJ06255.1| hypothetical protein PRUPE_ppa004431mg [Prunus persica]
Length=510

 Score =   425 bits (1092),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHF+SEVLTSP+M  TL +A+S+SKKFGGL+FFD+NLPLPLWKSRDE
Sbjct  271  SELNLAVLKEARIFHFSSEVLTSPSMQLTLLRAMSYSKKFGGLVFFDVNLPLPLWKSRDE  330

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + ++ AW +ADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F QT+K R+YYHY+ 
Sbjct  331  TRKYMERAWNEADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFGQTKKRRDYYHYTP  390

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  391  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  450

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+ENQDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  451  MRKLTTCPEMYENQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  510



>gb|KFK34655.1| hypothetical protein AALP_AA5G174200 [Arabis alpina]
Length=460

 Score =   422 bits (1085),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNS VL SPTM STLFKAI WSKKFGGLIFFDLNLPLPLW+SR+E
Sbjct  221  SELNLAVLKEARIFHFNSAVLISPTMESTLFKAIQWSKKFGGLIFFDLNLPLPLWRSRNE  280

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++IK AW +A+IIE S+ ELEFLLDE++YE +RNY P+YFAEDF+QT+  R+YYHY+ 
Sbjct  281  TRKLIKKAWNEANIIEASQQELEFLLDEEYYERRRNYTPEYFAEDFEQTKNRRDYYHYTP  340

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+  LWHD+LK L VTDGTLRLHYYTP+F+GVVVGTEDVLITP TCDRTGSGDAVVAGI
Sbjct  341  EEIKSLWHDKLKLLVVTDGTLRLHYYTPTFDGVVVGTEDVLITPMTCDRTGSGDAVVAGI  400

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEMFE+QDVLERQLRFA++AGII+QWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  401  MRKLTTCPEMFEDQDVLERQLRFAVAAGIIAQWTIGAVRGFPTESATQNLKEQVYVPSMW  460



>ref|XP_002273576.2| PREDICTED: fructokinase-like 1, chloroplastic [Vitis vinifera]
Length=485

 Score =   422 bits (1086),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+AVLKEARIFHFNSEVLTSP+MHS+LF AI  SKK GGL+FFDLNLPLPLW+SRDE
Sbjct  246  SELNIAVLKEARIFHFNSEVLTSPSMHSSLFGAIELSKKHGGLVFFDLNLPLPLWRSRDE  305

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++I+ AW QADIIEVS+ ELEFLLDED+YE +RNY+PQY+++ ++QT+  R+YYHY+R
Sbjct  306  TRKLIEKAWNQADIIEVSKQELEFLLDEDYYEMRRNYRPQYYSDSYEQTKNRRDYYHYTR  365

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            +E++PLWH+ LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VAGI
Sbjct  366  DEISPLWHEGLKFLFVTDGTLRVHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVAGI  425

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+ENQD LERQLRFAI+AGIISQWTIG VRGFPTESA QNLKEQVYVPSMW
Sbjct  426  MRKLTTFPEMYENQDTLERQLRFAIAAGIISQWTIGGVRGFPTESAAQNLKEQVYVPSMW  485



>ref|XP_009358825.1| PREDICTED: uncharacterized protein LOC103949435 [Pyrus x bretschneideri]
Length=655

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEAR+FHF SEVLTSP+M  TLF+A+S+S+KFGGL+FFDLNLPLPLWKSRDE
Sbjct  416  SELNLAVLKEARMFHFTSEVLTSPSMRPTLFRAMSYSQKFGGLVFFDLNLPLPLWKSRDE  475

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + I  AW QADIIEVSR ELEFLLDED+Y  KRN +PQY+AE+F+QT+K R+YYHY+ 
Sbjct  476  TRKYIDRAWNQADIIEVSRQELEFLLDEDYYVRKRNSRPQYYAEEFEQTKKHRDYYHYTP  535

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWH+ LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  536  EEISPLWHEGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  595

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+E+QDVLERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  596  MRKLTTHPEMYEDQDVLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  655



>ref|XP_004302649.2| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=647

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEAR+FHF SEVLTS  M   L++AI+++KKFGGL+FFDLNLPLPLWKSRDE
Sbjct  408  SELNLAVLKEARMFHFTSEVLTSAPMQPALYRAIAYAKKFGGLVFFDLNLPLPLWKSRDE  467

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW +AD+IEVSR ELEFLLDE++Y  KRNY+PQY+A++++QT+K R+YYHY+ 
Sbjct  468  TREFIKKAWYEADVIEVSRQELEFLLDEEYYVRKRNYRPQYYAQEYEQTKKRRDYYHYTP  527

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD+LKFLFVTDGTLR+HYY+PSF+GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  528  EEIAPLWHDKLKFLFVTDGTLRIHYYSPSFDGVVIGTEDVLITPFTCDRTGSGDAVVAAI  587

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+ENQDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  588  MRKLTTFPEMYENQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  647



>ref|XP_004137741.1| PREDICTED: fructokinase-2-like [Cucumis sativus]
 gb|KGN58805.1| hypothetical protein Csa_3G732620 [Cucumis sativus]
Length=511

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/240 (83%), Positives = 217/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSRDE
Sbjct  272  SELNLAVLKEARIFHFNSESLLSTAIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSRDE  331

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW++ADIIEVSR ELEFLLDE++YE KRNY+PQY+A+  +QT+  R++YHY+ 
Sbjct  332  TREYIKKAWKEADIIEVSRQELEFLLDEEYYEKKRNYRPQYYAQTIEQTKNRRDHYHYTP  391

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHDRLK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  392  EELSPLWHDRLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  451

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  452  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  511



>ref|XP_010101836.1| hypothetical protein L484_023626 [Morus notabilis]
 gb|EXB89973.1| hypothetical protein L484_023626 [Morus notabilis]
Length=519

 Score =   419 bits (1076),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEAR+F+F SEVLTSP+M  TLFKAI++SKKFGGL+FFD NLPLPLWKSRDE
Sbjct  280  SELNLAVLKEARMFYFTSEVLTSPSMKRTLFKAIAYSKKFGGLLFFDPNLPLPLWKSRDE  339

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW +A+IIEV+R ELEFLLDE++YE KRNY+PQY+A++++QT+  R+YYHY+R
Sbjct  340  TREFIKRAWNEANIIEVTRQELEFLLDEEYYERKRNYRPQYYAQNYEQTKNRRDYYHYTR  399

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+H+Y+P+F+GVVVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  400  EEISPLWHDGLKFLFVTDGTLRIHFYSPTFDGVVVGTEDVLITPFTCDRTGSGDAVVAAI  459

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+E+ DVLERQLRFAI+AGIISQWTIG VRGFPTESATQNLKEQVYVPSMW
Sbjct  460  MRKLTTCPEMYEDVDVLERQLRFAIAAGIISQWTIGGVRGFPTESATQNLKEQVYVPSMW  519



>ref|XP_004156589.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2-like [Cucumis 
sativus]
Length=511

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 216/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSRDE
Sbjct  272  SELNLAVLKEARIFHFNSESLLSTAIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSRDE  331

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW++ADIIEVSR ELEFLLDE++YE  RNY+PQY+A+  +QT+  R++YHY+ 
Sbjct  332  TREYIKKAWKEADIIEVSRQELEFLLDEEYYEKXRNYRPQYYAQTIEQTKNRRDHYHYTP  391

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHDRLK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  392  EELSPLWHDRLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  451

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  452  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  511



>ref|XP_008442480.1| PREDICTED: uncharacterized protein LOC103486334 [Cucumis melo]
Length=662

 Score =   418 bits (1075),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 196/240 (82%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSE L S  +  TLFKAI  SKKFGGLIFFDLNLPLPLWKSR+E
Sbjct  423  SELNLAVLKEARIFHFNSEALLSTVIEPTLFKAIQLSKKFGGLIFFDLNLPLPLWKSREE  482

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E IK AW +ADIIEVSR ELEFLLDE++YE KRNY+PQY+A+  +QT+  R++YHY+ 
Sbjct  483  TREYIKKAWNEADIIEVSRQELEFLLDEEYYEKKRNYRPQYYAQTIEQTKNRRDHYHYTP  542

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LK LFVTDGTLR+HYY+PSF GV +GTEDVLITPFTCDRTGSGDAVVAGI
Sbjct  543  EEISPLWHDHLKLLFVTDGTLRIHYYSPSFHGVAIGTEDVLITPFTCDRTGSGDAVVAGI  602

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM ENQDVLERQLRFAI+AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  603  MRKLTTFPEMLENQDVLERQLRFAIAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  662



>ref|XP_008239829.1| PREDICTED: uncharacterized protein LOC103338406 [Prunus mume]
Length=661

 Score =   417 bits (1072),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 192/240 (80%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHF+SEVLTSP+M STL +A+S+SKKFGGL+FFD+NLPLPLWKSRDE
Sbjct  422  SELNLAVLKEARIFHFSSEVLTSPSMQSTLLRAMSYSKKFGGLVFFDVNLPLPLWKSRDE  481

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + ++ AW +ADIIEVSR ELEFLLDED+Y  KRNY+PQY+AE+F+QT+K R+YYHY+ 
Sbjct  482  TRKYMERAWNEADIIEVSRQELEFLLDEDYYVRKRNYRPQYYAEEFEQTKKRRDYYHYTP  541

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LKFLFVTDGTLR+HYY+PSF GVV+GTEDVLITPFTCDRTGSGDAVVA I
Sbjct  542  EEISPLWHDGLKFLFVTDGTLRIHYYSPSFHGVVIGTEDVLITPFTCDRTGSGDAVVAAI  601

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLTT PEM+ENQDVLERQLRFA++A     WTIGAVRGFPTESATQNLKEQVYVPS+W
Sbjct  602  MRKLTTYPEMYENQDVLERQLRFAVAAXXXXXWTIGAVRGFPTESATQNLKEQVYVPSLW  661



>gb|ADI87418.1| fructokinase-like protein 1 [Lactuca sativa]
Length=469

 Score =   408 bits (1048),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 192/241 (80%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL+VLKEAR+FHFNSEVL S +M S+LFKAISWSKKFG LIFFD+NLPLPLWKSR E
Sbjct  229  SELNLSVLKEARMFHFNSEVLLSESMKSSLFKAISWSKKFGSLIFFDMNLPLPLWKSRHE  288

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTR-KIRNYYHYS  396
            T +VIK +WEQADIIEVS+ ELEFLLDE ++E +RNY+PQY+AE  Q+T+   +++YHY+
Sbjct  289  TRKVIKDSWEQADIIEVSKQELEFLLDEHYHEQRRNYQPQYYAESHQETKDNTKDFYHYT  348

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            ++E+APLWHD+LKFLFVTDGTLRLHYY P F+GVVVGTEDVLITPFTCDRTGSGDAVVAG
Sbjct  349  KDEIAPLWHDKLKFLFVTDGTLRLHYYAPDFDGVVVGTEDVLITPFTCDRTGSGDAVVAG  408

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSM  36
            I+RKLT+ PEM+ NQDVL RQLRFAI+AGIISQWTIG VRGFPTESATQNLKEQVYVPSM
Sbjct  409  ILRKLTSFPEMYWNQDVLGRQLRFAIAAGIISQWTIGDVRGFPTESATQNLKEQVYVPSM  468

Query  35   W  33
            W
Sbjct  469  W  469



>gb|EPS61748.1| fructokinase-like protein 1, partial [Genlisea aurea]
Length=407

 Score =   398 bits (1023),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 185/241 (77%), Positives = 215/241 (89%), Gaps = 1/241 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVL-TSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRD  576
            SELNLAVLKEA+IFHFNSEVL TSP+M   LFKAI+ SK FGGL+FFD NLPLPLWKSRD
Sbjct  167  SELNLAVLKEAKIFHFNSEVLLTSPSMLRCLFKAIAASKHFGGLVFFDPNLPLPLWKSRD  226

Query  575  ETWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
            ET E IK AW +A+I+EVSR ELEFLLDE+ YE  R+++PQY+AE + QTRK RN +HY+
Sbjct  227  ETREAIKRAWREANIVEVSRPELEFLLDEERYERMRSHRPQYYAESYDQTRKRRNCHHYT  286

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            R+E+APLWHD LK +FVTDGTLR+HYY+P+F+GVVVGTEDVLITP+TCDRTGSGDA+VAG
Sbjct  287  RDEIAPLWHDGLKLMFVTDGTLRVHYYSPAFDGVVVGTEDVLITPYTCDRTGSGDALVAG  346

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSM  36
            IMRKL   PEMFE++DVL+RQ+RFAI+AGIISQWTIG VRGFP+ESA QNLKEQVYVPSM
Sbjct  347  IMRKLADHPEMFEDEDVLQRQVRFAIAAGIISQWTIGGVRGFPSESAAQNLKEQVYVPSM  406

Query  35   W  33
            W
Sbjct  407  W  407



>ref|XP_010928949.1| PREDICTED: fructokinase-like 1, chloroplastic [Elaeis guineensis]
Length=519

 Score =   400 bits (1029),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 215/240 (90%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+AVLKEARIFHF+S VL +P MHS LF+AI+ SKK+   +FFDLNLPLPLWKSR+E
Sbjct  280  SEINVAVLKEARIFHFSSGVLLAPNMHSALFRAIALSKKYHSNVFFDLNLPLPLWKSREE  339

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVIK AW +AD IEVSR ELEFLLDE++YE KR+Y+PQY++E ++QT+  R+YYHY+R
Sbjct  340  TREVIKKAWSKADFIEVSRQELEFLLDEEYYEKKRSYRPQYYSESYEQTKNRRDYYHYTR  399

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD +K LFVTDGTLR+HYYT  F+G VVGTEDVLITP+TCDRTGSGDAVVA I
Sbjct  400  EEIAPLWHDGIKILFVTDGTLRIHYYTSKFDGAVVGTEDVLITPYTCDRTGSGDAVVAAI  459

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLT  PEM+E+QD+LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  460  MRKLTIHPEMYEDQDLLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  519



>gb|ADI87419.1| fructokinase-like protein 1 [Euphorbia esula]
Length=427

 Score =   394 bits (1013),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 181/227 (80%), Positives = 208/227 (92%), Gaps = 0/227 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNLAVLKEARIFHFNSEVLTS +M STLF+AI  SKKFGGL FFDLNLPLPLW SRDE
Sbjct  201  SELNLAVLKEARIFHFNSEVLTSLSMQSTLFRAIKLSKKFGGLTFFDLNLPLPLWISRDE  260

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            TW+VI+ AW+ AD+IEVSR ELEFL+DEDHYE +RNY+PQY+AE +++T+K RNYYHY+ 
Sbjct  261  TWKVIRKAWDVADVIEVSRRELEFLIDEDHYERQRNYRPQYYAESYEKTKKWRNYYHYTP  320

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++PLWHD LK L VTDGT+R+HYYTPSF+GVVVGTEDVLITPFTCDRTGSGDAVVA +
Sbjct  321  EEISPLWHDGLKLLIVTDGTIRIHYYTPSFDGVVVGTEDVLITPFTCDRTGSGDAVVAAV  380

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESAT  72
            MRKLT  PEMF++QD+LERQLRFA++AGII+QWTIGAVRGFPTESAT
Sbjct  381  MRKLTICPEMFDDQDILERQLRFAVAAGIIAQWTIGAVRGFPTESAT  427



>ref|XP_006848050.1| hypothetical protein AMTR_s00029p00193780 [Amborella trichopoda]
 gb|ERN09631.1| hypothetical protein AMTR_s00029p00193780 [Amborella trichopoda]
Length=215

 Score =   385 bits (989),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 175/215 (81%), Positives = 198/215 (92%), Gaps = 0/215 (0%)
 Frame = -1

Query  677  MHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGAWEQADIIEVSRSELEFL  498
            MHS LF+AI  SKK+GGLIFFDLNLPLPLW+SRDET + I+ AW QA+IIE+++ ELEFL
Sbjct  1    MHSALFRAIQLSKKYGGLIFFDLNLPLPLWRSRDETRKAIQEAWNQANIIELTKQELEFL  60

Query  497  LDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVAPLWHDRLKFLFVTDGTLRLHY  318
            LDED+YE KR YKPQY+AE +QQTRK RN+YHY+REE+APLWHD +K LFVTDGT R+HY
Sbjct  61   LDEDYYERKREYKPQYYAESYQQTRKQRNHYHYTREEIAPLWHDNIKILFVTDGTFRIHY  120

Query  317  YTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAI  138
            YTPSF+G V+GTEDVL+TPFTCDRTGSGDAVVAGIMRKLTT PEM+ENQD+LERQLRFAI
Sbjct  121  YTPSFDGAVIGTEDVLLTPFTCDRTGSGDAVVAGIMRKLTTHPEMYENQDILERQLRFAI  180

Query  137  SAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  181  AAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  215



>ref|XP_011009152.1| PREDICTED: fructokinase-like 1, chloroplastic [Populus euphratica]
Length=485

 Score =   395 bits (1014),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 209/232 (90%), Gaps = 0/232 (0%)
 Frame = -1

Query  728  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  549
            KEAR+FHFNSE LTSP++ STL KAI  SKK GGLIF+DLNLPLPLWKSR+ET EVIK A
Sbjct  254  KEARMFHFNSEALTSPSLQSTLLKAIRLSKKSGGLIFYDLNLPLPLWKSRNETREVIKKA  313

Query  548  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVAPLWH  369
             ++A+ IEVSR+ELEFLLDE++YE KRNY+PQY+AE ++QT+  R+ YHY+REE+APLWH
Sbjct  314  MKEANFIEVSRTELEFLLDEEYYERKRNYRPQYYAESYEQTKNWRDCYHYTREEIAPLWH  373

Query  368  DRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLTTQP  189
            D LKFLFVTDGTL +HYY P+F+G V GTEDVLITPFTCDRTGSGDA+VA +MRKLTT P
Sbjct  374  DGLKFLFVTDGTLEIHYYGPNFDGKVTGTEDVLITPFTCDRTGSGDAIVAALMRKLTTCP  433

Query  188  EMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            EMFE+QDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  434  EMFEDQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  485



>ref|XP_009421323.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   395 bits (1015),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 181/240 (75%), Positives = 210/240 (88%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+++AVLKEARIFHFNSEVL SP M   LF AI  SKK+   +FFDLNLPL LW+SRDE
Sbjct  289  SEIDVAVLKEARIFHFNSEVLLSPAMQPALFWAIKLSKKYNSNVFFDLNLPLSLWRSRDE  348

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVI  AW  +D+IEVSR E+EFLLDE++YE KRNY+PQY++E ++QT+  R+Y+HY+R
Sbjct  349  TREVINKAWSNSDLIEVSRQEMEFLLDEEYYERKRNYRPQYYSESYEQTKNRRDYHHYTR  408

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            +E+APLWHD LK LFVTDGTLR+HYYTP F+G VVGTEDVLITPFTCDRTGSGDAVVA I
Sbjct  409  KEIAPLWHDGLKILFVTDGTLRIHYYTPKFDGAVVGTEDVLITPFTCDRTGSGDAVVAAI  468

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKLT  PEM+E+QD+LER LRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  469  MRKLTIHPEMYEDQDMLERHLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  528



>ref|XP_008798949.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103713712 
[Phoenix dactylifera]
Length=665

 Score =   399 bits (1026),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 181/240 (75%), Positives = 212/240 (88%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+++AVLKEARIFHF+S VL +PTMHS LF+AI+ SKK+   +FFDLNLPLPLW SR+E
Sbjct  426  SEIDVAVLKEARIFHFSSGVLLTPTMHSALFRAIALSKKYSSNVFFDLNLPLPLWSSREE  485

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            TWEVI  AW +AD+IEVSR ELEFLLDE++YE KRNY+PQY+ E ++QT+  R+ +HY+R
Sbjct  486  TWEVINKAWSKADLIEVSRQELEFLLDEEYYEKKRNYRPQYYCESYEQTKNRRDCHHYTR  545

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+APLWHD +K LFVTDGTLR+HYYTP F+G VVGTEDVLITP+TCDRTGSGDAVVA I
Sbjct  546  EEIAPLWHDGIKILFVTDGTLRIHYYTPKFDGAVVGTEDVLITPYTCDRTGSGDAVVAAI  605

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKL    EM E+QD+LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  606  MRKLAIHLEMCEDQDLLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  665



>ref|XP_002322950.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
 gb|EEF04711.1| hypothetical protein POPTR_0016s11690g [Populus trichocarpa]
Length=485

 Score =   391 bits (1004),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 206/232 (89%), Gaps = 0/232 (0%)
 Frame = -1

Query  728  KEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVIKGA  549
            KEAR+FHFNSE LTSP++ STLF+AI  SKK GGLIF+DLNLPLPLWKSR+ET EVIK A
Sbjct  254  KEARMFHFNSEALTSPSLQSTLFEAIRLSKKSGGLIFYDLNLPLPLWKSRNETREVIKKA  313

Query  548  WEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVAPLWH  369
             ++AD IEVSR+ELEFLLDE+ YE KRN  PQY+AE ++QT+  R+ YHY+REE+APLWH
Sbjct  314  MKEADFIEVSRTELEFLLDEECYERKRNCSPQYYAESYEQTKNWRDCYHYTREEIAPLWH  373

Query  368  DRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLTTQP  189
            D LKFLFVTDGTL +HYY P F+G V GTEDVLITPFTCDRTGSGDA+VA +MRKLTT P
Sbjct  374  DGLKFLFVTDGTLEIHYYGPKFDGKVTGTEDVLITPFTCDRTGSGDAIVAALMRKLTTCP  433

Query  188  EMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            EMFE+QDV ERQLRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  434  EMFEDQDVCERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  485



>gb|EMS45106.1| hypothetical protein TRIUR3_04898 [Triticum urartu]
Length=295

 Score =   368 bits (944),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 198/239 (83%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E+N  VLKEAR+ HFNSEVL +P+MH TLF+AI+ SKKFG  IFFDLNLPLPLW+SRDET
Sbjct  57   EINADVLKEARMLHFNSEVLLTPSMHDTLFRAIALSKKFGSKIFFDLNLPLPLWRSRDET  116

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I  AW++ADIIEVSR ELEFLLD  +YE+KR   PQY+ + F  TR    YYHY+ E
Sbjct  117  KEFINRAWKEADIIEVSRDELEFLLDHKYYEYKRATPPQYYLDGFHLTRNWPQYYHYTPE  176

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            E+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  +
Sbjct  177  EIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAAI  236

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  237  RKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  295



>ref|NP_001147575.1| protein kinase [Zea mays]
 gb|ACG27971.1| protein kinase [Zea mays]
Length=521

 Score =   374 bits (960),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 203/240 (85%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHFNSEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW S+D+
Sbjct  282  TEINVDVLKEARMFHFNSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSKDK  341

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVI  AW++A+IIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYHYS 
Sbjct  342  TKEVINRAWKEAEIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYHYSP  401

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA  
Sbjct  402  EEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVAAA  461

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE+VYVPSMW
Sbjct  462  IRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEEVYVPSMW  521



>tpg|DAA56815.1| TPA: protein kinase [Zea mays]
Length=521

 Score =   374 bits (959),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 203/240 (85%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHFNSEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW S+D+
Sbjct  282  TEINVDVLKEARMFHFNSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSKDK  341

