BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF014A22

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07185.1|  unnamed protein product                                313   1e-98   Coffea canephora [robusta coffee]
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    306   3e-96   Nicotiana tomentosiformis
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    303   4e-95   Nicotiana sylvestris
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      304   4e-95   
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    303   5e-95   Solanum tuberosum [potatoes]
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    304   7e-95   Glycine max [soybeans]
gb|KHN28317.1|  ABC transporter G family member 14                      303   8e-95   Glycine soja [wild soybean]
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    303   1e-94   Glycine max [soybeans]
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    302   2e-94   Sesamum indicum [beniseed]
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             302   2e-94   Phaseolus vulgaris [French bean]
gb|AES95438.2|  white-brown-complex ABC transporter family protein      298   8e-93   Medicago truncatula
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      298   1e-92   Vitis vinifera
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      298   1e-92   Nelumbo nucifera [Indian lotus]
ref|XP_003612480.1|  ABC transporter-like protein                       298   1e-92   
emb|CAN70956.1|  hypothetical protein VITISV_028138                     298   2e-92   Vitis vinifera
gb|KDP37809.1|  hypothetical protein JCGZ_06711                         286   2e-92   Jatropha curcas
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      296   7e-92   Tarenaya hassleriana [spider flower]
gb|KJB51502.1|  hypothetical protein B456_008G219500                    295   1e-91   Gossypium raimondii
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    295   1e-91   Glycine max [soybeans]
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    295   1e-91   Sesamum indicum [beniseed]
gb|KHN16959.1|  ABC transporter G family member 14                      293   1e-91   Glycine soja [wild soybean]
gb|EYU37490.1|  hypothetical protein MIMGU_mgv1a026680mg                291   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      294   2e-91   Tarenaya hassleriana [spider flower]
gb|KHG20314.1|  ABC transporter G family member 14                      295   2e-91   Gossypium arboreum [tree cotton]
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    294   3e-91   Cicer arietinum [garbanzo]
ref|XP_007040852.1|  ATP-binding cassette 14                            294   3e-91   Theobroma cacao [chocolate]
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      294   3e-91   Brassica rapa
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             293   6e-91   Phaseolus vulgaris [French bean]
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    293   8e-91   Brassica rapa
emb|CDY47690.1|  BnaCnng15320D                                          293   8e-91   Brassica napus [oilseed rape]
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    293   8e-91   Camelina sativa [gold-of-pleasure]
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    293   9e-91   Glycine max [soybeans]
ref|XP_006385164.1|  ABC transporter family protein                     293   1e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      292   1e-90   Camelina sativa [gold-of-pleasure]
emb|CDY12299.1|  BnaA09g24990D                                          294   1e-90   Brassica napus [oilseed rape]
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      292   2e-90   Eucalyptus grandis [rose gum]
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             292   2e-90   Capsella rubella
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    291   3e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 14      291   3e-90   Fragaria vesca subsp. vesca
ref|NP_564383.1|  ABC transporter G family member 14                    291   4e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             290   7e-90   Eutrema salsugineum [saltwater cress]
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 1...    290   9e-90   Cucumis sativus [cucumbers]
ref|XP_004164431.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    290   9e-90   
ref|XP_002893685.1|  abc transporter family protein                     290   9e-90   
gb|KJB25133.1|  hypothetical protein B456_004G178100                    289   2e-89   Gossypium raimondii
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      289   2e-89   Cucumis melo [Oriental melon]
gb|KJB25132.1|  hypothetical protein B456_004G178100                    289   3e-89   Gossypium raimondii
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             288   6e-89   Citrus clementina [clementine]
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         287   1e-88   Jatropha curcas
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      287   2e-88   Prunus mume [ume]
ref|XP_010111780.1|  ABC transporter G family member 14                 287   2e-88   Morus notabilis
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         286   3e-88   Ricinus communis
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    288   4e-88   
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                285   6e-88   Erythranthe guttata [common monkey flower]
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    285   7e-88   Arabis alpina [alpine rockcress]
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    285   7e-88   Citrus sinensis [apfelsine]
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   285   8e-88   Citrus sinensis [apfelsine]
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    288   9e-88   
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      285   9e-88   Malus domestica [apple tree]
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             285   1e-87   
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    283   4e-87   Nelumbo nucifera [Indian lotus]
gb|KHG16348.1|  ABC transporter G family member 14                      283   7e-87   Gossypium arboreum [tree cotton]
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    274   4e-84   
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...    275   6e-84   