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVI  AW++A+IIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYHYS 
Sbjct  342  TKEVINRAWKEAEIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYHYSP  401

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA  
Sbjct  402  EEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVAAA  461

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESATQNLKE+VYVPSMW
Sbjct  462  IRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESATQNLKEEVYVPSMW  521



>ref|XP_002456644.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
 gb|EES01764.1| hypothetical protein SORBIDRAFT_03g040010 [Sorghum bicolor]
Length=524

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 202/240 (84%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHF+SEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW SRD+
Sbjct  285  TEINVDVLKEARMFHFSSEVLLNPSMHDTLFRAIELSKKFGSKVFFDLNLPLPLWTSRDK  344

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVI  AW++ADIIEVSR ELEFLLD ++YE+KRN  PQY+ E F  TR    YYHYS 
Sbjct  345  TKEVINRAWKEADIIEVSRDELEFLLDHEYYEYKRNTPPQYYLEGFHFTRNWPQYYHYSP  404

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDA+VA  
Sbjct  405  EEIAPIWHDGIKILLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAIVAAA  464

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLTT PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKE+VYVPSMW
Sbjct  465  IRKLTTCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEEVYVPSMW  524



>gb|EMT01230.1| hypothetical protein F775_26429 [Aegilops tauschii]
Length=295

 Score =   364 bits (934),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 196/239 (82%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E+N  VLKEA++ HFNSEVL +P+MH TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET
Sbjct  57   EINADVLKEAKMLHFNSEVLLTPSMHDTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDET  116

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I  AW++ADIIEVSR ELEFLLD  +YE+KR   PQY+ + F  TR    YYHY+ E
Sbjct  117  KEFINRAWKEADIIEVSRDELEFLLDHKYYEYKRATPPQYYLDGFHLTRNWPQYYHYTPE  176

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            E+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  +
Sbjct  177  EIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAAI  236

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  237  RKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  295



>emb|CBI30446.3| unnamed protein product [Vitis vinifera]
Length=674

 Score =   376 bits (966),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/235 (74%), Positives = 204/235 (87%), Gaps = 16/235 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+AVLKEARIFHFNSEVLTSP+MHS+LF AI  SKK GGL+FFDLNLPLPLW+SRDE
Sbjct  450  SELNIAVLKEARIFHFNSEVLTSPSMHSSLFGAIELSKKHGGLVFFDLNLPLPLWRSRDE  509

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T ++I+ AW QADIIE+                +RNY+PQY+++ ++QT+  R+YYHY+R
Sbjct  510  TRKLIEKAWNQADIIEM----------------RRNYRPQYYSDSYEQTKNRRDYYHYTR  553

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            +E++PLWH+ LKFLFVTDGTLR+HYY+PSF+GVVVGTEDVLITPFTCDRTGSGDA+VAGI
Sbjct  554  DEISPLWHEGLKFLFVTDGTLRVHYYSPSFDGVVVGTEDVLITPFTCDRTGSGDAIVAGI  613

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVY  48
            MRKLTT PEM+ENQD LERQLRFAI+AGIISQWTIG VRGFPTESA QNLKEQVY
Sbjct  614  MRKLTTFPEMYENQDTLERQLRFAIAAGIISQWTIGGVRGFPTESAAQNLKEQVY  668



>ref|XP_004970597.1| PREDICTED: fructokinase-2-like [Setaria italica]
Length=528

 Score =   369 bits (948),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHF+SEVL +P+MH TLF+AI  SKKFG  +FFDLNLPLPLW SRDE
Sbjct  289  NEINVDVLKEARMFHFSSEVLLNPSMHDTLFRAIEMSKKFGSKVFFDLNLPLPLWTSRDE  348

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T EVI  AW++ADIIE+SR ELEFLLD ++YE+KR   PQY+ E F  TR    YYHYS 
Sbjct  349  TKEVINRAWKEADIIELSRDELEFLLDHEYYEYKRRTPPQYYLEGFHFTRNWPQYYHYSP  408

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP+T DRTGSGDAVVA  
Sbjct  409  EEIAPIWHDGIKVLLVTYGTLRIHYYTPKFHGCVVGTEDALITPYTTDRTGSGDAVVAAA  468

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKL T PEM+E+QD LERQLRFA++AGIISQWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  469  IRKLITCPEMYEDQDTLERQLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEQVYVPSMW  528



>ref|NP_001044818.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAD82650.1| putative fructokinase [Oryza sativa Japonica Group]
 dbj|BAF06732.1| Os01g0851000 [Oryza sativa Japonica Group]
 dbj|BAG89476.1| unnamed protein product [Oryza sativa Japonica Group]
Length=531

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 200/240 (83%), Gaps = 0/240 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHFNSEVL +P+M STLF+AI  SKKFG  IFFDLNLPLPLW+SRDE
Sbjct  292  AEINVDVLKEARVFHFNSEVLLTPSMESTLFRAIELSKKFGSKIFFDLNLPLPLWRSRDE  351

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+I  AW +ADIIEVSR ELEFLLD ++Y++KR   PQY+ + F  TR    YYHY+ 
Sbjct  352  TKELINKAWNEADIIEVSRDELEFLLDHEYYQYKRANPPQYYLDGFHLTRNWPQYYHYTP  411

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G V+GTED LITP+T DRTGSGDAVVA  
Sbjct  412  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVIGTEDALITPYTTDRTGSGDAVVAAA  471

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +RKLT+ PEM+E+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  472  IRKLTSCPEMYEDQDTLERNLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEQVYVPSMW  531



>emb|CBH32521.1| protein kinase, putative, expressed [Triticum aestivum]
 emb|CDM85037.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   367 bits (943),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 195/239 (82%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E+N  VLKEA++ HFNSEVL +P+MH TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET
Sbjct  286  EINADVLKEAKMLHFNSEVLLTPSMHGTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDET  345

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I  AW +ADIIEVSR ELEFLLD  +YEHKR   PQY+ + F  TR    YYHY+ E
Sbjct  346  KEFINRAWREADIIEVSRDELEFLLDHKYYEHKRATPPQYYLDGFHLTRNWPQYYHYTPE  405

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            E+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  +
Sbjct  406  EIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAAI  465

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  466  RKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  524



>ref|XP_003564619.1| PREDICTED: fructokinase-like 1, chloroplastic [Brachypodium distachyon]
Length=526

 Score =   364 bits (934),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 171/239 (72%), Positives = 194/239 (81%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E+N  VLKEAR+ HFNSEVL +P+MH+TLF+ I  SKKFG  IFFDLNLPLPLW+SRDET
Sbjct  288  EINADVLKEARMLHFNSEVLLTPSMHNTLFRTIELSKKFGSKIFFDLNLPLPLWRSRDET  347

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I  AW +ADIIEVSR ELEFLLD+ +YE+KR   PQY+ + F  TR    YYHY+ E
Sbjct  348  KEFINRAWNEADIIEVSRDELEFLLDQKYYEYKRATPPQYYLDGFHLTRNWPQYYHYTPE  407

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            E+AP+WHDR+K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  +
Sbjct  408  EIAPIWHDRIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAAI  467

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKL   PEMFE+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKEQVYVPSMW
Sbjct  468  RKLIACPEMFEDQDTLERGLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEQVYVPSMW  526



>dbj|BAJ87729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   361 bits (927),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/239 (71%), Positives = 197/239 (82%), Gaps = 0/239 (0%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E++  VLKEA++ HFNSEVL +PTM  TLF++I  SKKFG  IFFDLNLPLPLW+SRDET
Sbjct  282  EIHADVLKEAKMLHFNSEVLLTPTMQDTLFRSIELSKKFGSKIFFDLNLPLPLWRSRDET  341

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I  AW++ADIIE+SR ELEFLLD ++YE+KR   PQY+ + F  TR    YYHY+ E
Sbjct  342  KEFINRAWKEADIIELSRDELEFLLDHEYYEYKRATPPQYYLDGFHLTRNWPQYYHYTPE  401

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
            E+AP+WHD +K L VT GTLR+HYYTP F G VVGTED LITP T DRTGSGDA+VA  +
Sbjct  402  EIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVVGTEDALITPTTTDRTGSGDAIVAAAI  461

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            RKLTT PEM+E+QD LER+LRFA++AGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  462  RKLTTCPEMYEDQDTLERELRFAVAAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  520



>ref|XP_009358994.1| PREDICTED: fructokinase-2-like [Pyrus x bretschneideri]
Length=245

 Score =   347 bits (891),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 199/240 (83%), Gaps = 4/240 (2%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S ++   L +AR+FHF SEVLT P+M  TLF A+S+SKKFGGL+FFD+NL L LWKSRDE
Sbjct  10   SIIHFDALMQARVFHFTSEVLTPPSMRPTLFTAMSYSKKFGGLVFFDVNLSLHLWKSRDE  69

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + I  AW +ADII+ SR ELEFLLDE++Y  KRNY   Y+AE+F+QT+K R+YY Y+ 
Sbjct  70   TRKYIDRAWNEADIIKFSRQELEFLLDEENYARKRNY--YYYAEEFEQTKKRRDYYLYTP  127

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE++ LWH  LKFLFVTDGTL +HYY+PSF GVV+GTE VLITPFTCDR GS D  VA I
Sbjct  128  EEISSLWHKGLKFLFVTDGTLPIHYYSPSFHGVVIGTEAVLITPFTCDRAGSRD--VAAI  185

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            MRKL T PEM+E+QDVLER+LRFA++AGIISQW IGAVRGFPTESATQNLKEQVYVPSMW
Sbjct  186  MRKLRTHPEMYEDQDVLERELRFAVAAGIISQWRIGAVRGFPTESATQNLKEQVYVPSMW  245



>gb|EEE55679.1| hypothetical protein OsJ_04093 [Oryza sativa Japonica Group]
Length=590

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/233 (70%), Positives = 193/233 (83%), Gaps = 0/233 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHFNSEVL +P+M STLF+AI  SKKFG  IFFDLNLPLPLW+SRDE
Sbjct  290  AEINVDVLKEARVFHFNSEVLLTPSMESTLFRAIELSKKFGSKIFFDLNLPLPLWRSRDE  349

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T E+I  AW +ADIIEVSR ELEFLLD ++Y++KR   PQY+ + F  TR    YYHY+ 
Sbjct  350  TKELINKAWNEADIIEVSRDELEFLLDHEYYQYKRANPPQYYLDGFHLTRNWPQYYHYTP  409

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            EE+AP+WHD +K L VT GTLR+HYYTP F G V+GTED LITP+T DRTGSGDAVVA  
Sbjct  410  EEIAPIWHDGIKLLLVTYGTLRIHYYTPKFHGCVIGTEDALITPYTTDRTGSGDAVVAAA  469

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            +RKLT+ PEM+E+QD LER LRFA++AGIISQWTIGAVRGFPTESA QNLKEQ
Sbjct  470  IRKLTSCPEMYEDQDTLERNLRFAVAAGIISQWTIGAVRGFPTESAAQNLKEQ  522



>ref|XP_002973268.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
 gb|EFJ25642.1| hypothetical protein SELMODRAFT_54157, partial [Selaginella moellendorffii]
Length=382

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 177/237 (75%), Gaps = 2/237 (1%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ +LKEA++FHF+S  LT+  M STL  AI  ++ FG LIFFD+N PLP W SRD 
Sbjct  146  SEVNMDILKEAKLFHFSSISLTTEKMCSTLMSAIDAARGFGSLIFFDVNFPLPFWISRDA  205

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFA--EDFQQTRKIRNYYHY  399
            TWE I+ AW  +DII++++ ELEFL++++    +   K    +  E+FQ  +  R  YHY
Sbjct  206  TWEAIEKAWTSSDIIKINKVELEFLIEDEGLAMRLLAKDSIASSWEEFQARKNQRFEYHY  265

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            + E++AP+W D +K LFVTDGT R+HYYTP F G VVGTEDV+++ F+CDRTGSGD + A
Sbjct  266  TLEQIAPIWRDNIKILFVTDGTYRIHYYTPKFHGDVVGTEDVIVSAFSCDRTGSGDTISA  325

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVY  48
             I+RKL  QP++FE+QD LER LRF ++AG+ISQWTIGAVRG PTESA QNL EQ++
Sbjct  326  AIIRKLVAQPDIFEDQDRLERALRFVVAAGVISQWTIGAVRGLPTESAAQNLTEQMF  382



>ref|XP_002986741.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
 gb|EFJ12304.1| hypothetical protein SELMODRAFT_44136, partial [Selaginella moellendorffii]
Length=382

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 177/237 (75%), Gaps = 2/237 (1%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ +LKEA++FHF+S  LT+  M STL  AI  ++ FG LIFFD+N PLP W SR+ 
Sbjct  146  SEVNMDILKEAKLFHFSSISLTTEKMCSTLMSAIDAARGFGSLIFFDVNFPLPFWISREA  205

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFA--EDFQQTRKIRNYYHY  399
            TWE I+ AW  +DII++++ ELEFL++++    +   K    +  E+FQ  +  R  YHY
Sbjct  206  TWEAIEKAWTSSDIIKINKVELEFLIEDEGLAMRLLAKDSIASSWEEFQARKNQRFEYHY  265

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            + E++AP+W D +K LFVTDGT R+HYYTP F G VVGTEDV+++ F+CDRTGSGD + A
Sbjct  266  TLEQIAPIWRDNIKILFVTDGTYRIHYYTPKFHGDVVGTEDVIVSAFSCDRTGSGDTISA  325

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVY  48
             I+RKL  QP++FE+QD LER LRF ++AG+ISQWTIGAVRG PTESA QNL EQ++
Sbjct  326  AIIRKLVAQPDIFEDQDRLERALRFVVAAGVISQWTIGAVRGLPTESAAQNLTEQMF  382



>ref|XP_001774794.1| predicted protein [Physcomitrella patens]
 gb|EDQ60335.1| predicted protein, partial [Physcomitrella patens]
Length=390

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 178/243 (73%), Gaps = 5/243 (2%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            E+NL +LKEAR+F F S  L    + STL  +I  +++ G  IFFD+NLPLP WK R+ T
Sbjct  143  EVNLDILKEARMFQFTSISLMQQPISSTLMTSIDTAREGGAEIFFDVNLPLPYWKDRETT  202

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKI--RNYYHYS  396
            W  I+ AW+++ I+EV++ ELEFLL E  YE KR  K  YF++   + +++  R  YHY 
Sbjct  203  WSTIQNAWKKSTIVEVTKQELEFLLGEALYEKKRARKSVYFSKSVDEMKQLTGREEYHYE  262

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             EE++ LWH  +K LFVTDGT R+HYYTP F G + GTEDVL+TPFTCDRTGSGDA+VA 
Sbjct  263  PEELSHLWHKDMKILFVTDGTWRIHYYTPLFHGSIHGTEDVLLTPFTCDRTGSGDAIVAA  322

Query  215  IMRKLTTQPEMFE---NQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYV  45
            I+RKLTTQP++ E   ++D L++ LRFA+ AGIISQWT GA+ GFP+ESA QNL EQVY 
Sbjct  323  IIRKLTTQPQLLEGNLDEDKLQKALRFAVCAGIISQWTKGAIDGFPSESAAQNLTEQVYP  382

Query  44   PSM  36
            PSM
Sbjct  383  PSM  385



>ref|XP_010675364.1| PREDICTED: cytochrome P450 81D1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = -1

Query  449  FAEDFQQTRKIRNYYHYSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVL  270
            +AED++Q++  R+YYHY+REE++PLWHD LKFLFVTDGT R+HYYT SF+GVVVGTEDVL
Sbjct  35   YAEDYEQSKNRRDYYHYTREEISPLWHDGLKFLFVTDGTFRIHYYTSSFDGVVVGTEDVL  94

Query  269  ITPFTCDRTGSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  90
            ITPFTCDRTGSGDA+VAGIMRKLT+ PEM+E++DVLERQLRFAI+AGIISQW IGAVRGF
Sbjct  95   ITPFTCDRTGSGDAIVAGIMRKLTSHPEMYEDRDVLERQLRFAIAAGIISQWAIGAVRGF  154

Query  89   PTESATQNLKEQ  54
            PTESATQNLKEQ
Sbjct  155  PTESATQNLKEQ  166



>gb|KHN44929.1| Fructokinase-2 [Glycine soja]
Length=557

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 146/223 (65%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN  VLKEA++F+FN+  L    M ST  +AI  SK FGG+IF+DLNLP+PLW S +E
Sbjct  314  SELNFDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVIFYDLNLPIPLWHSSEE  373

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  ADIIEV++ ELEFL             P   +E+F      R+ + HY 
Sbjct  374  TMMFIQQAWNLADIIEVTKQELEFLC---------GITP---SEEFDTKNNARSKFVHYE  421

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V+PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFTCD + +GD +VA 
Sbjct  422  PEVVSPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTCDMSATGDGIVAA  481

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  482  LMRMLTVQPDLLTDKGYLEHSIKYAIDCGVIDQWILGRVRGFP  524



>ref|XP_006573158.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=573

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 146/223 (65%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN  VLKEA++F+FN+  L    M ST  +AI  SK FGG+IF+DLNLP+PLW S +E
Sbjct  330  SELNFDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVIFYDLNLPIPLWHSSEE  389

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  ADIIEV++ ELEFL             P   +E+F      R+ + HY 
Sbjct  390  TMMFIQQAWNLADIIEVTKQELEFLC---------GITP---SEEFDTKNNARSKFVHYE  437

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V+PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFTCD + +GD +VA 
Sbjct  438  PEVVSPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTCDMSATGDGIVAA  497

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  498  LMRMLTVQPDLLTDKGYLEHSIKYAIDCGVIDQWILGRVRGFP  540



>ref|XP_004490214.1| PREDICTED: uncharacterized protein LOC101493906 [Cicer arietinum]
Length=577

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/238 (45%), Positives = 151/238 (63%), Gaps = 17/238 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEA++F+FN+  L    M ST  +AI  +K FG ++F+D+NLP+PLW S++E
Sbjct  336  AEINIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKIAKHFGAVVFYDVNLPMPLWHSQEE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+  W  ADIIEV++ ELEFL      + ++ K N K ++               H
Sbjct  396  TKMFIQQVWNLADIIEVTKQELEFLCGITPSEEFDTKNNAKSKFV--------------H  441

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E +APLWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFTCD + SGD +V
Sbjct  442  YEPEVIAPLWHENLKVLFVTNGTSKIHYYTAELDGAVSGMEDPPITPFTCDMSASGDGIV  501

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVY  48
            A IMR LT QP++  ++  LE  +++AI  G+I QW +G VRGFP +  T+++    Y
Sbjct  502  AAIMRMLTVQPDLITDKGYLEHSIKYAIDCGVIDQWILGRVRGFPPQEDTEDITPDPY  559



>ref|XP_004144690.1| PREDICTED: fructokinase-2-like, partial [Cucumis sativus]
Length=447

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 148/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDE
Sbjct  207  SEINIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDE  266

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T E I+  W  ADIIEV++ ELEFL            +P   +E+F  +      + HY 
Sbjct  267  TIEFIQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTRNNDSSKFVHYE  314

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA 
Sbjct  315  PEVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAA  374

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  375  LMRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  425



>ref|XP_004160828.1| PREDICTED: putative fructokinase-5-like [Cucumis sativus]
Length=568

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 148/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDE
Sbjct  328  SEINIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDE  387

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T E I+  W  ADIIEV++ ELEFL            +P   +E+F  +      + HY 
Sbjct  388  TIEFIQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTRNNDSSKFVHYE  435

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA 
Sbjct  436  PEVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAA  495

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  496  LMRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  546



>ref|XP_010257983.1| PREDICTED: fructokinase-like 2, chloroplastic [Nelumbo nucifera]
Length=709

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 144/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FNS  L  P M ST  +AI  SKK GG+IFFDLNLPLPLW+S +E
Sbjct  449  SEINIDVLKEAKMFYFNSFSLLDPNMRSTTLQAIKISKKLGGIIFFDLNLPLPLWQSGEE  508

Query  572  TWEVIKGAWEQADIIEVSRSELEFLL---DEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   ++ AW  AD+IEV++ ELEFL      + ++ K N K ++               H
Sbjct  509  TNMFVQEAWTLADVIEVTKQELEFLCGIKPSESFDTKDNDKSKFI--------------H  554

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E + PLWH  LK LFVT+GT ++HYYT    G V G ED  ITPFTCD + SGD +V
Sbjct  555  YKPEVIRPLWHQNLKVLFVTNGTSKIHYYTEQHNGSVRGMEDPPITPFTCDMSASGDGIV  614

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            A ++R LT QP +  ++  LE  +++AI+ G+I QW +G  RGFP
Sbjct  615  AALLRMLTVQPHLITDKGYLEHTIKYAINCGVIDQWLVGRTRGFP  659



>gb|KGN54881.1| hypothetical protein Csa_4G571770 [Cucumis sativus]
Length=588

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 148/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L  P M ST  KAI  +KK G +IF+DLNLPLPLW SRDE
Sbjct  348  SEINIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIAKKLGSVIFYDLNLPLPLWHSRDE  407

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T E I+  W  ADIIEV++ ELEFL            +P   +E+F  +      + HY 
Sbjct  408  TIEFIQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTRNNDSSKFVHYE  455

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E + PLWH+ LK LFVT+GT ++H+YT   +G ++G ED  +TPFT D + SGD +VA 
Sbjct  456  PEVIKPLWHENLKVLFVTNGTSKIHFYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAA  515

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  516  LMRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDDTEEV  566



>gb|KHN29971.1| Fructokinase-2 [Glycine soja]
Length=557

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+E
Sbjct  314  SELNIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREE  373

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEFL     +E            +F      R+ + HY 
Sbjct  374  TMMFIQRVWNLADIIEVTKQELEFLCGITPFE------------EFDTKNNARSKFVHYE  421

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + +GD +VA 
Sbjct  422  PEVVAPLWHENLKVLFVTNGTSKIHYYTKELNGAVLGMEDAPITPFTRDMSATGDGIVAA  481

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP++  ++  LE  +++ I  G+I QW  G VRGFP
Sbjct  482  LMRMLTVQPDLLTDKGYLEHSIKYGIDCGVIDQWIFGRVRGFP  524



>ref|XP_003518781.1| PREDICTED: probable fructokinase-2-like [Glycine max]
Length=573

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+E
Sbjct  330  SELNIDVLKEAKMFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREE  389

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEFL     +E            +F      R+ + HY 
Sbjct  390  TMMFIQRVWNLADIIEVTKQELEFLCGITPFE------------EFDTKNNARSKFVHYE  437

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + +GD +VA 
Sbjct  438  PEVVAPLWHENLKVLFVTNGTSKIHYYTKELNGAVLGMEDAPITPFTRDMSATGDGIVAA  497

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP++  ++  LE  +++ I  G+I QW  G VRGFP
Sbjct  498  LMRMLTVQPDLLTDKGYLEHSIKYGIDCGVIDQWIFGRVRGFP  540



>ref|XP_008442238.1| PREDICTED: uncharacterized protein LOC103486152 [Cucumis melo]
Length=588

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 147/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L  P M ST  KAI  ++K G +IF+DLNLPLPLW SRDE
Sbjct  348  SEINIDVLKEAKMFYFGTHSLLDPNMRSTSMKAIKIARKLGSVIFYDLNLPLPLWHSRDE  407

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T E I+  W  ADIIEV++ ELEFL            +P   +E+F  +      + HY 
Sbjct  408  TKEFIQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTRNNDSSKFVHYE  455

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E + PLWH  LK LFVT+GT ++HYYT   +G ++G ED  +TPFT D + SGD +VA 
Sbjct  456  PEVIKPLWHRNLKVLFVTNGTSKIHYYTEEHDGAILGMEDAPLTPFTSDMSASGDGIVAA  515

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR L+ QP +  ++  LER +++AI+ G+I QW +G  RG+P    T+ +
Sbjct  516  LMRMLSVQPHLVTDKGYLERSIKYAINCGVIDQWLLGRTRGYPPNDETEEV  566



>ref|XP_010551378.1| PREDICTED: fructokinase-like 2, chloroplastic [Tarenaya hassleriana]
Length=604

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 145/225 (64%), Gaps = 13/225 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK G +IF+D+NLPLPLW+S +E
Sbjct  325  SEINIDVLKEAKMFYFSTHSLLDRKMRSTTLQAIKISKKLGSVIFYDVNLPLPLWQSHEE  384

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W+ ADIIE+++ ELEFL             P   AE+F       N + HY 
Sbjct  385  TKAFIQEVWDLADIIEITKQELEFLC---------GINP---AEEFDTKNNNSNKFVHYG  432

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V PLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFT D + SGD +VAG
Sbjct  433  PEIVEPLWHENLKVLFVTNGTSKIHYYTKDHDGAVLGMEDAPITPFTGDMSASGDGIVAG  492

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  81
            +MR LT QP++  ++  LER LR+AI  G++ QW +   RGFP +
Sbjct  493  LMRMLTVQPDLITDKGYLERMLRYAIECGVVDQWLLAQTRGFPAK  537



>gb|KHG26530.1| Fructokinase-2 [Gossypium arboreum]
Length=585

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 145/229 (63%), Gaps = 13/229 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  316  SEINIDVLKEAKMFYFNTHSLLDRNMRSTTLRAIKMSKKLGGVIFYDVNLPLPLWQSDEE  375

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+ AW  AD IEV++ ELEFL            KP    E+F  +      + HY 
Sbjct  376  TKMFIQEAWNLADFIEVTKQELEFLC---------RIKPM---EEFDTKNNASSKFIHYD  423

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  +TPF+CD + SGD +VAG
Sbjct  424  HEVVAPLWHENLKTLFVTNGTSKIHYYTKEQNGAVNGMEDAPLTPFSCDMSASGDGIVAG  483

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            ++R L+ QP++  ++  LE  +++AI  G+I QW +   RGFP +   Q
Sbjct  484  LLRMLSVQPDLITDKGYLEHTIKYAIDCGVIDQWIVSRTRGFPPKEGIQ  532



>ref|XP_002273674.2| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Vitis 
vinifera]
 emb|CBI27307.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 151/234 (65%), Gaps = 14/234 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VL+EA++F+FN+  L    M ST F+AI  SKK GG+IF+DLNLPLPLW+S  E
Sbjct  324  SEINIDVLREAKMFYFNTSSLLDQNMASTTFRAIKISKKLGGVIFYDLNLPLPLWQSGQE  383

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + I+ AW  ADIIEV++ ELEF+      E+       +  +D   ++    + HY  
Sbjct  384  TKKFIQQAWNLADIIEVTKQELEFICGIKSTEN-------FDTKDNNNSK----FVHYDP  432

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
              V PLWH+ LK LFVT+GT ++H+YT    G V G ED  ITPFTCD + SGD +VAG+
Sbjct  433  VVVGPLWHENLKVLFVTNGTSKIHFYTKEENGAVHGMEDAPITPFTCDMSASGDGIVAGL  492

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            MR LT QP +  ++  LE  +R+AI  G+I QW +   RG+P +   ++++E+V
Sbjct  493  MRMLTVQPHLITDKGYLEHSIRYAIDCGVIDQWLLARQRGYPPK---EDVEEEV  543



>emb|CDY54150.1| BnaCnng26300D [Brassica napus]
Length=472

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 144/222 (65%), Gaps = 11/222 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+E
Sbjct  200  SEINVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREE  259

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +I+  W+ AD+IEV++ ELEFL   +         P+ F      + K   + HY  
Sbjct  260  TKSLIQEVWDLADVIEVTKQELEFLCGIE--------PPEEFDTKNNDSSK---FVHYEP  308

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  309  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  368

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  369  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  410



>ref|XP_003614114.1| Fructokinase-2 [Medicago truncatula]
 gb|AES97072.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=578

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 150/236 (64%), Gaps = 13/236 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M ST  +AI  +K FG ++F+D+NLP+PLW S++E
Sbjct  337  SEINIDVLKEAKMFYFNTHSLLDRHMRSTTLRAIKIAKHFGAVVFYDVNLPMPLWHSQEE  396

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEFL             P   +E+F      R+ + HY 
Sbjct  397  TKTFIQQVWNLADIIEVTKQELEFLC---------GITP---SEEFDTKNNARSKFVHYE  444

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFT D + SGD +VA 
Sbjct  445  PEVVAPLWHENLKVLFVTNGTSKIHYYTTELDGAVSGMEDAPITPFTRDMSASGDGIVAA  504

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVY  48
            +MR LT QP++  ++  L+  +++AI  G+I QW +G VRGFP +  T+++    Y
Sbjct  505  LMRMLTVQPDLITDKGYLQHSIQYAIDCGVIDQWILGRVRGFPPQEDTEDITPDPY  560



>ref|XP_007045821.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
 gb|EOY01653.1| Fructokinase-like 2 isoform 1 [Theobroma cacao]
Length=577

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  325  SEINIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEE  384

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  385  TKIFIQEAWNLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFIHYD  432

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD +VA 
Sbjct  433  HEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDGIVAA  492

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  493  LLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535



>ref|XP_007045823.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
 gb|EOY01655.1| Fructokinase-like 2 isoform 3, partial [Theobroma cacao]
Length=585

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  325  SEINIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEE  384

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  385  TKIFIQEAWNLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFIHYD  432

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD +VA 
Sbjct  433  HEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDGIVAA  492

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  493  LLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535



>ref|XP_004982464.1| PREDICTED: putative fructokinase-5-like [Setaria italica]
Length=581

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 146/228 (64%), Gaps = 14/228 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N AVLKEA++F++NS  L  PT  S+L KA+  SKKFGG+IFFDLNLPLPLW S   
Sbjct  328  SDINPAVLKEAKMFYYNSSALLEPTTQSSLLKAVDVSKKFGGIIFFDLNLPLPLWSSSKV  387

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T  +IK AWE ADIIEV++ ELEFL D          KP   +E F      ++ + HYS
Sbjct  388  TKSLIKEAWEAADIIEVTKQELEFLCD---------IKP---SEKFDTNDNDKSKFTHYS  435

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +  LWHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGDA+VA 
Sbjct  436  PEAIKKLWHDNLKVLFVTNGTSKIHYYTEKHSGWVRGTEDAPITPFTSEMSQSGDAIVAA  495

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
            +MR L   P +  ++  L + +++AI  G++ QW +   RGF P E A
Sbjct  496  LMRMLAINPHLVTDKVYLHKAVKYAIKCGVLDQWVLARERGFLPKERA  543



>ref|XP_002512061.1| fructokinase, putative [Ricinus communis]
 gb|EEF50730.1| fructokinase, putative [Ricinus communis]
Length=575

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/222 (47%), Positives = 144/222 (65%), Gaps = 11/222 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++ +FN+  L    M S   +AI  SKK GG+IF+D+NLPLPLW S +E
Sbjct  331  SEINIDVLKEAKMLYFNTHSLIDRNMRSATMRAIRISKKLGGVIFYDVNLPLPLWHSSEE  390

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T   I+  W  A+IIEV++ ELEFL   +  E       ++  +D   ++    + HY  
Sbjct  391  TKLFIQEVWNHANIIEVTKQELEFLCGIEPTE-------EFDTKDNASSK----FVHYGP  439

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E VAPLWH+ LK LFVT+GT ++HYYT  F G V G ED  ITPFTCD + SGD +VA I
Sbjct  440  EVVAPLWHENLKVLFVTNGTSKIHYYTEEFNGSVHGMEDPAITPFTCDMSASGDGIVAAI  499

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            MR L+ QP +  ++  LE+ +++AI  G+I QW +G +RGFP
Sbjct  500  MRMLSVQPHLIADKGYLEKTIKYAIDCGVIDQWLLGRMRGFP  541



>ref|XP_007045822.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
 gb|EOY01654.1| Fructokinase-like 2 isoform 2 [Theobroma cacao]
Length=594

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  KAI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  325  SEINIDVLKEAKMFYFSTHSLLDRNMRSTTLKAIKMSKKLGGVIFYDVNLPLPLWQSDEE  384

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  385  TKIFIQEAWNLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFIHYD  432

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V PLWH+ LK LFVT+GT ++HYYT    G   G ED  ITPFTCD + SGD +VA 
Sbjct  433  HEVVKPLWHENLKVLFVTNGTSKIHYYTKEQNGAAHGMEDAPITPFTCDMSASGDGIVAA  492

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  ++  LE  +++AI  G+I QW +   RGFP
Sbjct  493  LLRMLTVQPDLITDKGYLECTIKYAIDCGVIDQWLVARTRGFP  535



>ref|XP_006856418.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
 gb|ERN17885.1| hypothetical protein AMTR_s00047p00218860 [Amborella trichopoda]
Length=611

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 149/222 (67%), Gaps = 11/222 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FNS  L    M ST  +AI   KK GG++FFDLNLPLPLWKS++E
Sbjct  336  SEINVDVLKEAKMFYFNSSSLVDQEMRSTTMEAIDLLKKLGGVVFFDLNLPLPLWKSKEE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +I+ AW+QAD +EV++ ELEFL   +  E       ++  +D  +++    + H+ R
Sbjct  396  TRTLIEQAWKQADFVEVTKQELEFLCGIEPSE-------KFDTKDNDKSK----FIHHKR  444

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E ++PLWH+ LK LFVT+GT ++HYY    +G   G ED  I+PFTCD + SGDA+VA +
Sbjct  445  EVISPLWHESLKVLFVTNGTSKIHYYMEKTDGAENGMEDAPISPFTCDMSTSGDAIVAAL  504

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            MR L  QP++  ++  L   +++AI+ G+  QW IG +RGFP
Sbjct  505  MRMLVLQPDLCTDRGYLRHAVKYAINCGVHHQWLIGRIRGFP  546



>ref|XP_010649953.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Vitis 
vinifera]
Length=627

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/234 (46%), Positives = 151/234 (65%), Gaps = 14/234 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VL+EA++F+FN+  L    M ST F+AI  SKK GG+IF+DLNLPLPLW+S  E
Sbjct  386  SEINIDVLREAKMFYFNTSSLLDQNMASTTFRAIKISKKLGGVIFYDLNLPLPLWQSGQE  445

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T + I+ AW  ADIIEV++ ELEF+      E+       +  +D   ++    + HY  
Sbjct  446  TKKFIQQAWNLADIIEVTKQELEFICGIKSTEN-------FDTKDNNNSK----FVHYDP  494

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
              V PLWH+ LK LFVT+GT ++H+YT    G V G ED  ITPFTCD + SGD +VAG+
Sbjct  495  VVVGPLWHENLKVLFVTNGTSKIHFYTKEENGAVHGMEDAPITPFTCDMSASGDGIVAGL  554

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            MR LT QP +  ++  LE  +R+AI  G+I QW +   RG+P +   ++++E+V
Sbjct  555  MRMLTVQPHLITDKGYLEHSIRYAIDCGVIDQWLLARQRGYPPK---EDVEEEV  605



>gb|KDP41324.1| hypothetical protein JCGZ_15731 [Jatropha curcas]
Length=580

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 150/235 (64%), Gaps = 16/235 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L   +M     +AI  SKK GG+IF+DLNLPLPLW+S +E
Sbjct  329  SEINIDVLKEAKMFYFTTHSLLVRSMRLATLQAIKISKKLGGVIFYDLNLPLPLWQSSEE  388

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  A+IIEV++ ELEFL            KP   A++F      R+ + HY 
Sbjct  389  TKLFIQEVWNHANIIEVTKQELEFLC---------GIKP---ADEFDTKNNARSKFVHYG  436

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFTCD + SGD +VA 
Sbjct  437  PEVVAPLWHENLKVLFVTNGTSKIHYYTEEHNGSVHGMEDAPITPFTCDMSASGDGIVAA  496

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            I+R  + QP +  ++  LE  +++AI  G+I QW +G VRGFP +   ++++E+V
Sbjct  497  ILRMFSVQPHLITDKGYLEHTIKYAIDCGVIDQWLLGRVRGFPPK---EDMEEEV  548



>ref|XP_003562305.1| PREDICTED: fructokinase-like 2, chloroplastic [Brachypodium distachyon]
Length=578

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 148/236 (63%), Gaps = 16/236 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+IFFDLNLP+PLW S  E
Sbjct  324  SDINPDVLKEAKMFYYNSSALLEPTTRSSLLKAIEISKKFGGIIFFDLNLPMPLWSSSKE  383

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  +IK AWE ADIIEV++ E+EFL            KP  +   ED ++++    + HY
Sbjct  384  TKSLIKEAWEAADIIEVTKQEIEFLC---------GIKPSGKSDTEDDEKSK----FKHY  430

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E V  LWH  LK LFVT+GT ++HYYT    G V GTED  ITPFTC+ + SGDA+VA
Sbjct  431  SPEVVMKLWHANLKVLFVTNGTSKIHYYTEKHNGWVRGTEDAPITPFTCEMSQSGDAIVA  490

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESATQNLKEQ  54
             +M  L+  P +  ++  L + ++ AI  G+I QW +   RGF P E A     EQ
Sbjct  491  ALMNMLSINPHLVTDKVYLHKTVKHAIKCGVIDQWLVARERGFLPRERADYPTSEQ  546



>emb|CDY40900.1| BnaC06g30380D [Brassica napus]
Length=616

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 144/222 (65%), Gaps = 11/222 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+E
Sbjct  335  SEINVDVLKEAKMFYFTTHSLQDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREE  394

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +I+  W+ AD+IEV++ ELEFL   +         P+ F      + K   + HY  
Sbjct  395  TKSLIQEVWDLADVIEVTKQELEFLCGIE--------PPEEFDTKNNDSSK---FVHYEP  443

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +VAG+
Sbjct  444  ETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIVAGL  503

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  504  IRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  545



>ref|XP_002466840.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
 gb|EER93838.1| hypothetical protein SORBIDRAFT_01g015030 [Sorghum bicolor]
Length=583

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 144/228 (63%), Gaps = 14/228 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  E
Sbjct  330  SDINPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKE  389

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T  +IK AWE ADIIEV++ ELEFL            KP   +E F      ++ + HYS
Sbjct  390  TKLLIKEAWEAADIIEVTKQELEFLC---------GIKP---SEKFDTNDNDKSKFTHYS  437

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +  LWH+ LK LFVT+GT ++HYYT    G V GTED  ITPFT D + SGDA+VA 
Sbjct  438  PEVIMKLWHNNLKVLFVTNGTSKIHYYTEKHNGWVRGTEDAPITPFTSDMSQSGDAIVAA  497

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
            +MR L   P +  ++  L + ++ AI  G+I QW +   RGF P E A
Sbjct  498  LMRMLIINPHLVTDKVYLHKAVKHAIKCGVIDQWMLARERGFLPKERA  545



>ref|XP_002312288.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
 gb|EEE89655.2| hypothetical protein POPTR_0008s09690g [Populus trichocarpa]
Length=607

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 147/225 (65%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLK+A++F+FN+  L   +M ST  +AI  SKK G ++F+D+NLPLPLW+S +E
Sbjct  328  SELNIDVLKQAKMFYFNTHSLLDRSMRSTALRAIKVSKKLGAVVFYDVNLPLPLWRSSEE  387

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+ AW  AD+IEV++ ELEFL     ++ ++ + N K ++               H
Sbjct  388  TKLFIQEAWNLADVIEVTKQELEFLCGIEPDEEFDTRNNAKSKFV--------------H  433

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E VAPLWH+ L+ LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD + 
Sbjct  434  YGPEVVAPLWHENLEVLFVTNGTSKIHYYTREHNGAVHGMEDPPITPFTSDMSASGDGIT  493

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP++F +++ LE  +++AI  G+I QW +G  RGFP
Sbjct  494  AGLLRMLTVQPDLFTDKEYLESTIKYAIDCGVIDQWLLGRTRGFP  538



>gb|EEE59468.1| hypothetical protein OsJ_11670 [Oryza sativa Japonica Group]
Length=586

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 148/229 (65%), Gaps = 16/229 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  E
Sbjct  333  TDINPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKE  392

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  ++K AWE ADIIE+++ ELEFL            KP  ++  +D  +++    + HY
Sbjct  393  TKSLVKEAWEAADIIEITKQELEFLC---------GIKPSEKFGTKDNDKSK----FTHY  439

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  440  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  499

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  500  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  548



>ref|XP_004297219.1| PREDICTED: fructokinase-like 2, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=554

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 146/223 (65%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M ST  +AI  +K+ GG++F+D+NLPLPLW+S +E
Sbjct  312  SEINMDVLKEAKMFYFNTHSLLDQNMRSTTLQAIKIAKQLGGVVFYDVNLPLPLWQSSEE  371

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEFL            +P   +E+F      R+ + H+ 
Sbjct  372  TKLFIQQVWNIADIIEVTKQELEFLC---------GVQP---SEEFDTKDNARSKFVHHR  419

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            RE +APLWH+ LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  420  REMIAPLWHENLKVLFVTNGTSKIHYYTKEHDGAVNGMEDPPISPFTSDMSASGDGIVAA  479

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP
Sbjct  480  LMRMLTVQPHLVTDREYLEHSIKYAIDCGVIDQWLLGRSRGFP  522



>gb|AAT81682.1| putative kinase [Oryza sativa Japonica Group]
Length=589

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 148/229 (65%), Gaps = 16/229 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  E
Sbjct  336  TDINPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  ++K AWE ADIIE+++ ELEFL            KP  ++  +D  +++    + HY
Sbjct  396  TKSLVKEAWEAADIIEITKQELEFLC---------GIKPSEKFGTKDNDKSK----FTHY  442

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  443  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  502

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  503  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  551



>gb|ABF97502.1| pfkB-type carbohydrate kinase family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=575

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 110/229 (48%), Positives = 148/229 (65%), Gaps = 16/229 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  E
Sbjct  322  TDINPAVLKEAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKE  381

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  ++K AWE ADIIE+++ ELEFL            KP  ++  +D  +++    + HY
Sbjct  382  TKSLVKEAWEAADIIEITKQELEFLC---------GIKPSEKFGTKDNDKSK----FTHY  428

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  429  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  488

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  489  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  537



>tpg|DAA50254.1| TPA: hypothetical protein ZEAMMB73_178722 [Zea mays]
Length=656

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/241 (47%), Positives = 149/241 (62%), Gaps = 15/241 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  E
Sbjct  403  SDINPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKE  462

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  +IK AWE A+IIEV++ ELEFL          + KP  ++   D  +++    + HY
Sbjct  463  TKSLIKEAWEAANIIEVTKQELEFLC---------SIKPSEKFDTNDNDKSK----FTHY  509

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E +  LWH  LK LFVT+GT ++HYYT +  G V GTED  ITPFT D + SGDA+VA
Sbjct  510  SSEVIMKLWHSNLKVLFVTNGTSKIHYYTETHNGWVRGTEDAPITPFTGDMSQSGDAIVA  569

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPS  39
             +MR L   P +  ++  L + ++ AI  G+I QW +   RGF  +       EQ  V S
Sbjct  570  ALMRMLVINPHLITDKVYLHKAVKHAIKCGVIDQWVLARERGFLPKERADPTSEQYEVKS  629

Query  38   M  36
            +
Sbjct  630  I  630



>emb|CDX95956.1| BnaA07g27750D [Brassica napus]
Length=608

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 144/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+E
Sbjct  336  SEINVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T  +I+  W+ AD+IEV++ ELEFL      + ++ K N   ++               H
Sbjct  396  TKSLIQEVWDLADVIEVTKQELEFLCGIEATEEFDTKNNDSSKFV--------------H  441

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +V
Sbjct  442  YEPETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIV  501

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  502  AGLIRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  546



>ref|XP_009105465.1| PREDICTED: uncharacterized protein LOC103831320 [Brassica rapa]
Length=617

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 144/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F +  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+SR+E
Sbjct  336  SEINVDVLKEAKMFYFTTHSLLDKKMMSTTLQAIKISKQLGNVIFYDLNLPLPLWQSREE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T  +I+  W+ AD+IEV++ ELEFL      + ++ K N   ++               H
Sbjct  396  TKSLIQEVWDLADVIEVTKQELEFLCGIEATEEFDTKNNDSSKFV--------------H  441

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E V PLWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +V
Sbjct  442  YEPETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIV  501

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  502  AGLIRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLLAQTRGYP  546



>ref|XP_010091598.1| hypothetical protein L484_026446 [Morus notabilis]
 gb|EXB44864.1| hypothetical protein L484_026446 [Morus notabilis]
Length=569

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 143/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA+IF+F++  L  P M ST  +AI  SKK GG+IF+D+NLPLPLW S +E
Sbjct  328  SEINIDVLKEAKIFYFSTHSLLDPNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWLSSEE  387

Query  572  TWEVIKGAWEQADIIEVSRSELEFL---LDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
                I+  W  ADIIEV++ ELEFL   +  + ++ K N K ++               H
Sbjct  388  AKSFIQQVWNLADIIEVTKQELEFLCGIMPSEEFDTKNNDKVKFI--------------H  433

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E V PLWH+ LK LFVT+GT ++HYYT   +G V G ED  +TPFT D + SGD ++
Sbjct  434  YKPEVVEPLWHENLKVLFVTNGTSKIHYYTREHDGAVRGMEDPHLTPFTRDMSASGDGII  493

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            A ++R LT QP +  ++  LE  +++AI  G+I QW +G VRGFP
Sbjct  494  AALLRMLTVQPHLITDKGYLEHSIKYAIDCGVIDQWALGRVRGFP  538



>ref|XP_006437893.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
 gb|ESR51133.1| hypothetical protein CICLE_v10031077mg [Citrus clementina]
Length=575

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 152/235 (65%), Gaps = 16/235 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +E
Sbjct  334  SEINIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  394  TKMFIQQAWNLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFVHYE  441

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAG
Sbjct  442  PEVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAG  501

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            IMR LT QP +  ++  L R +++AI  G+  QW+     G+P +   + ++E+V
Sbjct  502  IMRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPK---EGMEEEV  553



>gb|KDO70321.1| hypothetical protein CISIN_1g0081612mg [Citrus sinensis]
Length=575

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 147/229 (64%), Gaps = 13/229 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +E
Sbjct  334  SEINIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  394  TKMFIQQAWTLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFVHYE  441

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAG
Sbjct  442  PEVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAG  501

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            IMR LT QP +  ++  L R +++AI  G+  QW+     G+P +   +
Sbjct  502  IMRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPKGGME  550



>gb|EEC75710.1| hypothetical protein OsI_12536 [Oryza sativa Indica Group]
Length=586