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    275   1e-83   Solanum lycopersicum
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    274   1e-83   Solanum lycopersicum
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...    275   1e-83   Elaeis guineensis
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    274   1e-83   Solanum tuberosum [potatoes]
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    274   1e-83   Solanum tuberosum [potatoes]
ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    274   2e-83   Nicotiana sylvestris
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...    274   2e-83   Elaeis guineensis
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...    273   3e-83   Elaeis guineensis
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      273   3e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    270   7e-82   Nicotiana tomentosiformis
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...    269   8e-82   
ref|XP_010910172.1|  PREDICTED: ABC transporter G family member 1...    269   1e-81   
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...    268   5e-81   Phoenix dactylifera
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...    265   2e-80   Phoenix dactylifera
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    263   2e-79   Populus euphratica
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             262   6e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14      261   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    260   3e-78   Populus euphratica
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...    254   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659869.1|  PREDICTED: ABC transporter G family member 1...    235   1e-71   
ref|NP_001182828.1|  hypothetical protein                               232   6e-71   
dbj|BAJ97566.1|  predicted protein                                      240   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95904.1|  predicted protein                                      240   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008390022.1|  PREDICTED: ABC transporter G family member 2...    231   3e-70   
gb|EEC82957.1|  hypothetical protein OsI_27950                          238   2e-69   Oryza sativa Indica Group [Indian rice]
gb|EAZ41641.1|  hypothetical protein OsJ_26175                          238   3e-69   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC99536.1|  putative ABC transporter AbcG1                         238   3e-69   Oryza sativa Japonica Group [Japonica rice]
gb|AFW57205.1|  hypothetical protein ZEAMMB73_095241                    233   1e-68   
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...    235   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_008662280.1|  PREDICTED: hypothetical protein isoform X1         234   6e-68   
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...    233   8e-68   Pyrus x bretschneideri [bai li]
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...    232   1e-67   
gb|KDP29341.1|  hypothetical protein JCGZ_18262                         232   2e-67   Jatropha curcas
ref|XP_003573439.1|  PREDICTED: ABC transporter G family member 14      232   3e-67   Brachypodium distachyon [annual false brome]
gb|EMS54909.1|  ABC transporter G family member 14                      224   6e-67   Triticum urartu
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...    229   1e-66   
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...    229   2e-66   
ref|XP_010096709.1|  ABC transporter G family member 14                 226   1e-65   
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...    224   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             224   1e-64   
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...    224   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...    223   2e-64   Nelumbo nucifera [Indian lotus]
gb|KHN07535.1|  ABC transporter G family member 21                      221   3e-64   Glycine soja [wild soybean]
gb|EPS63929.1|  hypothetical protein M569_10851                         223   3e-64   Genlisea aurea
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      223   3e-64   Prunus mume [ume]
ref|XP_004972751.1|  PREDICTED: ABC transporter G family member 1...    224   4e-64   Setaria italica
gb|KHN07718.1|  ABC transporter G family member 21                      220   2e-63   Glycine soja [wild soybean]
ref|XP_002443920.1|  hypothetical protein SORBIDRAFT_07g004390          222   2e-63   Sorghum bicolor [broomcorn]
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             221   2e-63   Populus trichocarpa [western balsam poplar]
gb|KHN37813.1|  ABC transporter G family member 21                      221   3e-63   Glycine soja [wild soybean]
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...    221   3e-63   Glycine max [soybeans]
gb|AIU41651.1|  ABC transporter family protein                          219   8e-63   Hevea brasiliensis [jebe]
ref|XP_002524381.1|  ATP-binding cassette transporter, putative         219   1e-62   
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...    218   2e-62   Cicer arietinum [garbanzo]
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             218   4e-62   Phaseolus vulgaris [French bean]
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...    218   4e-62   
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...    218   4e-62   Tarenaya hassleriana [spider flower]
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21      216   1e-61   Populus euphratica
gb|KHN00888.1|  ABC transporter G family member 21                      216   1e-61   Glycine soja [wild soybean]
ref|XP_003591854.1|  ABC transporter G family member                    216   1e-61   
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...    216   1e-61   Glycine max [soybeans]
ref|XP_007046353.1|  ABC-2 type transporter family protein              215   3e-61   
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...    214   1e-60   Glycine max [soybeans]
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 21      214   1e-60   Fragaria vesca subsp. vesca
ref|XP_010681458.1|  PREDICTED: ABC transporter G family member 21      206   2e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             213   2e-60   Phaseolus vulgaris [French bean]
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21      213   2e-60   Vitis vinifera