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/229 (48%), Positives = 147/229 (64%), Gaps = 16/229 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +++N AVLKEA++F++NS  L  P   S+L KAI  SKKFGG+ FFDLNLPLPLW S  E
Sbjct  333  TDINPAVLKEAKMFYYNSSALLEPATRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKE  392

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKP--QYFAEDFQQTRKIRNYYHY  399
            T  ++K AWE ADIIE+++ ELEFL            KP  ++  +D  +++    + HY
Sbjct  393  TKSLVKEAWEAADIIEITKQELEFLC---------GIKPSEKFGTKDNDKSK----FTHY  439

Query  398  SREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
            S E V  LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VA
Sbjct  440  SPEVVTKLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVA  499

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
             +M+ L   P +  ++D L   ++ AI+ G+I QW +   RGF P E A
Sbjct  500  ALMKMLAINPHLVTDKDYLHTAMKHAITCGVIDQWLLARERGFLPRERA  548



>ref|XP_008665080.1| PREDICTED: uncharacterized protein LOC103643674 [Zea mays]
Length=730

 Score =   215 bits (548),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/240 (48%), Positives = 148/240 (62%), Gaps = 13/240 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N AVLKEA++F++NS  L  PT  S+L KAI  SKKFGG IFFDLNLPLPLW S  E
Sbjct  477  SDINPAVLKEAKMFYYNSSALLEPTTESSLLKAIDVSKKFGGTIFFDLNLPLPLWSSSKE  536

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T  +IK AWE A+IIEV++ ELEFL          + KP   +E F      ++ + HYS
Sbjct  537  TKSLIKEAWEAANIIEVTKQELEFLC---------SIKP---SEKFDTNDNDKSKFTHYS  584

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +  LWH  LK LFVT+GT ++HYYT +  G V GTED  ITPFT D + SGDA+VA 
Sbjct  585  SEVIMKLWHSNLKVLFVTNGTSKIHYYTETHNGWVRGTEDAPITPFTGDMSQSGDAIVAA  644

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSM  36
            +MR L   P +  ++  L + ++ AI  G+I QW +   RGF  +       EQ  V S+
Sbjct  645  LMRMLVINPHLITDKVYLHKAVKHAIKCGVIDQWVLARERGFLPKERADPTSEQYEVKSI  704



>ref|XP_006650283.1| PREDICTED: uncharacterized protein LOC102700038 [Oryza brachyantha]
Length=584

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 144/230 (63%), Gaps = 18/230 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  E
Sbjct  331  SDINPTVLKEAKMFYYNSSALLEPTTQSSLLKAIEVSKKFGGVTFFDLNLPLPLWSSSKE  390

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T  ++K AWE ADIIE+++ ELEFL      + ++ K N K +              + H
Sbjct  391  TKSLVKEAWEAADIIEITKQELEFLCGIKPSEKFDTKDNDKSK--------------FTH  436

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            YS E V  LWH+ L+ LFVT+GT ++HYYT    G V GTED  ITPFT D + SGDA+V
Sbjct  437  YSPEVVMKLWHENLQVLFVTNGTSKIHYYTKEHNGWVRGTEDAPITPFTSDMSQSGDAIV  496

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF-PTESA  75
            A +M+ LT  P +  ++  L   ++ AI+ G+I QW +   RGF P E A
Sbjct  497  AALMKMLTINPHLVTDKVYLHDAIKHAITCGVIDQWLLARERGFLPREQA  546



>gb|AAF27059.1|AC008262_8 F4N2.16 [Arabidopsis thaliana]
Length=568

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 140/223 (63%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +E
Sbjct  288  SEINVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEE  347

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  AD+IE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  348  TKSFIQEVWNLADVIEITKQELEFLC---------GIEP---TEEFDTENNDISKFVHYP  395

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG
Sbjct  396  PETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAG  455

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  456  LIRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  498



>gb|ADI87422.1| fructokinase-like protein 2 [Nicotiana benthamiana]
Length=624

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 148/230 (64%), Gaps = 13/230 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  +  P M  T  +A   SKK GG++F+D+NLP PLW+S D+
Sbjct  383  SEININVLKEAKMFYFNTFSMLDPNMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDK  442

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
                I+ AW+ ADIIEV++ ELEFL            KP   +E F      R+ + HY 
Sbjct  443  AKTFIQQAWDLADIIEVTKQELEFLC---------GIKP---SERFDTKDNDRSKFTHYP  490

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV +TP+T D + SG+ ++AG
Sbjct  491  PEVIAPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGLEDVPLTPYTSDMSASGEGIIAG  550

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            I+R LT QP +  ++  LER L++AIS G++ QW +    G+PT+   ++
Sbjct  551  IIRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLLARRLGYPTKEGMED  600



>ref|XP_006484232.1| PREDICTED: uncharacterized protein LOC102617588 [Citrus sinensis]
Length=575

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 152/235 (65%), Gaps = 16/235 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +E
Sbjct  334  SEINIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      ++ + HY 
Sbjct  394  TKMFIQQAWTLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNAQSKFVHYE  441

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VAG
Sbjct  442  PEVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVAG  501

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            IMR LT QP +  ++  L R +++AI  G+  QW+     G+P +   + ++E+V
Sbjct  502  IMRMLTVQPHLITDKGYLVRTIKYAIDCGVRDQWSQARTLGYPPK---EGMEEEV  553



>ref|XP_010044389.1| PREDICTED: uncharacterized protein LOC104433370 [Eucalyptus grandis]
 gb|KCW86476.1| hypothetical protein EUGRSUZ_B03142 [Eucalyptus grandis]
Length=564

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 142/225 (63%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N+ VLKEA++ + N+  L    M ST  +AI  SK+FGGLIF+D+NLPLPLW S +E
Sbjct  324  SDINVDVLKEAKMLYINTHSLLERNMRSTALQAIKISKRFGGLIFYDVNLPLPLWHSAEE  383

Query  572  TWEVIKGAWEQADIIEVSRSELEFL---LDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+  WE AD IEV++ ELEFL   +  + ++ K N K ++               H
Sbjct  384  TKAFIQQVWELADFIEVTKQELEFLCGIVPSEEFDTKNNSKSKFI--------------H  429

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  + +APLWHD LK LFVT+GT ++HYYT    G V G ED  ITPF+ D + SGD +V
Sbjct  430  YEPDIIAPLWHDNLKVLFVTNGTSKIHYYTKEHNGAVHGMEDPPITPFSRDMSASGDGIV  489

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP++  ++D LE  +++AI  G+I QW +    GFP
Sbjct  490  AGLVRMLTVQPDLHTDRDYLEHSIKYAIDCGVIDQWAVSRTHGFP  534



>ref|XP_007222920.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24119.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=555

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 148/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +E
Sbjct  315  SEINIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWHSCEE  374

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEF+            +P   +E+F      R+ + H++
Sbjct  375  TKLFIQQVWNLADIIEVTKQELEFIC---------GIQP---SEEFDTKNNDRSKFVHHT  422

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAP+WH+ LK LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VA 
Sbjct  423  PEVVAPVWHENLKVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAA  482

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP +  T+ +
Sbjct  483  LMRMLTVQPHLITDKEYLEHTIKYAIDCGVIDQWLLGRERGFPPKEDTEEV  533



>ref|XP_011018828.1| PREDICTED: fructokinase-like 2, chloroplastic [Populus euphratica]
Length=607

 Score =   211 bits (536),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 144/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ VLK+A++F+FN+  L   +M ST  +AI  SKK G ++F+D+NLPLPLW+S +E
Sbjct  328  SELNIDVLKQAKMFYFNTHSLLDRSMRSTALRAIKVSKKLGAVVFYDVNLPLPLWQSSEE  387

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+ AW  AD++EV++ ELEFL     ++ Y  + N K ++               H
Sbjct  388  TKLFIQEAWNLADVVEVTKQELEFLCGIEPDEEYNTRNNAKSKFV--------------H  433

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E VAPLWH+ L+ LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD + 
Sbjct  434  YGPEVVAPLWHENLEVLFVTNGTSKIHYYTREHNGAVHGMEDPPITPFTRDMSASGDGIT  493

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP +  +++ LE  +++AI  G+I QW +G  RGFP
Sbjct  494  AGLLRMLTVQPALVTDKEYLESTIKYAIDCGVIDQWLLGRTRGFP  538



>gb|KJB50552.1| hypothetical protein B456_008G176200 [Gossypium raimondii]
Length=587

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 142/229 (62%), Gaps = 13/229 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M  T  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  316  SEINIDVLKEAKMFYFNTHSLLDRNMRLTTLRAIKMSKKLGGVIFYDVNLPLPLWQSDEE  375

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+ AW  AD IEV++ ELEFL            KP    E+F  +      + HY 
Sbjct  376  TKMFIQEAWNLADFIEVTKQELEFLC---------RIKP---TEEFDTKNNASSKFIHYD  423

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ LK LFVT+GT ++HYYT    G V G ED  +TPF+ D + SGD +VAG
Sbjct  424  HEVVAPLWHENLKTLFVTNGTSKIHYYTKEQNGAVNGMEDAPLTPFSRDMSASGDGIVAG  483

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            ++R L+ QP++  +   LE  +++AI  G+I QW +   RGFP +   Q
Sbjct  484  LLRMLSVQPDLISDTGYLEHTIKYAIDCGVIDQWIVSRTRGFPPKEGIQ  532



>ref|XP_007153496.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
 gb|ESW25490.1| hypothetical protein PHAVU_003G040700g [Phaseolus vulgaris]
Length=578

 Score =   210 bits (535),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 144/225 (64%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELN+ VLKEA++F+FN+  L    M ST  +AI  SK FGG++F+DLNLP+PLW SR+E
Sbjct  337  TELNIDVLKEAKLFYFNTHSLLDRNMRSTTLQAIKISKHFGGVVFYDLNLPMPLWHSREE  396

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
                I+  W  ADIIEV++ ELEFL      + ++ K N   ++               H
Sbjct  397  AILFIQRFWNLADIIEVTKQELEFLCGITPSEEFDTKNNDSSKFV--------------H  442

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E VAPLWH+ LK LFVT+GT ++HYYT   +G V+G ED  ITPFT D + +GD +V
Sbjct  443  YEPEVVAPLWHENLKVLFVTNGTSKIHYYTKELDGAVLGMEDAPITPFTSDMSATGDGIV  502

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            A ++RKL+ + ++  ++  LE  +++AI+ G+I QW  G VRGFP
Sbjct  503  AALLRKLSVELDLITDKGYLEHSIKYAINCGVIDQWIQGRVRGFP  547



>emb|CDP00452.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   209 bits (533),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 147/232 (63%), Gaps = 17/232 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M ST  +AI  SKK GG++F+DLNLPLPLW+S +E
Sbjct  331  SEINIDVLKEAKMFYFNTFSLLDWKMRSTALQAIKISKKLGGIVFYDLNLPLPLWQSGEE  390

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+ AW  AD+IEV++ ELEFL      + ++ K N + ++               H
Sbjct  391  TKTFIQKAWALADVIEVTKEELEFLCGIKASEEFDTKNNDRSKF--------------TH  436

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y+ E VAPLWH+ LK LFVT+GT ++HYYT    G V+G ED  +TP+T D + SGD +V
Sbjct  437  YAPEVVAPLWHENLKVLFVTNGTSKIHYYTKEHNGSVLGMEDGPLTPYTSDMSASGDGIV  496

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            AGI+R LT QP +  ++  LE  +++AIS G+I QW      G+P +   ++
Sbjct  497  AGILRMLTVQPHLLTDKGYLEHTIKYAISCGVIDQWLQARKLGYPAKEGMED  548



>ref|NP_177080.2| fructokinase-like 2 [Arabidopsis thaliana]
 gb|AEE34893.1| fructokinase-like 2 [Arabidopsis thaliana]
Length=616

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 140/223 (63%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +E
Sbjct  336  SEINVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEE  395

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  AD+IE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  396  TKSFIQEVWNLADVIEITKQELEFLC---------GIEP---TEEFDTENNDISKFVHYP  443

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG
Sbjct  444  PETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAG  503

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  504  LIRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  546



>sp|F4I0K2.2|SCKL2_ARATH RecName: Full=Fructokinase-like 2, chloroplastic; AltName: Full=pfkB-type 
carbohydrate kinase family protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52502.1|AC018364_20 putative fructokinase; 80884-78543 [Arabidopsis thaliana]
Length=614

 Score =   210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 140/223 (63%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW S +E
Sbjct  334  SEINVDVLKEAKMFYFSTHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWHSSEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  AD+IE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  394  TKSFIQEVWNLADVIEITKQELEFLC---------GIEP---TEEFDTENNDISKFVHYP  441

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G EDV ITPFT D + SGD +VAG
Sbjct  442  PETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDVPITPFTRDMSASGDGIVAG  501

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  GII QW +   RG+P
Sbjct  502  LIRMLTVQPDLMNNKGYLERTARYAIECGIIDQWLLAQTRGYP  544



>ref|XP_008243824.1| PREDICTED: uncharacterized protein LOC103342040 [Prunus mume]
Length=555

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 147/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N+ VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +E
Sbjct  315  SDINIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKLSKKLGGVIFYDVNLPLPLWHSCEE  374

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEF+            +P   +E+F      R+ + H++
Sbjct  375  TKLFIQQVWNLADIIEVTKQELEFIC---------GIQP---SEEFDTKNNDRSKFVHHT  422

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAPLWH+ L  LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VA 
Sbjct  423  PEVVAPLWHENLNVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAA  482

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +MR LT QP +  +++ LE  +++AI  G+I QW +G  RGFP +  T+ +
Sbjct  483  LMRMLTVQPHLITDKEYLEHTIKYAIDCGVIDQWLLGRERGFPPKEDTEEV  533



>ref|XP_008389397.1| PREDICTED: probable fructokinase-1 isoform X1 [Malus domestica]
Length=559

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 143/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  317  SEINVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEE  376

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   ++  W  ADIIEV++ ELEFL            +P   +E+F      R+ + H+S
Sbjct  377  TKLFVQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTKNNDRSKFVHHS  424

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  425  PEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDGIVAA  484

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  485  LMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  527



>ref|XP_008389398.1| PREDICTED: probable fructokinase-1 isoform X2 [Malus domestica]
Length=556

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 143/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  314  SEINVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEE  373

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   ++  W  ADIIEV++ ELEFL            +P   +E+F      R+ + H+S
Sbjct  374  TKLFVQQVWNLADIIEVTKQELEFLC---------GIQP---SEEFDTKNNDRSKFVHHS  421

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  422  PEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDGIVAA  481

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  482  LMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  524



>ref|XP_009356432.1| PREDICTED: probable fructokinase-4 isoform X1 [Pyrus x bretschneideri]
Length=561

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  319  SEINVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEE  378

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W   DIIEV++ ELEFL            +P   +E+F      R+ + H+S
Sbjct  379  TKLFIQQVWNLGDIIEVTKQELEFLC---------GIQP---SEEFDTKNNDRSKFVHHS  426

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  427  PEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDGIVAA  486

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  487  LMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  529



>ref|XP_009356434.1| PREDICTED: probable fructokinase-4 isoform X2 [Pyrus x bretschneideri]
Length=559

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  317  SEINVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEE  376

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W   DIIEV++ ELEFL            +P   +E+F      R+ + H+S
Sbjct  377  TKLFIQQVWNLGDIIEVTKQELEFLC---------GIQP---SEEFDTKNNDRSKFVHHS  424

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  425  PEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDGIVAA  484

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  485  LMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  527



>ref|XP_009356435.1| PREDICTED: probable fructokinase-4 isoform X3 [Pyrus x bretschneideri]
Length=558

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 142/223 (64%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK GG+IF+D+NLPLPLW+S +E
Sbjct  316  SEINVDVLKEAKMFYFSTNSLLDRNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWQSCEE  375

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W   DIIEV++ ELEFL            +P   +E+F      R+ + H+S
Sbjct  376  TKLFIQQVWNLGDIIEVTKQELEFLC---------GIQP---SEEFDTKNNDRSKFVHHS  423

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWHD LK LFVT+GT ++HYYT   +G V G ED  I+PFT D + SGD +VA 
Sbjct  424  PEVVEQLWHDNLKVLFVTNGTSKIHYYTKDHQGAVNGMEDPPISPFTSDMSASGDGIVAA  483

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +MR LT QP +  +++ LE  + +AI  G+I QW +G  RGFP
Sbjct  484  LMRMLTVQPHLITDKEYLEHSINYAIDCGVIDQWLLGQERGFP  526



>ref|XP_008777340.1| PREDICTED: putative fructokinase-5 [Phoenix dactylifera]
Length=559

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 147/224 (66%), Gaps = 11/224 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FNS  L +  + ST  +AI  SKKFGG+IFFDLNLPLPLWKS +E
Sbjct  324  SEINIDVLKEAKMFYFNSSSLLNQNLRSTAMQAIKISKKFGGVIFFDLNLPLPLWKSSEE  383

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T   I+ AW  A+IIEV++ ELEFL   +  E       ++  +D  +++    + H+  
Sbjct  384  TKTFIQEAWNIANIIEVTKQELEFLCGIEPSE-------KFDTKDNDKSK----FIHHKP  432

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWH+ LK LFVT+GT ++HYYT   +G V G ED  ITPFT D + SGDA+VA +
Sbjct  433  EVVMQLWHENLKVLFVTNGTSKIHYYTKKDDGCVHGMEDPPITPFTGDMSISGDAIVAAL  492

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTE  81
            +R LT QP +  ++  LE  +++AI+ G+I QW    V GFP +
Sbjct  493  IRMLTVQPHLATDKGYLEHMIKYAINCGVIDQWLHARVCGFPAK  536



>ref|XP_009786224.1| PREDICTED: uncharacterized protein LOC104234369 [Nicotiana sylvestris]
Length=648

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 146/230 (63%), Gaps = 13/230 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+D+NLP PLW+S D+
Sbjct  407  SEINIDVLKEAKMFYFNTFSLLDPHMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDK  466

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
                I+ AW+ ADIIEV++ ELEFL            KP   +E F      R+ + HY 
Sbjct  467  AKTFIQQAWDLADIIEVTKQELEFLC---------GIKP---SERFDTKDNDRSKFTHYP  514

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV +TP+T D + SGD ++AG
Sbjct  515  PEVIAPLWHENLKVLFVTNGTSKIHYYTKEHHGAVLGLEDVPLTPYTSDMSASGDGIIAG  574

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            I+R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  575  IIRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  624



>ref|XP_011075683.1| PREDICTED: fructokinase-like 2, chloroplastic [Sesamum indicum]
Length=570

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 146/231 (63%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L    M ST  +A+  +K+ G ++F+DLNLPLPLW+S +E
Sbjct  330  SEINIDVLKEAKMFYFNTFSLLDRNMRSTTLQAVKIAKRLGNVVFYDLNLPLPLWQSSEE  389

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T   I+ AW  +DIIEV++ ELEFL             P   +E+F      R+ + HY+
Sbjct  390  TKMFIQKAWNLSDIIEVTKQELEFLC---------GITP---SENFDTRDNDRSKFTHYA  437

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V+ LWHD LK LFVT+GT ++HYYT    G V G ED  +TP+T D + SGD +VAG
Sbjct  438  PEVVSQLWHDDLKVLFVTNGTSKIHYYTKEHNGAVHGMEDAALTPYTSDMSASGDGIVAG  497

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            IMR LT QP +  ++  LER +++AIS G+I QW      GFP +   +++
Sbjct  498  IMRMLTLQPHLISDKGYLERTVKYAISCGVIDQWLQARSLGFPAKEGMEDV  548



>ref|XP_010511945.1| PREDICTED: fructokinase-like 2, chloroplastic [Camelina sativa]
Length=621

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  341  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEE  400

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  401  TKSFIQEVWNLADIIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFVHYP  448

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  449  LETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTGDMSASGDGIVAG  508

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  509  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  551



>ref|XP_002887225.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63484.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=612

 Score =   207 bits (528),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 140/223 (63%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  333  SEINVDVLKEAKLFYFSTHSLLDKKMMSTTIQAIKISKQLGTVIFYDLNLPLPLWQSSEE  392

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W+ ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  393  TKSFIQEVWDLADIIEITKQELEFLC---------GIEP---TEEFDTENNDISKFVHYP  440

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  441  PETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDAPITPFTRDMSASGDGIVAG  500

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  501  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  543



>ref|XP_010415548.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010415551.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=624

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  344  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEE  403

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  404  TKSFIQEVWNLADIIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFVHYP  451

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  452  LETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAG  511

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  512  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  554



>ref|XP_010415552.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X3 [Camelina 
sativa]
Length=620

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  340  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEE  399

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  400  TKSFIQEVWNLADIIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFVHYP  447

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  448  LETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAG  507

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  508  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  550



>ref|XP_010470895.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X2 [Camelina 
sativa]
Length=619

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  339  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEE  398

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  399  TKSFIQEVWNLADIIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFVHYP  446

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  447  LETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAG  506

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  507  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  549



>ref|XP_010470894.1| PREDICTED: fructokinase-like 2, chloroplastic isoform X1 [Camelina 
sativa]
Length=623

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G +IF+DLNLPLPLW+S +E
Sbjct  343  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNVIFYDLNLPLPLWQSSEE  402

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  ADIIE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  403  TKSFIQEVWNLADIIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFVHYP  450

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  451  LETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAG  510

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  N+  LER  R+AI  G++ QW     RG+P
Sbjct  511  LIRMLTVQPDLMNNKGYLERTARYAIECGVVDQWLQAQTRGYP  553



>ref|XP_009628355.1| PREDICTED: uncharacterized protein LOC104118730 [Nicotiana tomentosiformis]
Length=648

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 145/230 (63%), Gaps = 13/230 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  +  P M  T  +A   SKK GG++F+D+NLP PLW+S D+
Sbjct  407  SEINIDVLKEAKMFYFNTFSMLDPNMRLTTLRATKISKKLGGVVFYDVNLPFPLWESGDK  466

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
                I+ AW+ ADIIEV++ ELEFL            KP   +E F      R+ + HY 
Sbjct  467  AKTFIQQAWDLADIIEVTKQELEFLC---------GIKP---SERFDTKDNDRSKFTHYP  514

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E +APLWH+ LK LFVT+GT ++HYYT      V+G EDV +TP+T D + SGD ++AG
Sbjct  515  PEVIAPLWHENLKVLFVTNGTSKIHYYTKEHNSAVLGLEDVPLTPYTSDMSASGDGIIAG  574

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            I+R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  575  IIRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  624



>gb|EMS49265.1| hypothetical protein TRIUR3_05313 [Triticum urartu]
Length=507

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 135/221 (61%), Gaps = 12/221 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N  VLKEA++F++NS  L  PT  ++L KAI  SKKFGG+ FFDLNLP+PLW S  E
Sbjct  255  SDINPDVLKEAKMFYYNSSALLEPTTRTSLLKAIEVSKKFGGITFFDLNLPMPLWSSSKE  314

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWE ADIIEV++ ELEFL            KP   ++   +  +   + HYS 
Sbjct  315  TKSLIKEAWEAADIIEVTKQELEFLC---------GIKPSANSDTKDEKSE---FAHYSP  362

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  +WHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A +
Sbjct  363  EVVMKIWHDNLKVLFVTNGTSKIHYYTEKHNGSVRGTEDAPITPFTSEMSQSGDTIAAAL  422