emb|CAN62390.1|  hypothetical protein VITISV_039480                     213   2e-60   Vitis vinifera
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    212   6e-60   Citrus sinensis [apfelsine]
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg             211   7e-60   Citrus clementina [clementine]
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                   211   7e-60   Citrus sinensis [apfelsine]
gb|KJB50814.1|  hypothetical protein B456_008G188000                    211   9e-60   Gossypium raimondii
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21      211   1e-59   Eucalyptus grandis [rose gum]
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      210   3e-59   Sesamum indicum [beniseed]
emb|CDP00551.1|  unnamed protein product                                209   4e-59   Coffea canephora [robusta coffee]
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg             208   9e-59   Eutrema salsugineum [saltwater cress]
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...    208   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006855537.1|  hypothetical protein AMTR_s00057p00214480          206   3e-58   
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...    206   6e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727             206   6e-58   Arabidopsis lyrata subsp. lyrata
emb|CAN62144.1|  hypothetical protein VITISV_007841                     205   8e-58   Vitis vinifera
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg             206   9e-58   Capsella rubella
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...    206   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       204   2e-57   Vitis vinifera
gb|EMT29518.1|  hypothetical protein F775_52365                         202   3e-57   
emb|CDY48079.1|  BnaA06g33490D                                          204   5e-57   Brassica napus [oilseed rape]
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      203   6e-57   Brassica rapa
emb|CDY46506.1|  BnaA02g27560D                                          203   6e-57   Brassica napus [oilseed rape]
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...    203   7e-57   Brassica rapa
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                    202   1e-56   Arabis alpina [alpine rockcress]
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    202   2e-56   Nicotiana tomentosiformis
emb|CDX99764.1|  BnaC02g35560D                                          202   2e-56   
gb|KDP27016.1|  hypothetical protein JCGZ_20951                         201   2e-56   Jatropha curcas
emb|CDY51602.1|  BnaCnng21050D                                          201   3e-56   Brassica napus [oilseed rape]
gb|EYU26406.1|  hypothetical protein MIMGU_mgv1a004006mg                199   4e-56   Erythranthe guttata [common monkey flower]
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    201   5e-56   Nicotiana sylvestris
ref|XP_006878615.1|  hypothetical protein AMTR_s00011p00258490          200   8e-56   Amborella trichopoda
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...    200   8e-56   Nicotiana sylvestris
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                199   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    198   3e-55   Nicotiana sylvestris
ref|NP_001189973.1|  ABC transporter G family member 21                 199   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    198   5e-55   Solanum tuberosum [potatoes]
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       197   6e-55   Nicotiana tomentosiformis
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       197   6e-55   Eucalyptus grandis [rose gum]
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       197   7e-55   Sesamum indicum [beniseed]
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      197   8e-55   Solanum lycopersicum
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...    199   2e-54   Nelumbo nucifera [Indian lotus]
emb|CDP05875.1|  unnamed protein product                                196   3e-54   Coffea canephora [robusta coffee]
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    196   3e-54   Solanum tuberosum [potatoes]
gb|KHG01243.1|  ABC transporter G family member 9                       195   4e-54   Gossypium arboreum [tree cotton]
gb|KJB62742.1|  hypothetical protein B456_009G433300                    195   5e-54   Gossypium raimondii
ref|XP_010502438.1|  PREDICTED: ABC transporter G family member 2...    183   1e-53   
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      194   1e-53   Nicotiana tomentosiformis
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21      194   2e-53   Cucumis melo [Oriental melon]
gb|AFK38841.1|  unknown                                                 181   3e-53   Lotus japonicus
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    193   3e-53   Nicotiana tomentosiformis
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       192   3e-53   
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       192   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    192   5e-53   Prunus mume [ume]
ref|XP_004170842.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    192   5e-53   
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             192   6e-53   
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    192   6e-53   Solanum lycopersicum
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    192   7e-53   Nicotiana sylvestris
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    191   8e-53   Phoenix dactylifera
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    191   1e-52   
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    194   1e-52   
ref|XP_004139018.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    191   1e-52   
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    191   1e-52   Populus euphratica
gb|KGN61520.1|  hypothetical protein Csa_2G153580                       191   1e-52   Cucumis sativus [cucumbers]
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       190   2e-52   Prunus mume [ume]
ref|XP_007021331.1|  White-brown-complex ABC transporter family         190   2e-52   
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             190   2e-52   Prunus persica
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    190   3e-52   Tarenaya hassleriana [spider flower]