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  90
            M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  423  MNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  463



>ref|XP_006301975.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
 gb|EOA34873.1| hypothetical protein CARUB_v10022455mg [Capsella rubella]
Length=618

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/223 (46%), Positives = 139/223 (62%), Gaps = 13/223 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F+S  L    M ST  +AI  SK+ G ++FFDLNLPLPLW+S +E
Sbjct  339  SEINVDVLKEAKMFYFSSHSLLDKKMMSTTIQAIKISKQLGNIVFFDLNLPLPLWQSSEE  398

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQ-QTRKIRNYYHYS  396
            T   I+  W  AD+IE+++ ELEFL            +P    E+F  +   I  + HY 
Sbjct  399  TKSFIQEVWNLADVIEITKQELEFLC---------GIEP---TEEFDTKNNDISKFAHYP  446

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGD +VAG
Sbjct  447  PETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVSGMEDPPITPFTRDMSASGDGIVAG  506

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            ++R LT QP++  ++  LER  R+AI  G++ QW     RG+P
Sbjct  507  LIRMLTVQPDLMNDKGYLERTARYAIECGVVDQWLQAQTRGYP  549



>ref|XP_006348670.1| PREDICTED: uncharacterized protein LOC102589995 [Solanum tuberosum]
Length=650

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 147/229 (64%), Gaps = 11/229 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+DLNLP PLW+S ++
Sbjct  409  SEINIDVLKEAKMFYFNTFSLLDPNMRLTTLRATKISKKLGGVVFYDLNLPSPLWESGEK  468

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                I+ AW  ADIIEV++ ELEFL   +  E       ++  +D  +++    + HY  
Sbjct  469  AKTFIQKAWNLADIIEVTKQELEFLCGIEPSE-------KFDTKDNDRSK----FTHYPP  517

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E +APLWH+ LK LFVT+GT ++HYYT    G V+G EDV ++P+T D + SGD ++AGI
Sbjct  518  EVIAPLWHENLKILFVTNGTSKIHYYTKEHNGSVLGLEDVPLSPYTSDMSASGDGIIAGI  577

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  578  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  626



>ref|XP_010680662.1| PREDICTED: fructokinase-like 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=577

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 147/240 (61%), Gaps = 13/240 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N+ VLKEA++F+ N+  L   +M     +A+  SKK GG+IF+DLNLPL LW+S +E
Sbjct  331  SDINIDVLKEAKMFYLNTSSLLDASMRRATLRALKISKKLGGVIFYDLNLPLSLWQSDEE  390

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T   I+  W  AD+IEV++ ELEF+            KP    E+F      R+ + HY 
Sbjct  391  TKSFIEQVWSLADVIEVTKQELEFIC---------GIKP---LEEFDTKNNKRSKFEHYE  438

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             + +APLWH+ LK LFVT+GT ++HYYT    G V+G ED  ++PFT D + SGD +VA 
Sbjct  439  PDIIAPLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGVEDAPMSPFTQDMSASGDGIVAA  498

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSM  36
            +MR LT QP +  +++ LER +++AI+ G+I QW +    GFP +   +   E   +P +
Sbjct  499  LMRMLTVQPHLITDKEYLERAVKYAINCGVIDQWIVTRQNGFPAKEGLEEEDEDEGIPDL  558



>gb|EMS47290.1| hypothetical protein TRIUR3_20910 [Triticum urartu]
Length=540

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 134/221 (61%), Gaps = 12/221 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N  VLKEA++F++NS  L  PT  ++L KAI  SKKF G+ FFDLNLP+PLW S  E
Sbjct  288  SDINPDVLKEAKMFYYNSSALLEPTTRTSLLKAIEVSKKFSGITFFDLNLPMPLWSSSKE  347

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWE ADIIEV++ ELEFL            KP   +E+     +   + HYS 
Sbjct  348  TKSLIKEAWEAADIIEVTKQELEFLC---------GIKP---SENSDTKDEKSEFAHYSP  395

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A +
Sbjct  396  EVVMKLWHDNLKVLFVTNGTSKIHYYTEKHNGSVRGTEDAPITPFTSEMSQSGDTIAAAL  455

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  90
            M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  456  MNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  496



>ref|XP_004239035.1| PREDICTED: fructokinase-like 2, chloroplastic [Solanum lycopersicum]
Length=645

 Score =   205 bits (522),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 147/229 (64%), Gaps = 11/229 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FN+  L  P M  T  +A   SKK GG++F+DLNLP PLW+S ++
Sbjct  404  SEINIDVLKEAKMFYFNTFSLLDPNMRLTTLRATKISKKLGGVVFYDLNLPSPLWESGEK  463

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                I+ AW  ADIIEV++ ELEFL   +  E       ++  +D  +++    + HY  
Sbjct  464  AKTFIQKAWNLADIIEVTKQELEFLCGIEPSE-------KFDTKDNDRSK----FTHYPP  512

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E +APLWH+ LK LF+T+GT ++HYYT    G V+G EDV ++P+T D + SGD ++AGI
Sbjct  513  EVIAPLWHENLKILFMTNGTSKIHYYTKEHNGSVLGLEDVPLSPYTSDMSASGDGIIAGI  572

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQN  66
            +R LT QP +  ++  LER L++AIS G++ QW      G+P +   ++
Sbjct  573  IRMLTVQPHLMTDKGYLERTLKYAISCGVVDQWLQARRLGYPPKEGMED  621



>gb|EYU28879.1| hypothetical protein MIMGU_mgv1a003579mg [Erythranthe guttata]
Length=576

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 147/231 (64%), Gaps = 13/231 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VL+EA++F+FN+  L      ST  +A+  SKK G L+F+DLNLPLPLW+S +E
Sbjct  335  SEINVDVLREAQMFYFNTFSLLDRNTRSTALQAVKISKKLGNLVFYDLNLPLPLWQSSEE  394

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYY-HYS  396
            T + I+ AW  +DIIEV++ ELEFL             P   +E+F      RN + HYS
Sbjct  395  TKKFIQSAWNLSDIIEVTKQELEFLC---------GIIP---SEEFDTRDNNRNKFTHYS  442

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E V+ LWH+ LK LFVT+GT ++HYYT  ++G V G ED  +TP+T D + +GD VVAG
Sbjct  443  PEIVSQLWHENLKILFVTNGTSKIHYYTKEYDGSVYGMEDAPLTPYTSDMSATGDGVVAG  502

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            IM+ LT QP +  ++  LER +++AI+ G+  QW      G+P +   +++
Sbjct  503  IMKMLTVQPHLLLDKGYLERTIKYAINCGVTDQWLQARKLGYPPKEGMEDV  553



>gb|EMT14724.1| hypothetical protein F775_09742 [Aegilops tauschii]
Length=774

 Score =   204 bits (518),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 135/221 (61%), Gaps = 12/221 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            S++N  VLKEA++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLP+PLW S  E
Sbjct  522  SDINPDVLKEAKMFYYNSSALLEPTTRSSLLKAIEVSKKFGGITFFDLNLPMPLWSSSKE  581

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T  +IK AWE ADIIEV++ ELEFL            KP   +E+     +   + HYS 
Sbjct  582  TKSLIKDAWEAADIIEVTKQELEFLC---------GIKP---SENSDTKDEKSEFAHYSP  629

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  +WHD LK LFVT+GT ++HYYT    G V GTED  ITPFT + + SGD + A +
Sbjct  630  EVVMKVWHDNLKVLFVTNGTSKIHYYTEKQNGSVRGTEDAPITPFTSEMSQSGDTIAAAL  689

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGF  90
            M  L+  P +  ++  L +  + AI  G+I QW     RGF
Sbjct  690  MNMLSINPHLVTDKVYLHKTAKHAIKCGVIDQWLAARERGF  730



>ref|XP_010937787.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-like 2, chloroplastic 
[Elaeis guineensis]
Length=559

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 143/222 (64%), Gaps = 11/222 (5%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+FNS  L + ++ ST  +AI  SKK GG+IFFDLNLPLPLWKS +E
Sbjct  324  SEINIDVLKEAKMFYFNSSSLLNQSLRSTAMQAIKISKKLGGVIFFDLNLPLPLWKSSEE  383

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
            T   I+  W  ADIIEV++ ELEFL   +  E       ++  +D  +++    + H+  
Sbjct  384  TKAFIQEVWNIADIIEVTKQELEFLCGMEPSE-------KFDTKDNDKSK----FIHHKP  432

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWH+ LK LFVT+GT ++HYYT    G V G ED  ITPFT D + SGDA++A +
Sbjct  433  EVVMQLWHENLKVLFVTNGTSKIHYYTQKDNGWVHGMEDPPITPFTGDMSISGDAIIAAL  492

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            +R LT QP +  ++  LE  +++AI+ G+I QW      GFP
Sbjct  493  IRMLTVQPHLATDKGYLEHMIKYAINCGVIDQWLHARECGFP  534



>gb|KFK41343.1| hypothetical protein AALP_AA2G117900 [Arabis alpina]
Length=615

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 141/225 (63%), Gaps = 17/225 (8%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  L    M ST  +AI  SKK G ++F+D+NLPLPLW+S +E
Sbjct  334  SEINVDVLKEAKMFYFSTHSLLDKKMMSTTLQAIKISKKLGNVVFYDVNLPLPLWQSGEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFL---LDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYH  402
            T   I+   + AD+IEV++ ELEFL   +  + ++ K N   ++               H
Sbjct  394  TKSFIQEVCDLADVIEVTKQELEFLCGIVPTEEFDTKNNDSSKFV--------------H  439

Query  401  YSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVV  222
            Y  E V  LWH+ LK LFVT+GT ++HYYT    G V+G EDV ITPFT D + SGD +V
Sbjct  440  YPPETVEQLWHENLKVLFVTNGTSKIHYYTKEHNGAVLGMEDVPITPFTRDMSASGDGIV  499

Query  221  AGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            AG++R LT QP++  ++  LE   R+AI  G++ QW +   RG+P
Sbjct  500  AGLIRMLTVQPDLINDKGYLEHTARYAIECGVVDQWLLAQTRGYP  544



>ref|NP_001050625.2| Os03g0602600 [Oryza sativa Japonica Group]
 dbj|BAF12539.2| Os03g0602600 [Oryza sativa Japonica Group]
Length=216

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 11/175 (6%)
 Frame = -1

Query  740  LAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEV  561
              +L +A++F++NS  L  PT  S+L KAI  SKKFGG+ FFDLNLPLPLW S  ET  +
Sbjct  35   FCLLMQAKMFYYNSSALLEPTTRSSLSKAIEVSKKFGGVTFFDLNLPLPLWSSSKETKSL  94

Query  560  IKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVA  381
            +K AWE ADIIE+++ ELEFL      E       ++  +D  +++    + HYS E V 
Sbjct  95   VKEAWEAADIIEITKQELEFLCGIKPSE-------KFGTKDNDKSK----FTHYSPEVVT  143

Query  380  PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             LWH+ LK LFVT+GT ++HYYT   +G V GTED  ITPFT D + SGDA+VAG
Sbjct  144  KLWHENLKVLFVTNGTSKIHYYTKEHDGWVRGTEDAPITPFTGDMSQSGDAIVAG  198



>gb|KDO58032.1| hypothetical protein CISIN_1g040065mg, partial [Citrus sinensis]
Length=82

 Score =   164 bits (415),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 75/82 (91%), Positives = 80/82 (98%), Gaps = 0/82 (0%)
 Frame = -1

Query  278  DVLITPFTCDRTGSGDAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAV  99
            DVLITPFTCDRTGSGDAVVA I+RKLTT PEMFENQDVL+RQLRFA++AGII+QWTIGAV
Sbjct  1    DVLITPFTCDRTGSGDAVVAAILRKLTTCPEMFENQDVLQRQLRFAVAAGIIAQWTIGAV  60

Query  98   RGFPTESATQNLKEQVYVPSMW  33
            RGFPTESATQNLKEQVYVPSMW
Sbjct  61   RGFPTESATQNLKEQVYVPSMW  82



>gb|KDO70322.1| hypothetical protein CISIN_1g0081612mg, partial [Citrus sinensis]
Length=500

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 119/179 (66%), Gaps = 13/179 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SK+FGG+IF+D+NLPLPLW+S +E
Sbjct  334  SEINIDVLKEAKMFYFSTHSMLERNMKSTTLQAIKISKQFGGIIFYDVNLPLPLWQSGEE  393

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+ AW  AD+IEV++ ELEFL            KP    E+F      R+ + HY 
Sbjct  394  TKMFIQQAWTLADVIEVTKQELEFLC---------GIKP---TEEFDTKNNARSKFVHYE  441

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVA  219
             E +APLWH+ LK LFVT+GT ++HYYT   +G V+GTED  +TPFT D + SGD +VA
Sbjct  442  PEVIAPLWHENLKVLFVTNGTSKVHYYTKEDDGAVLGTEDAPLTPFTSDMSASGDGIVA  500



>ref|XP_007222921.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
 gb|EMJ24120.1| hypothetical protein PRUPE_ppa003690mg [Prunus persica]
Length=485

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 13/182 (7%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA++F+F++  +    M ST  +AI  SKK GG+IF+D+NLPLPLW S +E
Sbjct  315  SEINIDVLKEAKMFYFSTHSMLDQNMRSTTLQAIKISKKLGGVIFYDVNLPLPLWHSCEE  374

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRN-YYHYS  396
            T   I+  W  ADIIEV++ ELEF+            +P   +E+F      R+ + H++
Sbjct  375  TKLFIQQVWNLADIIEVTKQELEFIC---------GIQP---SEEFDTKNNDRSKFVHHT  422

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
             E VAP+WH+ LK LFVT+GT ++HYYT    G + G ED  ITPFT D + SGD +VAG
Sbjct  423  PEVVAPVWHENLKVLFVTNGTSKIHYYTKEHHGAINGMEDPPITPFTSDMSASGDGIVAG  482

Query  215  IM  210
             +
Sbjct  483  TL  484



>gb|EPS69174.1| hypothetical protein M569_05592, partial [Genlisea aurea]
Length=374

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SE+N+ VLKEA +F+FNS  L   TM STLF+AI  +KK G LIF+D N+PLPLW S +E
Sbjct  207  SEINIDVLKEAEMFYFNSCCLLDRTMRSTLFRAIRIAKKLGNLIFYDPNIPLPLWLSSEE  266

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                ++ AW  +D+IEV++ ELE L      E       ++   D   ++    + HY  
Sbjct  267  AKMFVRTAWRLSDVIEVTKQELELLSGITPSE-------KFDTRDNDSSK----FIHYPP  315

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            E V+ LWHD LK LFVT+GT ++HYYT  F G V G+ED L+TP+T   + SGD +VAG
Sbjct  316  ELVSQLWHDDLKVLFVTNGTSKVHYYTKEFNGFVHGSEDALLTPYTAQMSASGDGMVAG  374



>ref|XP_006391043.1| hypothetical protein EUTSA_v100183771mg, partial [Eutrema salsugineum]
 gb|ESQ28329.1| hypothetical protein EUTSA_v100183771mg, partial [Eutrema salsugineum]
Length=225

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 101/169 (60%), Gaps = 17/169 (10%)
 Frame = -1

Query  584  SRDETWEVIKGAWEQADIIEVSRSELEFLLD---EDHYEHKRNYKPQYFAEDFQQTRKIR  414
            S +ET   I+  W+ AD+IEV++ ELEFL      + ++ K N   ++            
Sbjct  1    SSEETKSFIQEVWDLADVIEVTKQELEFLCGIEPTEAFDTKNNDSSKFV-----------  49

Query  413  NYYHYSREEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSG  234
               HY+ E V PLWH+ LK LFVT+GT ++HYYT    G V+G ED  ITPFT D + SG
Sbjct  50   ---HYAPETVEPLWHENLKVLFVTNGTSKIHYYTKEHNGSVLGMEDAPITPFTRDMSASG  106

Query  233  DAVVAGIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFP  87
            D +VAG++R LT QP++  ++  LER  R+AI  G++ QW +   RG+P
Sbjct  107  DGIVAGLIRMLTVQPDLISDKGYLERTARYAIECGVVDQWLLAQTRGYP  155



>ref|XP_008786156.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-2 [Phoenix dactylifera]
Length=215

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 110/185 (59%), Gaps = 13/185 (7%)
 Frame = -1

Query  737  AVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDETWEVI  558
             V   A++F+FNS      +M     +A+  SKKFGG IFFDLNLPLPLWKS +E    I
Sbjct  35   GVWNMAKMFYFNSS--XDQSMRLRTMQAVKISKKFGGAIFFDLNLPLPLWKSSEEPKTFI  92

Query  557  KGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSREEVAP  378
              AW  ADIIEV++ ELEFL   +  E       ++  +D+ +++    + HY  + +  
Sbjct  93   WEAWNAADIIEVTKQELEFLCGIEPLE-------KFDTKDYDKSK----FIHYKPKVLMQ  141

Query  377  LWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIMRKLT  198
            L H+ LK LFVT+GT ++HYYT    G +   ED  ITPFT D + SGD ++A ++R LT
Sbjct  142  LXHENLKVLFVTNGTSKVHYYTEKDNGCLHEMEDXRITPFTGDMSVSGDFIIAALLRMLT  201

Query  197  TQPEM  183
             QP +
Sbjct  202  VQPHL  206



>ref|XP_010313061.1| PREDICTED: probable fructokinase-5 [Solanum lycopersicum]
Length=325

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 117/230 (51%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L +  + S    A+  +K  G L+ +D N+ LPLW S + 
Sbjct  121  SELNLGLIKQAKIFHYGSISLITEPVRSAHMVAMKSAKDAGVLLSYDPNVRLPLWPSPEA  180

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E IK  W +AD I+VS  E+ FL  +D  +                            
Sbjct  181  AREGIKSIWNEADFIKVSDDEVNFLTQKDADKE---------------------------  213

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E +  LWHDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETIMSLWHDRLKLLVVTDGEKGCRYFTKSFKGKVSG-----FSVKTVDTTGAGDAFVGSL  268

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +   P +F++++ L++ L+F+ + G IS    GA+   P+ +  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALKFSNACGAISTTQKGAIPALPSTADAQGL  318



>ref|XP_006362721.1| PREDICTED: putative fructokinase-5-like [Solanum tuberosum]
Length=325

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 116/230 (50%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L +  + S    A+  +K  G L+ +D N+ LPLW S + 
Sbjct  121  SELNLGLIKQAKIFHYGSISLITEPVRSAHMVAMKAAKDAGVLLSYDPNVRLPLWPSPEA  180

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I+  W +AD I+VS  E+ FL  +D  +                            
Sbjct  181  AREGIRSIWNEADFIKVSDDEVNFLTQKDADKD---------------------------  213

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHDRLK L VTDG     Y+T SF+G V G         T D TG+GDA V  +
Sbjct  214  ETVMSLWHDRLKLLIVTDGEKGCRYFTKSFKGKVSG-----FPVKTVDTTGAGDAFVGSL  268

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +   P +F++++ L++ L+FA + G IS    GA+   P+ +  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALKFANACGAISTTQKGAIPALPSTADAQGL  318



>ref|XP_009602080.1| PREDICTED: putative fructokinase-5 [Nicotiana tomentosiformis]
Length=325

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 117/230 (51%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S + 
Sbjct  121  SELNLGLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSPEA  180

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W +AD I+VS  E+ FL  +D  +                            
Sbjct  181  ARDNIKTIWNEADFIKVSDDEVNFLTQKDPEKE---------------------------  213

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHDRLK L VTDG     YYT SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETVLSLWHDRLKLLVVTDGEKGCRYYTKSFKGKVSG-----FSVKTVDTTGAGDAFVGSL  268

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +   P +F++++ L++ LRFA + G IS    GA+   P+ S  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALRFANACGAISTTQKGAIPALPSTSDAQRL  318



>ref|XP_008790605.1| PREDICTED: fructokinase-1-like [Phoenix dactylifera]
Length=326

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 112/234 (48%), Gaps = 32/234 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL +++ A +FHF S  L +    S   +A+  +K+ G L+ +D+NL LPLW S  E
Sbjct  125  SELNLDLIRSAAVFHFGSISLIAEPCRSAHLRAMEVAKEAGALLSYDVNLRLPLWPSPAE  184

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QADII+VS  ELEFL DE   E +   K                      
Sbjct  185  AREQIMSIWDQADIIKVSDVELEFLTDEASVEDEVAMK----------------------  222

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 LW   LK L VT G     YYT  F G V   E   +     D TG+GDA +  +
Sbjct  223  -----LWQPNLKLLLVTIGKKGCKYYTKDFHGAV---ESFAVQ--QVDTTGAGDAFIGSL  272

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +RK+       ++++ L   LRFA + G I+    GA+  FP ES    L E+V
Sbjct  273  LRKIVEDKSALQDENKLREILRFANACGAITATKEGAIPSFPNESEVMQLLERV  326



>ref|XP_009783705.1| PREDICTED: putative fructokinase-5 [Nicotiana sylvestris]
Length=325

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/230 (35%), Positives = 117/230 (51%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S + 
Sbjct  121  SELNLGLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSPEA  180

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I+  W +AD I+VS  E+ FL  +D  +                            
Sbjct  181  ARDNIRSIWNEADFIKVSDDEVNFLTQKDAEKE---------------------------  213

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  ETVLSLWHDRLKLLVVTDGEKGCRYFTKSFKGKVSG-----FSVKTIDTTGAGDAFVGSL  268

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +   P +F++++ L++ LRFA + G IS    GA+   P+ S  Q L
Sbjct  269  LVSIAKDPSIFQDEEKLKKALRFANACGAISTTQKGAIPALPSTSDAQGL  318



>ref|XP_009787481.1| PREDICTED: fructokinase-2 isoform X2 [Nicotiana sylvestris]
Length=208

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  7    ELNLEVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  66

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS  ELEFL   D  +                            E
Sbjct  67   RKQIKSIWDKADVIKVSDVELEFLTGSDKIDD---------------------------E  99

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  100  SAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGALL  154

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  155  TKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  203



>ref|XP_011074982.1| PREDICTED: probable fructokinase-5 [Sesamum indicum]
Length=325

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 114/234 (49%), Gaps = 32/234 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ ++K+A IFH+ S  L S    S    A+  +K+ G L+ +D N+ LPLW S   
Sbjct  121  SELDIKMIKQASIFHYGSISLISEPCRSAHMAAMKDAKEAGALLSYDPNVRLPLWPSAQA  180

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W +AD I+VS  E+EFL  +D         PQ                    
Sbjct  181  ARDGIKSIWNKADFIKVSDDEVEFLTQKD---------PQ------------------KE  213

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LWHD+LK L +TDG     Y+T SF+G V G      +  T D TG+GDA V  +
Sbjct  214  DAVMSLWHDQLKLLVITDGGKGCRYFTKSFKGKVDG-----FSVKTIDTTGAGDAFVGAL  268

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  +   P + +++  L+  L FA + G IS    GA+   PT S  Q L  Q 
Sbjct  269  LVSIAKNPSIMQDEAKLKEALTFANACGAISTTRKGAIPALPTVSDAQALIAQA  322



>gb|AEK21796.1| fructokinase [Dimocarpus longan]
Length=336

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/234 (34%), Positives = 118/234 (50%), Gaps = 30/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ ++K+ARIFH+ S  L +    ST   A+S +K+ GG++ +D NL LPLW S   
Sbjct  130  SELDINIIKQARIFHYGSISLIAEPCKSTHLAAMSMAKRSGGILSYDPNLRLPLWPSEQA  189