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             190   3e-52   
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    189   5e-52   
ref|XP_001780064.1|  ATP-binding cassette transporter, subfamily ...    188   9e-52   
gb|KDP27020.1|  hypothetical protein JCGZ_20955                         187   1e-51   Jatropha curcas
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9       188   2e-51   Elaeis guineensis
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    186   1e-50   Glycine max [soybeans]
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    185   2e-50   
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    185   2e-50   Solanum tuberosum [potatoes]
gb|KHN36795.1|  ABC transporter G family member 9                       184   3e-50   Glycine soja [wild soybean]
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       184   6e-50   Brassica rapa
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    183   1e-49   
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    183   1e-49   Sesamum indicum [beniseed]
emb|CDY29304.1|  BnaC01g19560D                                          181   4e-49   Brassica napus [oilseed rape]
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       181   5e-49   Solanum lycopersicum
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       181   7e-49   
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9       179   3e-48   Fragaria vesca subsp. vesca
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             179   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         178   4e-48   Ricinus communis
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...    178   5e-48   Citrus sinensis [apfelsine]
emb|CDY29837.1|  BnaA03g48580D                                          177   1e-47   Brassica napus [oilseed rape]
emb|CDX92829.1|  BnaC07g40870D                                          177   1e-47   
ref|XP_006441201.1|  hypothetical protein CICLE_v10023692mg             177   1e-47   
ref|XP_006447786.1|  hypothetical protein CICLE_v10017645mg             176   2e-47   
gb|EPS69022.1|  hypothetical protein M569_05746                         176   2e-47   Genlisea aurea
gb|KDP27018.1|  hypothetical protein JCGZ_20953                         171   3e-47   Jatropha curcas
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    176   3e-47   Brassica rapa
gb|KJB13426.1|  hypothetical protein B456_002G073600                    176   5e-47   Gossypium raimondii
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      175   5e-47   Medicago truncatula
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...    175   6e-47   
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    174   1e-46   Camelina sativa [gold-of-pleasure]
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    174   2e-46   Arabis alpina [alpine rockcress]
ref|XP_002316916.1|  ABC transporter family protein                     174   2e-46   
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       173   3e-46   Camelina sativa [gold-of-pleasure]
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             173   3e-46   Phaseolus vulgaris [French bean]
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      173   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg             173   3e-46   Citrus clementina [clementine]
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    172   7e-46   Populus euphratica
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    172   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    171   2e-45   
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             171   3e-45   Capsella rubella
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             170   4e-45   Phaseolus vulgaris [French bean]
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...    170   6e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194472.3|  ABC transporter G family member 9                     169   8e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43874.1|  putative protei                                        169   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    169   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN08925.1|  ABC transporter G family member 9                       169   1e-44   Glycine soja [wild soybean]
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    169   1e-44   Glycine max [soybeans]
ref|XP_011096967.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    168   3e-44   
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...    168   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002867504.1|  abc transporter family protein                     167   4e-44   
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      167   4e-44   Nicotiana tomentosiformis
ref|XP_004134251.1|  PREDICTED: ABC transporter G family member 9...    167   5e-44   Cucumis sativus [cucumbers]
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...    167   7e-44   Elaeis guineensis
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      167   7e-44   Nicotiana sylvestris
ref|XP_008452359.1|  PREDICTED: ABC transporter G family member 9...    165   2e-43   
gb|KGN56224.1|  hypothetical protein Csa_3G102320                       165   2e-43   Cucumis sativus [cucumbers]
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    165   3e-43   Cucumis sativus [cucumbers]
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25      165   4e-43   Elaeis guineensis
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      164   4e-43   Solanum lycopersicum
gb|EYU22839.1|  hypothetical protein MIMGU_mgv1a002620mg                164   8e-43   Erythranthe guttata [common monkey flower]
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    163   1e-42   
ref|XP_006376282.1|  hypothetical protein POPTR_0013s11640g             157   1e-42   
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    163   2e-42   Cicer arietinum [garbanzo]
gb|KDO40886.1|  hypothetical protein CISIN_1g046786mg                   162   2e-42   Citrus sinensis [apfelsine]
gb|KHN46331.1|  ABC transporter G family member 9                       162   2e-42   Glycine soja [wild soybean]
gb|EMS45576.1|  ABC transporter G family member 25                      155   2e-42   Triticum urartu
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...    162   2e-42   Glycine max [soybeans]
tpg|DAA38971.1|  TPA: hypothetical protein ZEAMMB73_519748              155   2e-42   
gb|ABR17189.1|  unknown                                                 163   3e-42   Picea sitchensis
gb|EMT03545.1|  ABC transporter G family member 25                      158   8e-42   
gb|KJB35858.1|  hypothetical protein B456_006G130900                    159   4e-41   Gossypium raimondii
emb|CDX96365.1|  BnaA07g29760D                                          156   4e-41   
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    158   4e-41   
gb|KDO74147.1|  hypothetical protein CISIN_1g010509mg                   158   4e-41   Citrus sinensis [apfelsine]
ref|XP_006841289.1|  hypothetical protein AMTR_s00134p00069640          159   5e-41   
gb|KJB60113.1|  hypothetical protein B456_009G290300                    159   5e-41   Gossypium raimondii
gb|KEH43567.1|  white-brown-complex ABC transporter family protein      159   6e-41   Medicago truncatula
emb|CBI20349.3|  unnamed protein product                                158   6e-41   Vitis vinifera
gb|KHG11002.1|  ABC transporter G family member 25                      158   6e-41   Gossypium arboreum [tree cotton]
dbj|BAJ94414.1|  predicted protein                                      158   8e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004496375.1|  PREDICTED: ABC transporter G family member 2...    158   8e-41   Cicer arietinum [garbanzo]
ref|XP_006301540.1|  hypothetical protein CARUB_v10021973mg             154   8e-41   
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      158   9e-41   
gb|KHG09588.1|  ABC transporter G family member 25                      157   1e-40   
ref|XP_002534493.1|  ATP-binding cassette transporter, putative         157   2e-40   
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g             157   2e-40   
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    157   2e-40   
ref|XP_004978848.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    157   2e-40   
emb|CDX72849.1|  BnaC06g32970D                                          157   2e-40   
ref|XP_006390724.1|  hypothetical protein EUTSA_v10019071mg             150   3e-40   
ref|XP_002325552.2|  ABC transporter family protein                     156   3e-40   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      156   3e-40   
gb|KHN17077.1|  ABC transporter G family member 25                      155   4e-40   
ref|XP_010105155.1|  ABC transporter G family member 25                 156   4e-40   
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    155   6e-40   
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...    155   8e-40   
ref|XP_001763976.1|  ATP-binding cassette transporter, subfamily ...    155   8e-40   
ref|NP_001065886.1|  Os11g0177400                                       154   9e-40   
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...    155   9e-40   
ref|NP_001136485.1|  uncharacterized protein LOC100216600               148   1e-39   
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    156   1e-39   
ref|XP_007019996.1|  ATP-binding casette family G25 isoform 1           152   1e-39   
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    156   1e-39   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    154   2e-39   
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                    154   2e-39   
ref|XP_003562060.1|  PREDICTED: ABC transporter G family member 2...    155   2e-39   
gb|KCW69055.1|  hypothetical protein EUGRSUZ_F02609                     153   2e-39   
ref|XP_002450415.1|  hypothetical protein SORBIDRAFT_05g004940          154   2e-39   
gb|AAX96020.1|  ABC transporter protein, putative                       154   2e-39   
ref|XP_007019995.1|  ATP-binding casette family G25                     154   2e-39   
ref|XP_004173013.1|  PREDICTED: ABC transporter G family member 2...    150   2e-39   
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             155   2e-39   
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     153   3e-39   
gb|EEC67784.1|  hypothetical protein OsI_35326                          154   3e-39   
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    153   3e-39   
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    153   4e-39   
ref|XP_007028064.1|  White-brown-complex ABC transporter family i...    154   5e-39   
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    153   5e-39   
emb|CDX68292.1|  BnaA07g23320D                                          153   6e-39   
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    152   6e-39   
ref|XP_011074938.1|  PREDICTED: ABC transporter G family member 2...    152   7e-39   
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    152   8e-39   
ref|XP_009104883.1|  PREDICTED: ABC transporter G family member 2...    152   9e-39   
ref|NP_001147989.1|  ATPase, coupled to transmembrane movement of...    152   1e-38   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    152   1e-38   
ref|XP_010553412.1|  PREDICTED: ABC transporter G family member 2...    151   1e-38   
ref|XP_009375288.1|  PREDICTED: ABC transporter G family member 2...    151   1e-38   
gb|EMT07325.1|  ABC transporter G family member 22                      151   1e-38   
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    152   2e-38   
gb|KDP43365.1|  hypothetical protein JCGZ_25470                         152   2e-38   
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25      152   2e-38   
ref|XP_006854611.1|  hypothetical protein AMTR_s00030p00144980          152   2e-38   
gb|EMS65761.1|  ABC transporter G family member 22                      152   2e-38   
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      152   2e-38   
ref|XP_007221428.1|  hypothetical protein PRUPE_ppa019498mg             148   3e-38   
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...    151   3e-38   
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    152   3e-38   
ref|XP_004139680.1|  PREDICTED: ABC transporter G family member 2...    150   3e-38   
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    151   4e-38   
ref|XP_010553410.1|  PREDICTED: ABC transporter G family member 2...    151   4e-38   
emb|CDX82199.1|  BnaC02g20910D                                          150   4e-38   
gb|KGN44483.1|  hypothetical protein Csa_7G307400                       150   4e-38   