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W+QADII++S  E+ FL   D               D      + N      
Sbjct  190  ARDGIMSIWDQADIIKISEDEITFLTGGD---------------DHNDDNVVLNK-----  229

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F+G V G     +   + D TG+GDA V+GI
Sbjct  230  -----LYHPNLKLLIVTEGSKGCRYYTKEFKGRVPG-----VKSKSVDTTGAGDAFVSGI  279

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  L +   +F++++ L   L FA + G I+    GA+   PT+ A   L + V
Sbjct  280  LNCLASDLNLFKDEERLREALLFANACGAITVTERGAIPALPTKEAVLKLVKLV  333



>ref|XP_010999528.1| PREDICTED: probable fructokinase-5 [Populus euphratica]
Length=326

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 111/225 (49%), Gaps = 32/225 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ +LK+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S D 
Sbjct  123  SELNMGLLKQAKVFHYGSISLISEPCRSAHLTAMKAAREAGILLSYDPNVRLPLWPSSDA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W +AD I+VS  E+ FL   D         PQ                    
Sbjct  183  ARDGIKSIWNEADFIKVSDDEVAFLTQGD---------PQ------------------KE  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHDRLK L VTDG     Y+T SF+G V G    ++     D TG+GDA V  +
Sbjct  216  EVVLSLWHDRLKLLVVTDGEKGCRYFTKSFKGSVPGFSVKVV-----DTTGAGDAFVGSL  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
            +  +     +F+N++ L+  L FA + G I     GA+   P+ S
Sbjct  271  LFSVAKDTSIFDNEEKLKEALSFANACGAICTTQKGAIPALPSGS  315



>ref|XP_009787480.1| PREDICTED: fructokinase-2 isoform X1 [Nicotiana sylvestris]
Length=327

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  126  ELNLEVIRPAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS  ELEFL   D  +                            E
Sbjct  186  RKQIKSIWDKADVIKVSDVELEFLTGSDKIDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  219  SAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGALL  273

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  274  TKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>ref|XP_009605011.1| PREDICTED: fructokinase-2 [Nicotiana tomentosiformis]
Length=327

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 111/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  126  ELNLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS  ELEFL   D  +                            E
Sbjct  186  RKQIKSIWDKADVIKVSDVELEFLTGSDKIDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  219  SAMSLWHPNLKLLLVTLGEKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGALL  273

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  274  TKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>gb|AIE16180.1| fructokinase [Nicotiana tabacum]
Length=327

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  126  ELNLEVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS  ELEFL   D  +                            E
Sbjct  186  RKQIKSIWDKADVIKVSDVELEFLTGSDKIDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  219  SAMSLWHPNLKLLLVTLGEKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGALL  273

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA    PTES    L
Sbjct  274  TKIVDDQSILEDEARLKEVLRFACACGAITTTKKGATPALPTESEALTL  322



>gb|AAQ10000.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata]
Length=328

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A+IFH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  127  ELNLDVIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  186

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS +ELEFL   D  +                            E
Sbjct  187  RKQIKSIWDKADVIKVSDNELEFLTGSDKIDD---------------------------E  219

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  220  SAMSLWHPNLKLLLVTLGEKGCRYYTKNFHG---GVEGFHVK--TVDTTGAGDSFVGALL  274

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  L FA + G I+    GA+   PTES    L
Sbjct  275  TKIVDDQSILEDEARLKEVLTFACACGAITTTKKGAIPALPTESEALTL  323



>gb|AAQ09999.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata]
Length=328

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A+IFH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  127  ELNLDVIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  186

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS +ELEFL   D  +                            E
Sbjct  187  RKQIKSIWDKADVIKVSDNELEFLTGSDKIDD---------------------------E  219

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  220  SAMSLWHPNLKLLLVTLGEKGCRYYTKNFHG---GVEGFHVK--TVDTTGAGDSFVGALL  274

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  L FA + G I+    GA+   PTES    L
Sbjct  275  TKIVDDQSILEDEARLKEVLTFACACGAITTTKKGAIPALPTESEALTL  323



>ref|XP_010526109.1| PREDICTED: probable fructokinase-4 [Tarenaya hassleriana]
Length=326

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 110/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSAEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL+FL   D  +                            E
Sbjct  186  RKQILSIWDKAEVIKVSDEELQFLTGSDKIDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGDKGCRYYTKNFRGTV--------DPFRVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ KL     + E++  L   LRFA + G I+    GA+   PTE+  QNL
Sbjct  271  ALLCKLVDDRSILEDEPRLRDVLRFANACGAITTTKKGAIPALPTEAEVQNL  322



>ref|XP_008460045.1| PREDICTED: probable fructokinase-4 [Cucumis melo]
 gb|ADN34093.1| fructokinase [Cucumis melo subsp. melo]
Length=331

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            EL+L +++ A+IFH+ S  L      S   KA+  +KK G L+ +D NL LPLW S +E 
Sbjct  130  ELDLDLIRSAKIFHYGSISLIVEPCRSAHIKAMDEAKKAGVLLSYDPNLRLPLWPSANEA  189

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E IK  W +ADII+VS  EL+FL  +D  +                            E
Sbjct  190  REQIKSIWNKADIIKVSDEELKFLTQKDKVDD---------------------------E  222

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V 
Sbjct  223  NAMSLWHDGLKLLLVTLGEQGCRYYTKNFRGCV--------DPFKVKAVDTTGAGDSFVG  274

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + +++  L   LRFA + G I+    GA+   PTE+    L
Sbjct  275  ALLSKIVDDQSVLQDEKKLRDILRFANACGAITTTKKGAIPALPTEADVAAL  326



>gb|AIL30505.1| fructokinase-2 [Nicotiana tabacum]
Length=327

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V+K A++FH+ S  L      S   KA+  +K+   L+ +D NL LPLW S +E 
Sbjct  126  ELNLEVIKSAKVFHYGSINLIVEPCRSAHLKAMEVAKEARALLSYDPNLRLPLWPSAEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + IK  W++AD+I+VS  ELEFL   D  +                            E
Sbjct  186  RKQIKSIWDKADVIKVSDVELEFLTGSDKIDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G   G E   +   T D TG+GD+ V  ++
Sbjct  219  SAMSLWHPNLKLLLVTLGDKGCNYYTKNFHG---GVEAFHVK--TVDTTGAGDSFVGALL  273

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA+   PTES    L
Sbjct  274  TKIVDDQSILEDEARLKEVLRFACACGAITTTKKGAIPALPTESEALTL  322



>ref|XP_010930218.1| PREDICTED: fructokinase-1-like [Elaeis guineensis]
Length=327

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 110/233 (47%), Gaps = 32/233 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K A IFHF S  L      ST   A+  +KK G L+ FD NL L LW+S   
Sbjct  126  SELNLDLIKRATIFHFGSISLIEEPCRSTQLAAMEIAKKEGALLSFDPNLRLRLWESPKV  185

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
               +I   W+Q++II+VS +E+EFL ++D  E                            
Sbjct  186  AQALIMEIWKQSNIIKVSDAEVEFLTNKDTVED---------------------------  218

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LWH  LK L VT G     YYT  F G V G     I     D TG+GDA V  +
Sbjct  219  DAVMNLWHPELKLLLVTLGGKGCKYYTKDFRGTVNG-----IAVKAIDTTGAGDAFVGAM  273

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            +RK+       ++++ L   LRFA + G I+    GA+   P E+    L E+
Sbjct  274  LRKIADDQSALQDEEKLREVLRFANACGAITTTKRGAIPALPVEAEVLELLER  326



>emb|CDY06000.1| BnaA09g37800D [Brassica napus]
Length=326

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 110/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++        + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCNFVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322



>ref|XP_008800140.1| PREDICTED: fructokinase-1-like [Phoenix dactylifera]
Length=327

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/233 (34%), Positives = 112/233 (48%), Gaps = 32/233 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL +++ A IFH+ S  L      ST   A+  +KK G L+ FD NL L LW+S  +
Sbjct  126  SELNLDLVRRATIFHYGSISLIEEPCRSTQLAAMEIAKKAGALLSFDPNLRLRLWESPKD  185

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
               +I   W+Q++II+VS +E+EFL ++D  E                            
Sbjct  186  AQALIMRIWKQSNIIKVSDAEVEFLTNKDAVED---------------------------  218

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LWH  LK L VT G     YYT  F G V G   + + P   D TG+GDA V  +
Sbjct  219  DAVMSLWHPELKLLLVTLGGKGCKYYTKDFRGTVKG---IAVKP--VDTTGAGDAFVGAM  273

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            +RK+       +++  L   LRFA + G I+    GA+   P E+    L E+
Sbjct  274  LRKIADDQSTLQDEKKLTEVLRFANACGAITTTKRGAIPALPKEAEVLELLER  326



>ref|XP_009116612.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 110/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S +E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSEEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCNIVDDRAVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322



>gb|AAM64445.1| fructokinase-like protein [Arabidopsis thaliana]
Length=326

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  QKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGEKGCSYYTKSFRGSV--------DPFHVDAVDTTGAGDSFVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCKIVDDRAVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322



>gb|KDP41134.1| hypothetical protein JCGZ_03625 [Jatropha curcas]
Length=325

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 114/231 (49%), Gaps = 34/231 (15%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L +    S    A+  +K  G L+ +D NL LPLW S D 
Sbjct  122  SELNLDLIKQAKIFHYGSISLITEPCRSAHMAAMKAAKAAGVLLSYDPNLRLPLWPSSDA  181

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W++AD I+VS  E+ FL   D                             S+
Sbjct  182  ARKGIKSIWKEADFIKVSDEEVAFLTQGDP----------------------------SK  213

Query  392  EEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            EEVA  LWH+ LK L VTDG     Y+T SF+G V G      +  T D TG+GD+ V  
Sbjct  214  EEVALQLWHEGLKLLVVTDGEKGCRYFTKSFKGKVAG-----FSVKTVDTTGAGDSFVGS  268

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            ++  +     +F+N++ L+  L FA + G I     GA+   P+ S  Q L
Sbjct  269  LLCSVAKDTSIFDNEEKLKEALTFANACGAICTTQKGAIPALPSPSDAQAL  319



>ref|XP_007201273.1| hypothetical protein PRUPE_ppa008482mg [Prunus persica]
 gb|EMJ02472.1| hypothetical protein PRUPE_ppa008482mg [Prunus persica]
 gb|AGH25527.1| fructokinase [Prunus persica]
Length=330

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 112/240 (47%), Gaps = 32/240 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L S    S    A+  +K  G ++ +D N+ LPLW S D 
Sbjct  123  SELNMPLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKDAGIMLSYDPNVRLPLWPSADA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E IK  W QAD I+VS  E++FL   D  +                            
Sbjct  183  AREGIKSIWNQADFIKVSDDEVQFLTQGDAEKD---------------------------  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LWHD LK L VTDG     YYT  F+G V G      +    D TG+GDA V   
Sbjct  216  DVVLSLWHDNLKLLVVTDGEKGCRYYTKKFKGKVTG-----FSVKAVDTTGAGDAFVGSF  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQVYVPSMW  33
            +  +     +FE++  L+  L F+ + G I     GA+   PT+SA   L  +    SM+
Sbjct  271  LLSMAKDMSIFEDETKLKEALSFSNACGAICTTQKGAIPALPTQSAALELISKSKSKSMF  330



>emb|CDX98377.1| BnaC06g17380D [Brassica napus]
Length=326

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 108/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDDELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCKYYTKSFHGSV--------DPFHVNTVDTTGAGDSFVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E +  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  271  ALLSNIVDDSTILEEEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322



>emb|CDX71907.1| BnaC08g29670D [Brassica napus]
Length=326

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 110/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKESGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSEEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G    +YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQSL  322



>emb|CDP17143.1| unnamed protein product [Coffea canephora]
Length=208

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 110/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E 
Sbjct  7    ELNLDLIRSAKVFHYGSISLIVEPCRSAHIKAMEAAKAAGVLLSYDPNLRLPLWPSAEEA  66

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++ADII+VS  ELEFL                       + KI +      E
Sbjct  67   RKQILSIWDKADIIKVSDVELEFL---------------------TGSNKIDD------E  99

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G    +YYT +F G V           T D TG+GD+ V  ++
Sbjct  100  SAMSLWHPNLKLLLVTLGEKGCNYYTKNFHGSVPA-----FHVNTVDTTGAGDSFVGALL  154

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L+  LRFA + G I+    GA+   PTES   +L
Sbjct  155  CKIVDNQAILEDEARLKEVLRFACACGAITTTKKGAIPALPTESDALSL  203



>ref|XP_006443006.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
 ref|XP_006478719.1| PREDICTED: probable fructokinase-4-like [Citrus sinensis]
 gb|ESR56246.1| hypothetical protein CICLE_v10021105mg [Citrus clementina]
Length=329

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 108/229 (47%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   +A+  +K+ G L+ +D NL LPLW S +E 
Sbjct  129  ELNLELIRSAKVFHYGSISLIVEPCRSAHLEAMKAAKEAGALLSYDPNLRLPLWPSPEEA  188

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I   W++A++I+VS  ELEFL   D  +                            E
Sbjct  189  REQIMSIWDKAEVIKVSDVELEFLTGSDKIDD---------------------------E  221

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT SF G V    D      T D TG+GDA V  ++
Sbjct  222  SALSLWHPNLKLLLVTLGEHGCRYYTKSFRGAV----DAFHVN-TVDTTGAGDAFVGALL  276

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             KL     + E++  L   L+FA + G I+    GA+   PTES   NL
Sbjct  277  GKLVDDQSVLEDEPRLREILKFANACGAITTTKKGAIPALPTESEALNL  325



>ref|XP_010696263.1| PREDICTED: probable fructokinase-5 [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 110/233 (47%), Gaps = 32/233 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A++FH+ S  L +    S    A+  +K+ G  + +D N+ LPLW S + 
Sbjct  120  SELNLDLIKQAKVFHYGSISLITEPCRSAHIAAMKAAKEAGVTLSYDPNVRLPLWSSPEA  179

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E IK  W QADII+VS  E+EFL   D  +                            
Sbjct  180  AREGIKSIWNQADIIKVSDDEVEFLTQGDATKE---------------------------  212

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E +  LW D LK L VTDG     Y+T  F+G V G     I     D TG+GDA V   
Sbjct  213  EVIKTLWFDGLKLLLVTDGEKGCRYFTKDFKGSVKGFSVKAI-----DTTGAGDAFVGSF  267

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            +  L   P + ++++ L+  L  + + G I     GA+   P+ S  Q+L +Q
Sbjct  268  LYSLAKDPSILQDENKLKEALTLSNACGAICTTQKGAIPALPSLSQAQDLVKQ  320



>ref|XP_010469311.1| PREDICTED: probable fructokinase-4 [Camelina sativa]
Length=326

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  QKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT SF G V         PF     D TG+GDA V 
Sbjct  219  TALSLWHSNLKLLLVTLGDKGCRYYTKSFRGSV--------DPFHVNAVDTTGAGDAYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + E++  L   LRFA + G I+    GA+   PTE+  Q+L
Sbjct  271  ALLCKIVDDRAVLEDEPRLREVLRFANACGAITTTKKGAIPALPTEAEVQSL  322



>emb|CDX67798.1| BnaA07g18380D [Brassica napus]
Length=326

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAELIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCKYYTKSFRGSV--------DPFHVNTVDTTGAGDSFVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  271  ALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322



>gb|AIE16179.1| fructokinase [Nicotiana tabacum]
Length=384

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 32/227 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL+  ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D 
Sbjct  178  AELDKDLIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADA  237

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              + I   W+QAD+I+VS  E+ FL D ED Y+           ++   T+         
Sbjct  238  ARKGILSIWDQADVIKVSEDEITFLTDGEDAYD-----------DNVVMTK---------  277

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
                  L+H  LK L VT+G     YYT +F G V G +   +     D TG+GDA V G
Sbjct  278  ------LFHPNLKLLLVTEGGEGCRYYTKNFHGRVNGIKVTAV-----DTTGAGDAFVGG  326

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  75
            ++  + + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  327  LLNSMASDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>ref|XP_011041646.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=345

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 118/234 (50%), Gaps = 30/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S + 
Sbjct  139  SELDINLLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEA  198

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QAD+I++S  E+ FL   D               D    + + +      
Sbjct  199  AREGIMSIWDQADVIKISEEEITFLTGCD---------------DPNDDKVVLDK-----  238

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G+
Sbjct  239  -----LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKPV--DTTGAGDAFVGGM  288

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  L +   +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  289  LSNLASNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKLLGKV  342



>ref|XP_011041647.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=329

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/234 (33%), Positives = 116/234 (50%), Gaps = 30/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S + 
Sbjct  123  SELDINLLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QAD+I++S  E+ FL   D     +    +                    
Sbjct  183  AREGIMSIWDQADVIKISEEEITFLTGCDDPNDDKVVLDK--------------------  222

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G+
Sbjct  223  -----LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKPV--DTTGAGDAFVGGM  272

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  L +   +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  273  LSNLASNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKLLGKV  326



>ref|XP_002521094.1| fructokinase, putative [Ricinus communis]
 gb|EEF41245.1| fructokinase, putative [Ricinus communis]
Length=329

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 112/231 (48%), Gaps = 34/231 (15%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L S    S    A+  +K  G L+ +D N+ LPLW S + 
Sbjct  126  SELNMGLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKAAGILLSYDPNVRLPLWPSHEA  185

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W +AD I+VS  E+ FL   D                             ++
Sbjct  186  ARDGIKSIWNEADFIKVSDDEVAFLTQGDP----------------------------TK  217

Query  392  EEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            EEV   L+HDRLK L VTDG     Y+T SF+G V G      +  T D TG+GDA V  
Sbjct  218  EEVVLSLYHDRLKLLIVTDGEKGCRYFTKSFKGKVSG-----YSVKTVDTTGAGDAFVGA  272

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            ++  +     +FEN+  L+  L FA + G I     GA+   P+ S  Q L
Sbjct  273  LLVSVAKDASIFENEGKLKEALTFANACGAICTTQKGAIPALPSTSDAQAL  323



>ref|XP_002318851.2| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|EEE97071.2| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=351

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL+  +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S + 
Sbjct  140  SELDTNLLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEA  199

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WEQAD+I++S  E+ FL   +DH + K                         
Sbjct  200  AREGIMSIWEQADVIKISEEEITFLTGCDDHTDDKV------------------------  235

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G
Sbjct  236  --VLDKLFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKPV--DTTGAGDAFVGG  288

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            ++  L     +FE++ +L   L FA + G ++    GA+   PT+ A   L E+V
Sbjct  289  MLSNLAFNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLEKV  343



>gb|AIL30508.1| fructokinase [Nicotiana tabacum]
Length=390

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 115/227 (51%), Gaps = 32/227 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL+  ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D 
Sbjct  178  AELDKDLIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADA  237

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              + I   W+QAD+I+VS  E+ FL D ED Y+           ++   T+         
Sbjct  238  ARKGILSIWDQADVIKVSEDEITFLTDGEDAYD-----------DNVVMTK---------  277

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
                  L+H  LK L VT+G     YYT +F G V G +   +     D TG+GDA V G
Sbjct  278  ------LFHPNLKLLLVTEGGEGCRYYTKNFHGRVNGIKVTAV-----DTTGAGDAFVGG  326

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  75
            ++  + + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  327  LLNSMASDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>ref|XP_002321869.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|EEF05996.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=349

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 114/230 (50%), Gaps = 30/230 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+ F A+  +KK G ++ +D NL L LW S + 
Sbjct  142  SELDINLLEQARIFHYGSISLISEPCRSSQFAAMRIAKKSGSILSYDPNLRLALWPSAEA  201

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QAD+I++S  E+ FL   D     +    +                    
Sbjct  202  AREGIMSIWDQADVIKISEEEITFLTGCDDPNDDKVVMDK--------------------  241

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G+
Sbjct  242  -----LFHPNLKLLIVTEGSKGCRYYTKEFKGWVPG---VKVKPV--DTTGAGDAFVGGM  291

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  L +   +FE++ +L   L FA + G ++    GA+   PT+ A   L
Sbjct  292  LSNLASNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKDAVLKL  341



>ref|XP_009104208.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
Length=326

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 108/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++K A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIKSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT SF G V         PF   T D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCKYYTKSFRGSV--------DPFHVNTVDTTGAGDSFVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E +  L   LRFA + G I+    GA+   PT S  Q L
Sbjct  271  ALLCNIVDDRSVLEEEARLREVLRFANACGAITTTKKGAIPALPTVSEVQTL  322



>ref|XP_010907694.1| PREDICTED: LOW QUALITY PROTEIN: fructokinase-1-like [Elaeis guineensis]
Length=327

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/234 (36%), Positives = 111/234 (47%), Gaps = 31/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL +++ A IFHF S  L +    S   KA+  +K+ G L+ +D+NL L LW S  E
Sbjct  125  SELNLDLIRSATIFHFGSVSLIAEPCRSAHLKAMEVAKEAGALLSYDVNLRLLLWPSPAE  184

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QADII+VS +ELEFL  E          P    ED               
Sbjct  185  AREQIMSIWDQADIIKVSDAELEFLTGE--------AAP---VED---------------  218

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E    LWH  LK L VT G     YY   F GVV   E   +     D TG+GDA +  +
Sbjct  219  EIAMKLWHPSLKLLLVTIGEKGCKYYAKDFHGVV---ESFAVQ--QVDTTGAGDAFMGSL  273

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +RK+       +++  L   LRF+ + G I+    GA+   P ES    L E+V
Sbjct  274  LRKIVEDKSALQDEKKLREVLRFSNACGAITTTKKGAIPSLPNESEVMQLLERV  327



>ref|XP_009396809.1| PREDICTED: fructokinase-1-like [Musa acuminata subsp. malaccensis]
Length=324

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 107/234 (46%), Gaps = 32/234 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNL ++++A IFH+ S  L +    S   KA+  +K+ G L+ +D NL LPLW S +E
Sbjct  123  AELNLDLIRKAAIFHYGSISLITEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWTSPEE  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W +ADII+VS  ELEFL   D  E                            
Sbjct  183  ARKQILSIWNEADIIKVSDVELEFLTGHDSVED---------------------------  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E +A LW   LK L VT G     YYT  F G V        T    D TG+GDA V  +
Sbjct  216  EVIAQLWRPSLKLLLVTLGEKGCKYYTKDFHGAVAS-----FTVEQVDTTGAGDAFVGAL  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +R++   P   +++  L   LRFA + G I+    GA+   P  +    L E  
Sbjct  271  LRRIVEDPSALQDEKKLREVLRFANACGAITTTKKGAIPSLPNVAEAMRLFESA  324



>ref|XP_010252313.1| PREDICTED: fructokinase-2 isoform X2 [Nelumbo nucifera]
 ref|XP_010252314.1| PREDICTED: fructokinase-2 isoform X2 [Nelumbo nucifera]
Length=312

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 110/230 (48%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L S    S  F A   +K+ G L+ +D NL LPLW S + 
Sbjct  75   SELNLGLIKQAKIFHYGSISLISEPCRSAHFAATDAAKRAGALLSYDPNLRLPLWPSAEA  134

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W +AD I+VS  E+ FL   D  +                            
Sbjct  135  ARQGIMSIWNEADFIKVSDDEVAFLTQGDPMDE---------------------------  167

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LW++RLK L VTDG     Y+T +F+G + G      +  T D TG+GDA V   
Sbjct  168  DVVLSLWYERLKLLVVTDGEKGCRYFTKNFKGQING-----FSVNTIDTTGAGDAFVGAF  222

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +FE+++ L+  L FA + G IS    GA+   P  SA   L
Sbjct  223  LFLVARDTAIFEDEEKLKEALLFANARGAISTTRKGAIPALPNTSAALKL  272



>ref|XP_009393498.1| PREDICTED: fructokinase-2 [Musa acuminata subsp. malaccensis]
Length=327

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 109/230 (47%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL+++K A+IFH+ S  L S    +    A+  +K+ G L+ +D N+ LPLW S + 
Sbjct  125  SELNLSLIKRAKIFHYGSISLISEPCRTAHLAAMRAAKQAGILLSYDPNVRLPLWPSEEA  184

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W++AD I+VS  E+ FL   D  +                            
Sbjct  185  ARTGIKSIWKEADFIKVSDDEVAFLTQGDPCKE---------------------------  217

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LW+D LK L VTDG     Y+T  F+G + G         T D TG+GDA V  +
Sbjct  218  ETVKTLWYDGLKLLVVTDGEKGCRYFTKDFKGQIPG-----YAVKTVDTTGAGDAFVGAL  272

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +F+N++ L++ L FA + G I     GA+   PT S    L
Sbjct  273  LVSIAKDNSLFKNEEKLKKALTFANACGAICTTKKGAIPALPTASMAMEL  322



>ref|NP_191507.1| probable fructokinase-4 [Arabidopsis thaliana]
 sp|Q9M1B9.1|SCRK4_ARATH RecName: Full=Probable fructokinase-4 [Arabidopsis thaliana]
 emb|CAB75445.1| fructokinase-like protein [Arabidopsis thaliana]
 gb|ABI49475.1| At3g59480 [Arabidopsis thaliana]
 gb|AEE79930.1| probable fructokinase-4 [Arabidopsis thaliana]
Length=326

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/232 (33%), Positives = 108/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL V++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  QKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGEKGCRYYTKSFRGSV--------DPFHVDAVDTTGAGDSFVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + E++  L   LR A + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCKIVDDRAVLEDEARLREVLRLANACGAITTTKKGAIPALPTESEVQSL  322



>ref|XP_010252312.1| PREDICTED: probable fructokinase-5 isoform X1 [Nelumbo nucifera]
Length=369

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/230 (33%), Positives = 110/230 (48%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL ++K+A+IFH+ S  L S    S  F A   +K+ G L+ +D NL LPLW S + 
Sbjct  132  SELNLGLIKQAKIFHYGSISLISEPCRSAHFAATDAAKRAGALLSYDPNLRLPLWPSAEA  191

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W +AD I+VS  E+ FL   D  +                            
Sbjct  192  ARQGIMSIWNEADFIKVSDDEVAFLTQGDPMDE---------------------------  224

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LW++RLK L VTDG     Y+T +F+G + G      +  T D TG+GDA V   
Sbjct  225  DVVLSLWYERLKLLVVTDGEKGCRYFTKNFKGQING-----FSVNTIDTTGAGDAFVGAF  279

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +FE+++ L+  L FA + G IS    GA+   P  SA   L
Sbjct  280  LFLVARDTAIFEDEEKLKEALLFANARGAISTTRKGAIPALPNTSAALKL  329



>ref|XP_007143920.1| hypothetical protein PHAVU_007G113500g [Phaseolus vulgaris]
 gb|ESW15914.1| hypothetical protein PHAVU_007G113500g [Phaseolus vulgaris]
Length=327

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/225 (32%), Positives = 106/225 (47%), Gaps = 32/225 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S + 
Sbjct  123  SELNMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVARESGALLSYDPNVRLPLWPSEEA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W  AD I+VS  E++FL   D  +                            
Sbjct  183  ARSGIKSIWFDADFIKVSDDEVQFLTQGDSEKE---------------------------  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LWHDRLK L VTDG     Y+T +F+G V G      +    D TG+GD+ V  I
Sbjct  216  DVVMSLWHDRLKLLLVTDGEKGCRYFTKNFKGRVTG-----FSVKAVDTTGAGDSFVGAI  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
            +  +     +F+N+  L   L FA + G +     GA+   PT +
Sbjct  271  LTAVARDASIFDNEQKLREALMFANACGAMCTTQKGAIPALPTAT  315



>ref|XP_002876506.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52765.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=326

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  QKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGDKGCRYYTKSFRGSV--------DPFHVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + E++  L   LR+A + G I+    GA+   PTES  Q+L
Sbjct  271  ALLCKIVDDRAVLEDEARLREVLRYANACGAITTTKKGAIPALPTESEVQSL  322



>ref|XP_004145029.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 ref|XP_004153919.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 ref|XP_004160686.1| PREDICTED: probable fructokinase-4-like [Cucumis sativus]
 gb|KGN46299.1| hypothetical protein Csa_6G080910 [Cucumis sativus]
Length=331

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 110/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            EL+L +++ A+IFH+ S  L      S   KA+  +KK G L+ +D NL LPLW S +E 
Sbjct  130  ELDLDLIRSAKIFHYGSISLIVEPCRSAHIKAMDEAKKAGVLLSYDPNLRLPLWPSANEA  189

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E IK  W +ADII+VS  EL+FL                      Q  K+ +      E
Sbjct  190  REQIKSIWNKADIIKVSDEELKFL---------------------TQKEKVDD------E  222

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G     YYT +F G V         PF     D TG+GD+ V 
Sbjct  223  NAMSLWHDGLKLLLVTLGEQGCRYYTKNFRGSV--------DPFKVKAVDTTGAGDSFVG  274

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + +++  L   LRFA + G I+    GA+   P+E+    L
Sbjct  275  ALLTKIVDDQSVLQDEKKLRDILRFANACGAITTTKKGAIPALPSEADVAAL  326



>gb|AHE93349.1| fructokinase [Camellia sinensis]
Length=327

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 111/224 (50%), Gaps = 34/224 (15%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL ++++A+IFH+ S  L      S   KA+  +K  G L+ +D NL LPLW S  E 
Sbjct  129  ELNLELIRKAKIFHYGSISLIVEPCRSAHLKAMEVAKDAGALLSYDPNLRLPLWPSEKEA  188

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I   W++A++I+VS +ELEFL                       T KI +      E
Sbjct  189  REQIMSIWDKAEVIKVSDNELEFL-----------------------TGKIDD------E  219

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH+ LK L VT G     YYT +F G V G         + D TG+GD+ V  ++
Sbjct  220  SAMSLWHNNLKLLLVTLGEQGCKYYTKNFRGCVDG-----FPVKSVDTTGAGDSFVGALL  274

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
             K+     + E+++ L+  L++A + G I+    GA+   PTES
Sbjct  275  CKIVDDRSVLEDEEKLKAVLKYANACGAITTTKKGAIPALPTES  318



>ref|XP_011030019.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=335

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S + 
Sbjct  124  SELDINLLEQARIFHYGSISLISDPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEA  183

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WEQAD+I++S  E+ FL   +DH + K                         
Sbjct  184  AREGIMSIWEQADVIKISEEEITFLTGYDDHTDDKV------------------------  219

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G
Sbjct  220  --VLDKLFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGG  272

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            ++  L     +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  273  MLSNLAFNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLGKV  327



>ref|XP_006371336.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
 gb|ERP49133.1| pfkB-type carbohydrate kinase family protein [Populus trichocarpa]
Length=327

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 110/226 (49%), Gaps = 33/226 (15%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ +LK+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S D 
Sbjct  123  SELNMGLLKQAKVFHYGSISLISEPCKSAHLTAMKAAREAGILLSYDPNVRLPLWPSSDA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W +AD I+VS  E+ FL   D         PQ                    
Sbjct  183  ARDGIKSIWNEADFIKVSDDEVSFLTQGD---------PQ------------------KE  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPS-FEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            + V  LWHDRLK L VTDG     Y+T + F+G V G    ++     D TG+GDA V  
Sbjct  216  DVVLSLWHDRLKLLVVTDGEKGCRYFTKALFKGRVPGFSVKVV-----DTTGAGDAFVGS  270

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
            ++  +     +F+N++ L   L FA + G I     GA+   P+ S
Sbjct  271  LLLSVAKDTSIFDNEEKLREALSFANACGAICTTQKGAIPALPSGS  316



>ref|XP_011016156.1| PREDICTED: probable fructokinase-7 isoform X2 [Populus euphratica]
Length=335

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S + 
Sbjct  124  SELDINLLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEA  183

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WEQAD+I++S  E+ FL   +DH + K                         
Sbjct  184  AREGIMSIWEQADVIKISEEEITFLTGYDDHTDDKV------------------------  219

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G
Sbjct  220  --VLDKLFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKP--VDTTGAGDAFVGG  272

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            ++  L     +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  273  MLSNLAFNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLGKV  327



>gb|AFO84081.1| fructokinase [Actinidia chinensis]
Length=329

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 108/229 (47%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A+IFH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E 
Sbjct  129  ELNLDLIRSAKIFHYGSISLIVEPCRSAHLKAMEVAKDAGALLSYDPNLRLPLWPSAEEA  188

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I   W++A++I+VS +ELEFL   D  +                            E
Sbjct  189  REQIMSIWDKAEVIKVSDNELEFLTGSDKIDD---------------------------E  221

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT SF G V    D      T D TG+GDA +  ++
Sbjct  222  SAMSLWHPNLKLLLVTLGEKGCRYYTKSFHGSV----DAFHVK-TVDTTGAGDAFIGALL  276

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L   L+FA + G I+    GA+   PTES   +L
Sbjct  277  CKMVDDRSVIEDEARLREILKFANACGAITTTKKGAIPALPTESDVLSL  325



>ref|XP_011030018.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=351

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S + 
Sbjct  140  SELDINLLEQARIFHYGSISLISDPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEA  199

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WEQAD+I++S  E+ FL   +DH + K                         
Sbjct  200  AREGIMSIWEQADVIKISEEEITFLTGYDDHTDDKV------------------------  235

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G
Sbjct  236  --VLDKLFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKPV--DTTGAGDAFVGG  288

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            ++  L     +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  289  MLSNLAFNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLGKV  343



>ref|XP_011073890.1| PREDICTED: fructokinase-2-like [Sesamum indicum]
Length=271

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/229 (34%), Positives = 112/229 (49%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELN  +++ A++FH+ S  L +    S  FKA+  +K  G L+ +D NL LPLW S +E 
Sbjct  55   ELNFHLIRSAKVFHYGSISLIAEPCRSAHFKAMEVAKDAGALLSYDPNLRLPLWPSAEEA  114

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I   WE+AD+I+VS  EL+FL                      QT  + +      E
Sbjct  115  REQILSIWEKADVIKVSDEELQFL---------------------TQTNIVDD------E  147

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT +F+G  V T  V     T D TG+GD+ V  ++
Sbjct  148  CAMSLWHHNLKLLLVTLGDRGCRYYTKNFKG-AVDTYQVK----TVDTTGAGDSFVGALL  202

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + + ++ L++ LR+A + G I+    GA+   PT S    L
Sbjct  203  CKIVDDQFIIQKEERLKQVLRYACACGAITTTKKGAIPALPTHSQVLTL  251



>ref|XP_011016155.1| PREDICTED: probable fructokinase-7 isoform X1 [Populus euphratica]
Length=351

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 79/235 (34%), Positives = 117/235 (50%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ +L++ARIFH+ S  L S    S+   A+  +KK G ++ +D NL L LW S + 
Sbjct  140  SELDINLLEQARIFHYGSISLISEPCRSSHIAAMRIAKKSGSILSYDPNLRLALWPSAEA  199

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WEQAD+I++S  E+ FL   +DH + K                         
Sbjct  200  AREGIMSIWEQADVIKISEEEITFLTGYDDHTDDKV------------------------  235

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V G
Sbjct  236  --VLDKLFHPNLKLLIVTEGSEGCRYYTKEFKGRVPG---VKVKPV--DTTGAGDAFVGG  288

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            ++  L     +FE++ +L   L FA + G ++    GA+   PT+ A   L  +V
Sbjct  289  MLSNLAFNLNLFEDEKLLREALLFANACGAVTVTERGAIPALPTKEAVLKLLGKV  343



>gb|KHN30534.1| Putative fructokinase-5 [Glycine soja]
Length=313

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 108/228 (47%), Gaps = 32/228 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S + 
Sbjct  109  SELNMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVAREGGALLSYDPNVRLPLWPSEEA  168

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W  AD I+VS  E+ FL   D         P+   ED   T           
Sbjct  169  ARSGIKSIWFDADFIKVSDDEVHFLTQGD---------PEK--EDVVMT-----------  206

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 LWHD+LK L VTDG     Y+T +F G V G    ++     D TG+GD+ V  +
Sbjct  207  -----LWHDKLKMLLVTDGEKGCRYFTKNFRGRVTGFSAKVV-----DTTGAGDSFVGAL  256

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            +  +   P +F N+  L   L FA + G +     GA+   PT +  +
Sbjct  257  LTAVARDPNIFHNEPKLREALTFANACGAMCTTQKGAIPALPTAAEAE  304



>ref|XP_007033923.1| PfkB-like carbohydrate kinase family protein [Theobroma cacao]
 gb|EOY04849.1| PfkB-like carbohydrate kinase family protein [Theobroma cacao]
Length=328

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 107/224 (48%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ +++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S DE 
Sbjct  128  ELNLDLIRSSKVFHYGSISLIVEPCRSAHLKAMEVAKQSGALLSYDPNLRLPLWPSADEA  187

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++AD+I+VS  ELEFL   D  + +   K                       
Sbjct  188  RKQILSIWDKADVIKVSDVELEFLTGSDKIDDETAMK-----------------------  224

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  L  L VT G     YYT +F G V    D      T D TG+GD+ V  ++
Sbjct  225  ----LWHPNLTLLLVTLGEKGSRYYTKNFHGSV----DAFHVN-TVDTTGAGDSFVGALL  275

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
             K+   P + EN+  L   L+FA + G I+    GA+   PTE+
Sbjct  276  CKIVEDPTILENESKLREVLKFANACGAITTTKKGAIPALPTEA  319



>ref|NP_001233888.1| fructokinase-2 [Solanum lycopersicum]
 sp|Q42896.2|SCRK2_SOLLC RecName: Full=Fructokinase-2 [Solanum lycopersicum]
 gb|AAB51108.1| fructokinase [Solanum lycopersicum]
 gb|AAB57734.1| fructokinase [Solanum lycopersicum]
Length=328

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 108/230 (47%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNL +++ A++FH+ S  L      +   KA+  +K+ G L+ +D NL LPLW S +E
Sbjct  126  AELNLDLIRSAKVFHYGSISLIVEPCRAAHMKAMEVAKEAGALLSYDPNLRLPLWPSAEE  185

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W+ AD+I+VS  ELEFL   +  +                            
Sbjct  186  AKKQIKSIWDSADVIKVSDVELEFLTGSNKIDD---------------------------  218

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E    LWH  LK L VT G    +YYT  F G V G         T D TG+GD+ V  +
Sbjct  219  ESAMSLWHPNLKLLLVTLGEKGCNYYTKKFHGTVGG-----FHVKTVDTTGAGDSFVGAL  273

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            + K+     + E++  L+  LRF+ + G I+    GA+   PT S    L
Sbjct  274  LTKIVDDQTILEDEARLKEVLRFSCACGAITTTKKGAIPALPTASEALTL  323



>ref|XP_003535409.1| PREDICTED: putative fructokinase-5-like [Glycine max]
Length=327

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 108/228 (47%), Gaps = 32/228 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A++FH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S + 
Sbjct  123  SELNMGLIKQAKVFHYGSISLISEPCRSAHLAAMKVAREGGALLSYDPNVRLPLWPSEEA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W  AD I+VS  E+ FL   D         P+   ED   T           
Sbjct  183  ARSGIKSIWFDADFIKVSDDEVHFLTQGD---------PEK--EDVVMT-----------  220

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 LWHD+LK L VTDG     Y+T +F G V G    ++     D TG+GD+ V  +
Sbjct  221  -----LWHDKLKMLLVTDGEKGCRYFTKNFRGRVTGFSAKVV-----DTTGAGDSFVGAL  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            +  +   P +F N+  L   L FA + G +     GA+   PT +  +
Sbjct  271  LTAVARDPNIFHNEPKLREALTFANACGAMCTTQKGAIPALPTAAEAE  318



>gb|EEC71816.1| hypothetical protein OsI_04455 [Oryza sativa Indica Group]
Length=398

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +E+N+ VLKEAR+FHFNSEVL +P+M  TLF+AI  SKKFG  IFFDLNLPLPLW+SRDE
Sbjct  292  AEINVDVLKEARVFHFNSEVLLTPSMEITLFRAIELSKKFGSKIFFDLNLPLPLWRSRDE  351

Query  572  TWEVIKGAWEQADIIEVS  519
            T E+I  AW +ADIIEVS
Sbjct  352  TKELINKAWNEADIIEVS  369



>ref|XP_008234319.1| PREDICTED: fructokinase-1 [Prunus mume]
Length=358

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 115/234 (49%), Gaps = 30/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ ++++ARIFH+ S  L      ST   A+  +KK G ++ +D NL LPLW S + 
Sbjct  151  SELDINLIQQARIFHYGSISLIDEPCRSTHLAAMRIAKKSGCILSYDPNLRLPLWPSEEA  210

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W+QADII++S  E+ FL   D            + ++   T+          
Sbjct  211  ARKGIMSIWDQADIIKISEDEITFLTGGD----------DPYDDNVVLTK----------  250

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F G V G   V + P   D TG+GDA V+G+
Sbjct  251  -----LFHPNLKLLVVTEGSEGCRYYTQKFRGRVAG---VKVKPV--DTTGAGDAFVSGV  300

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  + +   +F+N+  L   L FA + G ++    GA+   PT  A      QV
Sbjct  301  LNSIASDLSLFQNEQGLREALLFANACGALTVTERGAIPAMPTREAVLRCLAQV  354



>gb|ACN40355.1| unknown [Picea sitchensis]
Length=347

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 72/230 (31%), Positives = 110/230 (48%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL+  +++EA +FH+ S  L +    S    A++ +++ G L+ +D N+ LPLW S DE
Sbjct  144  SELDAELIREASVFHYGSISLIAEPTRSAHLAAMAIARQGGALLSYDPNVRLPLWPSADE  203

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W++AD+I++S  E+ FL   D                               
Sbjct  204  ARKGILSIWDEADLIKISDEEVGFLTGGDSNND---------------------------  236

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWH +LK L VTDG     YYT SF G V       I+    D TG+GDA V G+
Sbjct  237  EVVMSLWHSKLKLLLVTDGPKGCRYYTKSFRGRVD-----TISVKAIDTTGAGDAFVGGV  291

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            + ++     + E++  L++ LR A + G I+    GA+   P +S    L
Sbjct  292  LNQIADDISVLEDEQRLKKALRLANACGAITATKKGAIPALPDKSTVLEL  341



>ref|XP_010512210.1| PREDICTED: probable fructokinase-4 [Camelina sativa]
Length=326

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  QKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGDKGCRYYTKSFRGSV--------DPFHVNAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++ K+     + E++  L   LR+A + G I+    GA+   PTE+  Q+L
Sbjct  271  ALLCKIVDDRAVLEDEPRLREVLRYANACGAITTTKKGAIPALPTEAEVQSL  322



>gb|EMT27421.1| hypothetical protein F775_08291 [Aegilops tauschii]
Length=255

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 106/233 (45%), Gaps = 32/233 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELN+ V+K A +FH+ S  L +    S   +A+  +K+ G L+ +D N    LW SR+E 
Sbjct  55   ELNVDVIKRATVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNPREALWSSREEA  114

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
               I   W+QADI++VS SE+EFL   D  E                            +
Sbjct  115  RTKILSIWDQADIVKVSESEVEFLTGIDSVED---------------------------D  147

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
             V  LW    K L VT G     YY   F GVV   +   +     D TG+GDA V  ++
Sbjct  148  VVMKLWRPTFKLLLVTLGGKGCKYYARDFRGVVPSYKIQQV-----DTTGAGDAFVGALL  202

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            RK+   P   +NQ+ LE  ++FA + G I+    GA+   PTE     L E  
Sbjct  203  RKIVQDPSSLQNQEKLEEAIKFANACGAITTTKKGAIPSLPTEIEVLQLMENA  255



>ref|XP_009370536.1| PREDICTED: putative fructokinase-5 [Pyrus x bretschneideri]
Length=327

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 109/230 (47%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S D 
Sbjct  123  SELNMGLIKQAKIFHYGSISLIAEPCRSAHMAAMKAAKEAGVLLSYDPNVRLPLWPSADA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W QAD I+VS  E+ FL   D  +           ED               
Sbjct  183  ARQEIKSIWNQADFIKVSDDEVNFLTQGDSEK-----------EDV--------------  217

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
              V  LWHD LK L VTDG     YYT  F+G V G      +    D TG+GD+ V   
Sbjct  218  --VLSLWHDNLKLLVVTDGEKGCRYYTKKFKGKVAG-----FSVKAVDTTGAGDSFVGSF  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +FE++  L+  L FA + G I     GA+   PT+S  + L
Sbjct  271  LLSMANDMSIFEDEAKLKEALSFANACGAICTTQKGAIPALPTQSDAREL  320



>ref|XP_006402684.1| hypothetical protein EUTSA_v10006096mg [Eutrema salsugineum]
 gb|ESQ44137.1| hypothetical protein EUTSA_v10006096mg [Eutrema salsugineum]
Length=326

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/232 (33%), Positives = 107/232 (46%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D  +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDKVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWH  LK L VT G     YYT  F G V         PF   T D TG+GD+ V 
Sbjct  219  TALSLWHSNLKLLLVTLGEKGCRYYTKGFRGSV--------DPFRVNTVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PTES  Q L
Sbjct  271  ALLCNIVDDRAVLEDEARLREVLRFANACGAITTTKKGAIPALPTESEVQGL  322



>ref|XP_011091648.1| PREDICTED: fructokinase-2 [Sesamum indicum]
Length=329

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 103/224 (46%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +  
Sbjct  128  ELNLELIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKSAGALLSYDPNLRLPLWPSAEYA  187

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E IK  W +AD+I+VS  EL FL   D  +                            E
Sbjct  188  KEQIKSIWNKADVIKVSDEELVFLTGSDKVDD---------------------------E  220

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWHD LK L VT G     YYT +F G V G         T D TG+GD+ V  ++
Sbjct  221  SAMSLWHDNLKLLLVTLGAKGCRYYTKNFRGAVEG-----FAVKTVDTTGAGDSFVGALL  275

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
             K+     + +++  L+  L++A + G I+    GA+   P  S
Sbjct  276  GKIVDDHSIIQDETRLKEALKYACACGAITTTKKGAIPALPAHS  319



>ref|XP_004306875.1| PREDICTED: probable fructokinase-7 [Fragaria vesca subsp. vesca]
Length=366