ref|XP_010428049.1|  PREDICTED: ABC transporter G family member 25      150   4e-38   
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25      150   5e-38   
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    151   5e-38   
emb|CDP08055.1|  unnamed protein product                                150   5e-38   
ref|XP_010521140.1|  PREDICTED: ABC transporter G family member 2...    150   5e-38   
emb|CDP16843.1|  unnamed protein product                                150   5e-38   
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    151   6e-38   
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    151   6e-38   
gb|EEC74548.1|  hypothetical protein OsI_10084                          151   7e-38   
emb|CDX98933.1|  BnaC09g49020D                                          150   7e-38   
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...    150   7e-38   
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    150   8e-38   
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326             149   8e-38   
ref|NP_001049014.1|  Os03g0157400                                       150   8e-38   
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    151   9e-38   
gb|KJB16513.1|  hypothetical protein B456_002G233500                    149   1e-37   
emb|CDY03668.1|  BnaA02g15690D                                          150   1e-37   
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...    149   1e-37   
ref|XP_002322764.1|  ABC transporter family protein                     150   1e-37   
gb|KJB16514.1|  hypothetical protein B456_002G233500                    149   1e-37   
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    150   1e-37   
gb|KHG09828.1|  ABC transporter G family member 22                      149   1e-37   
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                150   1e-37   
dbj|BAK06297.1|  predicted protein                                      150   1e-37   
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      149   2e-37   
dbj|BAJ88390.1|  predicted protein                                      150   2e-37   
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          150   2e-37   
ref|XP_010503974.1|  PREDICTED: ABC transporter G family member 2...    148   2e-37   
gb|AAK63861.1|AF389289_1  AT5g06530/F15M7_6                             147   2e-37   
ref|XP_006663256.1|  PREDICTED: ABC transporter G family member 2...    148   2e-37   
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    149   2e-37   
gb|KJB16511.1|  hypothetical protein B456_002G233500                    148   2e-37   
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    149   2e-37   
gb|KEH41804.1|  white-brown-complex ABC transporter family protein      147   3e-37   
gb|KJB14994.1|  hypothetical protein B456_002G153900                    149   3e-37   
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      149   3e-37   
emb|CDY36671.1|  BnaCnng07730D                                          144   4e-37   
ref|XP_006826407.1|  hypothetical protein AMTR_s00004p00153830          146   4e-37   
gb|KJB16512.1|  hypothetical protein B456_002G233500                    149   4e-37   
ref|XP_010503973.1|  PREDICTED: ABC transporter G family member 2...    148   5e-37   
ref|XP_010653240.1|  PREDICTED: ABC transporter G family member 2...    147   5e-37   
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    148   5e-37   
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25      147   6e-37   
ref|XP_010248083.1|  PREDICTED: ABC transporter G family member 2...    148   6e-37   
ref|XP_004985645.1|  PREDICTED: ABC transporter G family member 2...    148   7e-37   
gb|KJB36224.1|  hypothetical protein B456_006G147000                    147   7e-37   
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             148   7e-37   
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    148   8e-37   
ref|XP_004985644.1|  PREDICTED: ABC transporter G family member 2...    147   1e-36   
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         147   1e-36   
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      147   1e-36   
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...    147   1e-36   
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             147   2e-36   
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      146   2e-36   
emb|CBI39105.3|  unnamed protein product                                146   2e-36   
ref|NP_568169.1|  ABC transporter G family member 22                    146   3e-36   
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...    146   3e-36   
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...    146   3e-36   
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...    146   3e-36   
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    146   3e-36   
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    146   3e-36   
emb|CDX95330.1|  BnaC04g28280D                                          146   3e-36   
gb|AAG52231.1|AC021665_14  putative ABC transporter; 60211-54925        145   3e-36   
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      145   3e-36   
dbj|BAH57205.1|  AT1G71960                                              145   3e-36   
emb|CDY23205.1|  BnaA04g05540D                                          146   4e-36   
gb|KJB36225.1|  hypothetical protein B456_006G147000                    146   4e-36   
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    145   4e-36   
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             145   4e-36   
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...    145   5e-36   
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...    145   5e-36   
emb|CBI18157.3|  unnamed protein product                                144   5e-36   
ref|NP_190799.2|  ABC transporter G family member 27                    145   6e-36   
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...    144   7e-36   
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    145   7e-36   
gb|AAK92745.1|  putative ABC transporter protein                        144   8e-36   
ref|NP_565030.1|  ABC transporter G family member 25                    144   8e-36   
tpg|DAA43438.1|  TPA: hypothetical protein ZEAMMB73_582925              145   8e-36   
gb|KHN10345.1|  ABC transporter G family member 27                      144   8e-36   
ref|XP_002873263.1|  abc transporter family protein                     145   9e-36   
ref|XP_002876135.1|  abc transporter family protein                     145   1e-35   
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    145   1e-35   
gb|KEH41808.1|  white-brown-complex ABC transporter family protein      143   1e-35   
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             144   1e-35   
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...    143   1e-35   
gb|KDO83899.1|  hypothetical protein CISIN_1g0057541mg                  140   2e-35   
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    144   2e-35   
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      144   2e-35   
ref|XP_006434602.1|  hypothetical protein CICLE_v10003863mg             140   2e-35   
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    144   2e-35   
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    144   2e-35   
ref|XP_007163008.1|  hypothetical protein PHAVU_001G198400g             142   2e-35   
ref|XP_002526137.1|  ATP-binding cassette transporter, putative         143   2e-35   
emb|CDY14079.1|  BnaC02g01960D                                          143   4e-35   
gb|KJB14993.1|  hypothetical protein B456_002G153900                    143   4e-35   
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    143   4e-35   
emb|CDX70095.1|  BnaA10g24440D                                          143   4e-35   
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    143   4e-35   
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    143   5e-35   
gb|KHG30511.1|  ABC transporter G family member 22                      142   5e-35   
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    142   7e-35   
emb|CDY04991.1|  BnaAnng01730D                                          142   9e-35   
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...    141   1e-34   
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             142   1e-34   
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    142   1e-34   
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    142   1e-34   
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                    140   1e-34   
ref|XP_010248096.1|  PREDICTED: ABC transporter G family member 2...    140   1e-34   
gb|KDP36071.1|  hypothetical protein JCGZ_08715                         142   1e-34   
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    141   2e-34   
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    141   2e-34   
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    141   2e-34   
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      141   2e-34   
emb|CBI35490.3|  unnamed protein product                                141   2e-34   
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    141   2e-34   
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...    140   3e-34   
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    139   4e-34   
ref|XP_003577777.2|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    139   4e-34   
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...    139   5e-34   
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...    138   8e-34   
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    139   1e-33   
gb|KDP43029.1|  hypothetical protein JCGZ_25215                         139   1e-33   
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    138   2e-33   
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    138   2e-33   
ref|XP_007019433.1|  White-brown-complex ABC transporter family         136   2e-32   
emb|CDP10560.1|  unnamed protein product                                135   2e-32   
ref|XP_004161297.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    134   2e-32   
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    135   3e-32   
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    135   3e-32   
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    134   3e-32   
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    134   4e-32   
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 2...    134   6e-32   
ref|XP_010535206.1|  PREDICTED: ABC transporter G family member 2...    132   2e-31   
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  131   2e-31   
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             131   2e-31   
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  130   4e-31   
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    130   9e-31   
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             130   1e-30   
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    130   2e-30   
gb|EPS64050.1|  hypothetical protein M569_10730                         127   4e-30   
ref|XP_006346115.1|  PREDICTED: ABC transporter G family member 2...    127   1e-29   
gb|EPS59306.1|  hypothetical protein M569_15501                         126   1e-29   
emb|CDY12359.1|  BnaC08g08460D                                          122   2e-29   
ref|XP_006362828.1|  PREDICTED: ABC transporter G family member 2...    126   5e-29   
ref|XP_004244029.1|  PREDICTED: ABC transporter G family member 26      125   5e-29   
ref|XP_002267511.2|  PREDICTED: ABC transporter G family member 26      125   7e-29   
ref|XP_008241115.1|  PREDICTED: ABC transporter G family member 2...    123   2e-28   
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    124   2e-28   
ref|XP_009781518.1|  PREDICTED: ABC transporter G family member 26      123   2e-28   
ref|XP_010676075.1|  PREDICTED: ABC transporter G family member 26      123   3e-28   
ref|XP_004303381.2|  PREDICTED: ABC transporter G family member 2...    124   3e-28   
gb|KJB19218.1|  hypothetical protein B456_003G089800                    122   4e-28   
emb|CAN73913.1|  hypothetical protein VITISV_035231                     122   4e-28   
gb|EYU27464.1|  hypothetical protein MIMGU_mgv1a002345mg                122   6e-28   
ref|XP_002309268.1|  ABC transporter family protein                     122   7e-28   
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    122   8e-28   
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             122   8e-28   
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    122   9e-28   
ref|XP_011095584.1|  PREDICTED: ABC transporter G family member 26      122   9e-28   
gb|AEP14526.1|  ABC transporter                                         117   1e-27   