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/234 (32%), Positives = 110/234 (47%), Gaps = 32/234 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELN+ ++K+A IFH+ S  L      S    A+  +K+ G ++ +D NL LPLW S + 
Sbjct  161  NELNVDLIKKASIFHYGSISLIEEPCRSAHLAAMDIAKQAGCILSYDPNLRLPLWPSAEA  220

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W  ADII+VS  E+ FL   D                            Y  
Sbjct  221  ARKGIMSIWNLADIIKVSEEEITFLTGGDD--------------------------PYDD  254

Query  392  EEVA-PLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
            E V   L+H  LK L VT+G     YYT  F+G V G +   +     D TG+GD+ V  
Sbjct  255  ELVMNKLYHSNLKLLLVTEGPAGCRYYTKEFKGKVAGIKADCV-----DTTGAGDSFVGS  309

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            ++  L + PE+F+N+  L   L+FA + G ++    GA+   PT+ A   +  Q
Sbjct  310  VLNSLASDPELFKNEKQLTEALKFANACGALTVEKKGAIPALPTKEAVPKVLSQ  363



>gb|EYU36729.1| hypothetical protein MIMGU_mgv1a009780mg [Erythranthe guttata]
Length=332

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 106/224 (47%), Gaps = 32/224 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K  G L+ +D NL LPLW S +E 
Sbjct  129  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKAAGALLSYDPNLRLPLWSSAEEA  188

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W QA++I+VS  EL+FL   D+ +                            E
Sbjct  189  RKQILSIWNQAEVIKVSDEELQFLTQNDNIDD---------------------------E  221

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWHD LK L VT G     YYT +F G V    D      T D TG+GD+ V  ++
Sbjct  222  SAMSLWHDNLKLLLVTLGDKGCRYYTKNFRGAV----DAYRVK-TVDTTGAGDSFVGALL  276

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
             K+     + E++  L+  L++A + G I+    GA+   PT S
Sbjct  277  YKIVDDQAIIEDESRLKEVLKYACACGAITTTKKGAIPALPTPS  320



>ref|XP_007218097.1| hypothetical protein PRUPE_ppa006628mg [Prunus persica]
 gb|EMJ19296.1| hypothetical protein PRUPE_ppa006628mg [Prunus persica]
Length=402

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 115/234 (49%), Gaps = 30/234 (13%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL++ ++++ARIFH+ S  L      ST   A+  +KK G ++ +D NL LPLW S + 
Sbjct  195  SELDINLIQQARIFHYGSISLIDEPCRSTHLAAMRIAKKSGCILSYDPNLRLPLWPSEEA  254

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + I   W+QADII++S  E+ FL   D            + ++   T+          
Sbjct  255  ARKGIMSIWDQADIIKISEDEITFLTGGD----------DPYDDNVVLTK----------  294

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+H  LK L VT+G+    YYT  F G V G   V + P   D TG+GDA V+G+
Sbjct  295  -----LFHPNLKLLVVTEGSEGCRYYTQKFRGRVAG---VKVKPV--DTTGAGDAFVSGV  344

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            +  + +   +F+N+  L   L FA + G ++    GA+   PT  A      QV
Sbjct  345  LNSIASDLSLFQNEQGLREALLFANACGALTVTERGAIPAMPTREAVLRCLAQV  398



>ref|XP_003597523.1| Fructokinase [Medicago truncatula]
 gb|AES67774.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=329

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 109/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S DE 
Sbjct  130  ELNLELIRSAKVFHYGSISLIVEPCRSAHLKALEVAKEAGCLLSYDPNLRLPLWPSADEA  189

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   WE+AD+I+VS +ELEFL   D                     KI +    +  
Sbjct  190  RKQILSIWEKADLIKVSDNELEFLTGSD---------------------KIDDATALT--  226

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK L VT G     YYT +F G V G         T D TG+GD+ V  ++
Sbjct  227  ----LWHPNLKLLLVTLGEHGARYYTKNFHGQVDG-----FKVNTVDTTGAGDSFVGALL  277

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L   L+FA + G I+    GA+   P E    NL
Sbjct  278  AKIVDDQAILEDESRLREVLKFANACGAITTTKKGAIPALPKEEDVLNL  326



>ref|XP_010111956.1| Putative fructokinase-5 [Morus notabilis]
 gb|EXC32163.1| Putative fructokinase-5 [Morus notabilis]
Length=339

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 115/235 (49%), Gaps = 32/235 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL++A++K+A+IFH+ S  L      S    A+  +KK G  + +D NL LPLW S + 
Sbjct  134  AELDIALIKQAKIFHYGSISLIEEPSRSAHLAAMGIAKKNGCFLSYDPNLRLPLWPSHEA  193

Query  572  TWEVIKGAWEQADIIEVSRSELEFLL-DEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              + I   W+QAD+I++S  E+ FL   +D Y+                           
Sbjct  194  ALKGIMSIWDQADLIKISEDEITFLTGGDDPYDDN-------------------------  228

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
               +  L+H  LK L VT+G+    YYT  F+G V G   V + P   D TG+GDA V+G
Sbjct  229  -AVLTKLFHPNLKLLIVTEGSAGCRYYTKEFKGRVHG---VTVKPI--DTTGAGDAFVSG  282

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQV  51
            I+  L +   +F+++  L   L FA + G I+    GA+   PT+       ++V
Sbjct  283  ILYSLASDLNLFQDEKCLREALSFANACGAITVTERGAIPALPTKDTVIQFLQKV  337



>ref|XP_010909223.1| PREDICTED: fructokinase-1-like [Elaeis guineensis]
Length=328

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 107/233 (46%), Gaps = 32/233 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNL +L+ A IFH+ S  L +    S   +A+  +K+ G L+ +D NL LPLW S  +
Sbjct  127  AELNLDLLRRAAIFHYGSISLIAEPCRSAHLRAMEVAKEAGALLSYDPNLRLPLWPSPAK  186

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QADII+VS  ELEFL  E   E +   K                      
Sbjct  187  AKEQIMSIWDQADIIKVSDVELEFLTGEASVEDEVALK----------------------  224

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 LW   LK L VT G     YYT  F G  VG+          D TG+GDA V  +
Sbjct  225  -----LWRPTLKLLLVTVGEKGCKYYTKDFRG-TVGS----FVVKQVDTTGAGDAFVGAL  274

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNLKEQ  54
            +RK+       +++  L   LRFA + G I+    GA+   P ES    L E+
Sbjct  275  LRKIVEDQSALQDEKKLREVLRFANACGAITTTKKGAIPSLPNESEVVQLLER  327



>ref|XP_009618746.1| PREDICTED: fructokinase-1-like [Nicotiana tomentosiformis]
Length=385

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 113/227 (50%), Gaps = 32/227 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL+  ++ +ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D 
Sbjct  179  AELDKDLIHKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADA  238

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              + I   W+QAD+I+VS  E+ FL D ED Y+           ++   T+         
Sbjct  239  ARKGILSIWDQADVIKVSEDEITFLTDGEDAYD-----------DNVVMTK---------  278

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
                  L+H  LK L VT+G     YYT +F G V      +I     D TG+GDA V G
Sbjct  279  ------LFHPNLKLLLVTEGGEGCRYYTKNFHGRV-----NVIKVTAVDTTGAGDAFVGG  327

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  75
            ++  + + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  328  LLNSMASDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  374



>emb|CDY00619.1| BnaC04g23060D [Brassica napus]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVDAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PT S  + L
Sbjct  271  ALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTVSEVETL  322



>ref|XP_009138911.1| PREDICTED: probable fructokinase-4 [Brassica rapa]
 emb|CDX89022.1| BnaA04g01640D [Brassica napus]
Length=326

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 109/232 (47%), Gaps = 38/232 (16%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   KA+  +K+ G L+ +D NL LPLW S++E 
Sbjct  126  ELNLDLIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKEEA  185

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++A++I+VS  EL FL   D+ +                            E
Sbjct  186  KKQILSIWDKAEVIKVSDEELMFLTGSDNVDD---------------------------E  218

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPF---TCDRTGSGDAVVA  219
                LWHD LK L VT G    +YYT SF G V         PF     D TG+GD+ V 
Sbjct  219  TALSLWHDNLKLLLVTLGEKGCNYYTKSFRGSV--------DPFHVDAVDTTGAGDSYVG  270

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             ++  +     + E++  L   LRFA + G I+    GA+   PT S  + L
Sbjct  271  ALLCNIVDDRSVLEDEARLREVLRFANACGAITTTKKGAIPALPTVSEVETL  322



>ref|XP_008467254.1| PREDICTED: fructokinase-1 [Cucumis melo]
Length=348

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/230 (32%), Positives = 112/230 (49%), Gaps = 32/230 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            EL L V+++A+IFH+ S  L      S    A+  +K  G L+ +D NL LPLW S +  
Sbjct  143  ELELKVIQQAKIFHYGSISLIDEPSKSAHLAALKLAKNAGCLLSYDPNLRLPLWPSPEAA  202

Query  569  WEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
             + I   W+Q+DI+++S  E+ FL   +D Y+     K                      
Sbjct  203  RDGIMSIWDQSDIVKISEDEITFLTGGDDPYDDNVVLKK---------------------  241

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
                 L+    K L VT+G+    YYT  F G V G +   I     D TG+GDA V+GI
Sbjct  242  -----LFRPNFKLLIVTEGSQGCRYYTQKFRGRVAGIKAKPI-----DTTGAGDAFVSGI  291

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            + ++ + P +F+++  L+  LRFA + G I+    GA+   PT+ A Q +
Sbjct  292  LFRVASDPSIFQDEQRLQDALRFANACGAITVMERGAIPALPTKEAVQKI  341



>ref|XP_004495435.1| PREDICTED: putative fructokinase-5-like isoform X1 [Cicer arietinum]
Length=327

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/228 (31%), Positives = 109/228 (48%), Gaps = 32/228 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L S    S    A++ +++ G L+ +D N+ LPLW S D 
Sbjct  123  SELNMGLIKQAKIFHYGSISLISEPCRSAHMAAMNAAREGGALLSYDPNVRLPLWSSPDA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W  AD I++S  E+EFL  +D         P+                  + 
Sbjct  183  ARSGIKSIWFDADFIKMSDDEVEFLTQKD---------PK------------------NE  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + +  LWHD+LK L +TDG     Y T +F+G V G      +    D TG+GD+ V  +
Sbjct  216  DVIMSLWHDKLKMLLITDGEKGCRYVTKNFKGRVSG-----FSVKAVDTTGAGDSFVGAL  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            +  +     +F+N+  L   L FA + G +     GA+   PT    Q
Sbjct  271  LTAVARDTSIFDNEPKLRETLTFANACGAMCTTQKGAIPALPTAEEAQ  318



>ref|XP_009379916.1| PREDICTED: probable fructokinase-1 [Musa acuminata subsp. malaccensis]
Length=321

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 106/230 (46%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +ELNL V+K A +FH+ S  L +    S   KA+  +++ G L+ +D NL LPLW S + 
Sbjct  120  AELNLDVIKSAAVFHYGSISLITEPCRSAHLKAMEVARQAGALLSYDPNLRLPLWPSPES  179

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E I   W+QADII+VS  ELEFL  ++  E                            
Sbjct  180  AREQIMSIWDQADIIKVSDVELEFLTGQESVED---------------------------  212

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            + V  LW    K L VT G     YYT  F G + G         T D TG+GDA V  +
Sbjct  213  DVVLTLWRPEFKLLLVTLGEKGCKYYTKDFRGSLDG-----FAVNTVDTTGAGDAFVGAM  267

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +RK+     + + ++ L   LRFA + G I+    GA+   P E+    L
Sbjct  268  LRKIVDDQTVLQEEEKLREVLRFANACGAITTTKKGAIPALPNEAEAVEL  317



>ref|XP_008777085.1| PREDICTED: fructokinase-2-like [Phoenix dactylifera]
Length=331

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 109/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNLA+++ A+IFH+ S  L S    S    A+  +K+ G L+ +D N+ LPLW S++  
Sbjct  130  ELNLALIRRAKIFHYGSISLISEPCRSAHLAAMRAAKEAGILLSYDPNVRLPLWPSQEAA  189

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++AD I+VS  E+ FL   D                             S +
Sbjct  190  RDGIMSIWKEADFIKVSDDEVAFLTQGDPA---------------------------SED  222

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
             +  LW D LK L VTDG     Y+T +F+G V G      +  T D TG+GDA V  ++
Sbjct  223  VIMKLWFDGLKLLVVTDGEKGCRYFTKNFKGKVPG-----FSVTTVDTTGAGDAFVGSLL  277

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
              +     +F N++ L+  LRF+ + G I     GA+   P  S  Q L
Sbjct  278  VSIAKDNSLFHNEEKLKEALRFSNACGAICTTKKGAIPALPDTSMAQEL  326



>gb|AAK44144.2|AF370329_1 putative fructokinase [Arabidopsis thaliana]
Length=227

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 112/230 (49%), Gaps = 35/230 (15%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL+  ++K+A+IFH+ S  L +    S    A   +K+ G ++ +D NL LPLW S D 
Sbjct  23   SELDFDLIKKAKIFHYGSISLITEPCKSAHISAAKAAKEAGVILSYDPNLRLPLWPSADN  82

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              E I   WE ADII++S  E+ FL   ED Y             D    RK        
Sbjct  83   AREEILSIWETADIIKISEEEIVFLTKGEDPY-------------DDNVVRK--------  121

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTE-DVLITPFTCDRTGSGDAVVA  219
                  L+H +LK L VT+G     YYT  F G V G + DV+      D TG+GDA VA
Sbjct  122  ------LFHPKLKLLLVTEGPEGCRYYTKDFSGRVHGLKVDVV------DTTGAGDAFVA  169

Query  218  GIMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            GI+ +L     + ++++ L   L FA + G ++    GA+   PT+ A  
Sbjct  170  GILSQLANDLSLLQDEERLREALMFANACGALTVKVRGAIPALPTKEAVH  219



>ref|XP_008237799.1| PREDICTED: putative fructokinase-5 [Prunus mume]
Length=327

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/230 (34%), Positives = 107/230 (47%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L S    S    A+  +K  G ++ +D N+ LPLW S D 
Sbjct  123  SELNMPLIKQAKIFHYGSISLISEPCRSAHMAAMKAAKDAGIMLSYDPNVRLPLWPSADA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              E IK  W QAD I+VS  E+ FL   D  +           ED               
Sbjct  183  AREGIKSIWNQADFIKVSDDEVHFLTQGDAEK-----------EDV--------------  217

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
              V  LWHD LK L +TDG     YYT  F+G V G      +    D TG+GDA V   
Sbjct  218  --VLSLWHDNLKLLVITDGEKGCRYYTKKFKGKVTG-----FSVKAVDTTGAGDAFVGSF  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +FE++  L+  L F+ + G I     GA+   PT+ A   L
Sbjct  271  LLSMAKDMSIFEDETKLKEALSFSNACGAICTTQKGAIPALPTQCAALEL  320



>ref|XP_009782121.1| PREDICTED: fructokinase-1-like [Nicotiana sylvestris]
Length=390

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 114/227 (50%), Gaps = 32/227 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            +EL+  ++++ARIFH+ S  L +    S    A+  +KK G ++ +D NL LPLW S D 
Sbjct  178  AELDKDLIQKARIFHYGSISLIAEPCRSAHLAAMEIAKKAGCILSYDPNLRLPLWPSADA  237

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLD-EDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYS  396
              + I   W+QAD+I+VS  E+ FL D ED Y+           ++   T+         
Sbjct  238  ARKGILSIWDQADVIKVSEDEITFLTDGEDAYD-----------DNVVMTK---------  277

Query  395  REEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAG  216
                  L+   LK L VT+G     YYT +F G V G +   +     D TG+GDA V G
Sbjct  278  ------LFRPNLKLLLVTEGGEGCRYYTKNFHGRVNGIKVTAV-----DTTGAGDAFVGG  326

Query  215  IMRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESA  75
            ++  + + P++++++  L   L FA   G I+    GA+   PT+ A
Sbjct  327  LLNSMASDPDIYQDEKKLRNALLFANGCGAITVTEKGAIPALPTKEA  373



>emb|CBI36689.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 106/229 (46%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            ELNL +++ A++FH+ S  L      S   +A+  +K+ G L+ +D NL LPLW S +E 
Sbjct  7    ELNLELIRSAKVFHYGSISLIVEPCRSAHLRAMEVAKEAGALLSYDPNLRLPLWPSAEEA  66

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E I   WE+A++I+VS  ELEFL   D  +                            E
Sbjct  67   REQIMSIWEKAEVIKVSDVELEFLTGSDKVDD---------------------------E  99

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                LWH  LK   VT G     YYT +F G V G         T D TG+GD+ V  ++
Sbjct  100  TALSLWHPGLKLFLVTLGEKGCRYYTKNFHGAVEG-----FHVKTVDTTGAGDSFVGALL  154

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             K+     + E++  L   L+FA + G I+    GA+   P E+   +L
Sbjct  155  CKIVDDQSVLEDEARLREVLKFANACGAITTTKKGAIPALPAEADVLSL  203



>ref|XP_003622348.1| Fructokinase-2 [Medicago truncatula]
 gb|KEH42831.1| pfkB family carbohydrate kinase [Medicago truncatula]
Length=327

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 107/228 (47%), Gaps = 32/228 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SEL + ++K  +IFH+ S  L S    S    A+  +++ G L+ +D N+ LPLW S D 
Sbjct  123  SELKMDMIKSTKIFHYGSISLISEPCRSAHMAAMKAAREGGALLSYDPNVRLPLWPSADA  182

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                IK  W +AD I+VS  E++FL  +D         P+                  + 
Sbjct  183  ARSGIKSIWNEADFIKVSDDEVQFLTQKD---------PE------------------NE  215

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHD+LK L +TDG     Y T +F+G V G     I     D TG+GD+ V  +
Sbjct  216  EVVMSLWHDKLKLLIITDGEKGCRYVTKNFKGRVSGFSVKAI-----DTTGAGDSFVGAL  270

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQ  69
            +R +     +FE++  L   L FA + G +     GA+   PT    Q
Sbjct  271  LRDVARDTSIFEDEPKLRETLTFANACGAMCTTQKGAIPALPTAEEAQ  318



>ref|XP_010908109.1| PREDICTED: fructokinase-2-like [Elaeis guineensis]
Length=331

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 112/229 (49%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            EL+L++++ A+IFH+ S  L +    S    A+  +K+ G L+ +D N+ LPLW S++  
Sbjct  130  ELDLSLIRSAKIFHYGSISLIAEPCRSAHLAAMRAAKEAGVLLSYDPNVRLPLWPSQEAA  189

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             + I   W++AD I+VS  E+ FL   D         PQ                  S +
Sbjct  190  RDGIMSIWKEADFIKVSDDEVAFLTQGD---------PQ------------------SED  222

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
             V  LW+D LK L VTDG     Y+T +F+G V G      +  T D TG+GDA V  ++
Sbjct  223  VVMKLWYDGLKLLIVTDGEKGCRYFTKNFKGKVPG-----FSVKTVDTTGAGDAFVGSLL  277

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
              +     +F N++ L+  LRF+ + G I     GA+   P  S  Q L
Sbjct  278  VSIAKDDSLFHNEEKLKEVLRFSNACGAICTTQKGAIPALPNTSMAQEL  326



>ref|XP_001762258.1| predicted protein [Physcomitrella patens]
 gb|EDQ73050.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 109/229 (48%), Gaps = 32/229 (14%)
 Frame = -1

Query  749  ELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDET  570
            EL+  +LK+A I H+ S  L +    ST  +A+  +K+ G L+ +D NL L LW S    
Sbjct  137  ELDTDLLKQASILHYGSISLITEPSRSTHLEAMRIAKEAGALLSYDPNLRLALWPSAAAA  196

Query  569  WEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSRE  390
             E IK  WE+ADII+VS  E+ FL D D  + + N K                       
Sbjct  197  KEGIKSIWERADIIKVSDEEVVFLTDGDPKDDQNNMK-----------------------  233

Query  389  EVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGIM  210
                ++H R K + VT+G     YYTP F G V G +  ++     D TG+GDA  AG++
Sbjct  234  ----MFHPRCKLMLVTEGGEGCRYYTPKFRGHVNGVKVQVV-----DTTGAGDAFCAGLL  284

Query  209  RKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
             +L   P + +++  L   L FA + G I+    GA+   P +     L
Sbjct  285  SQLAVVPSIIDDEPKLRNALTFANACGAITTTERGAIPALPDKDTVLRL  333



>ref|XP_009404933.1| PREDICTED: fructokinase-2-like [Musa acuminata subsp. malaccensis]
Length=328

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/230 (33%), Positives = 107/230 (47%), Gaps = 32/230 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELNL+++K A+IFH+ S  L S    S    A+  +K+ G L+ +D N  LPLW S + 
Sbjct  126  SELNLSLIKHAKIFHYGSISLISEPCRSAHLAAMRAAKEAGALLSYDPNARLPLWPSEEA  185

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
                I+  W +AD I++S  E+ FL  +D         PQ                  S 
Sbjct  186  ARAGIRSIWTEADFIKISDEEVAFLTQDD---------PQ------------------SE  218

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LW D LK + VTDG     Y+T  F+G V G         T D TG+GDA +  +
Sbjct  219  EVVMSLWSDGLKLMVVTDGEKGCRYFTKDFKGRVPGYR-----VNTVDTTGAGDAFLGAL  273

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTESATQNL  63
            +  +     +F+N+  L   L+ A ++G I     GA+   PT  A   L
Sbjct  274  LSSIANDTSLFQNEGKLREALKVANASGAICTTRKGAIPALPTMPAATEL  323



>ref|XP_004290279.1| PREDICTED: probable fructokinase-5 [Fragaria vesca subsp. vesca]
Length=323

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 104/225 (46%), Gaps = 32/225 (14%)
 Frame = -1

Query  752  SELNLAVLKEARIFHFNSEVLTSPTMHSTLFKAISWSKKFGGLIFFDLNLPLPLWKSRDE  573
            SELN+ ++K+A+IFH+ S  L S    S    A+  +K  G L+ +D N+ LPLW S D 
Sbjct  120  SELNMDLIKKAKIFHYGSISLISEPCKSAHMAAMKAAKDAGILLSYDPNVRLPLWPSADA  179

Query  572  TWEVIKGAWEQADIIEVSRSELEFLLDEDHYEHKRNYKPQYFAEDFQQTRKIRNYYHYSR  393
              + IK  W QAD I+VS  E++FL   D  +                            
Sbjct  180  ARDGIKSIWNQADFIKVSDDEVQFLTQGDPNKE---------------------------  212

Query  392  EEVAPLWHDRLKFLFVTDGTLRLHYYTPSFEGVVVGTEDVLITPFTCDRTGSGDAVVAGI  213
            E V  LWHD LK L VTDG     Y+T  F+G V G         T D TG+GDA V   
Sbjct  213  EVVLSLWHDNLKLLIVTDGEKGCRYFTKKFKGNVTG-----FAVKTVDTTGAGDAFVGSF  267

Query  212  MRKLTTQPEMFENQDVLERQLRFAISAGIISQWTIGAVRGFPTES  78
            +  +     +FE++  L   L FA + G I     GA+   P ES
Sbjct  268  LLSMAKDLSIFEDEAKLTEALSFANACGAICTTQKGAIPALPAES  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840