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYP+YNAVFTFPQERRMLIKERSSGMY LSSYFLAKTVGDLPLELALPTAFTFI+YWMG
Sbjct  453  GFYPIYNAVFTFPQERRMLIKERSSGMYHLSSYFLAKTVGDLPLELALPTAFTFIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKPEP TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  513  GLKPEPATFILSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YCFKLLLGVQYN NDYYECSKG YCRVADFP VK+VG NH+W+D
Sbjct  573  QIPAFIVWLKYLSYSYYCFKLLLGVQYNGNDYYECSKGVYCRVADFPYVKSVGLNHLWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+M+VGYRFIAYLAL RVR
Sbjct  633  VSIMALMMVGYRFIAYLALRRVR  655



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   306 bits (785),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLP+ELALPTAFTFILYWMG
Sbjct  431  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMG  490

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P TF LSL+IVL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  491  GLKANPATFILSLVIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  550

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VADFP +K+VG N+MW+D
Sbjct  551  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVADFPAIKSVGLNNMWMD  610

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLAL+RVR
Sbjct  611  VLIMALMLVGYRLLAYLALNRVR  633



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLP+ELALPTAFTFILYWMG
Sbjct  428  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P TF LSLLIVL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  488  GLKANPATFILSLLIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY D DYYECSKG YCRVADFP +K+VG N+MW+D
Sbjct  548  QIPPFIVWLKYLSYSYYCYKLLLGVQYKDKDYYECSKGVYCRVADFPAIKSVGLNNMWMD  607

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLAL+RVR
Sbjct  608  VLIMALMLVGYRLVAYLALNRVR  630



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  444  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P TF LSLL+VL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  504  GLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VA+FP +K++G N+MW+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGLNNMWMD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL+RVR
Sbjct  624  VFIMALMLVGYRLIAYLALNRVR  646



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  444  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P TF LSLL+VL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  504  GLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VA+FP +K++G N+MW+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGLNNMWMD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL+RVR
Sbjct  624  VFIMALMLVGYRLIAYLALNRVR  646



>ref|XP_003517105.2| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=659

 Score =   304 bits (778),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  517  GLKPDPMTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSK   C+VADFP +K++G NH+WVD
Sbjct  577  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKEELCKVADFPPIKSMGLNHLWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  637  VCIMAMMLVGYRLVAYLALHRVR  659



>gb|KHN28317.1| ABC transporter G family member 14 [Glycine soja]
Length=659

 Score =   303 bits (777),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  517  GLKPDPMTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSK   C+VADFP +K++G NH+WVD
Sbjct  577  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKEELCKVADFPPIKSMGLNHLWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  637  VCIMAMMLVGYRLVAYLALHRVR  659



>ref|XP_003537708.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN41781.1| ABC transporter G family member 14 [Glycine soja]
Length=660

 Score =   303 bits (776),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  458  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  517

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  518  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  577

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYY+CS G  C+VADFP +K++G NH+WVD
Sbjct  578  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYQCSTGELCKVADFPPIKSMGLNHLWVD  637

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  638  VCIMAMMLVGYRLVAYLALHRVR  660



>ref|XP_011082193.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAFTFI YWMG
Sbjct  451  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFTFIFYWMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VLFSVLVSQSLGLAFGA+LMDVKQA TLASVTT+V LIAGGYYV+
Sbjct  511  GLKPDPATFILSLLVVLFSVLVSQSLGLAFGALLMDVKQAATLASVTTMVFLIAGGYYVR  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WL+YLSYS+YC++LLLG+QYN+NDYYEC+KG YCRVAD+P +KAVG +H+W+D
Sbjct  571  HIPPFIAWLRYLSYSYYCYRLLLGIQYNENDYYECAKGAYCRVADYPPIKAVGLSHLWID  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+M +MLVGYRFIAYLALHRVR
Sbjct  631  ISIMMLMLVGYRFIAYLALHRVR  653



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  456  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLV LIAGGYY+Q
Sbjct  516  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+VADFP +K++G NH+WVD
Sbjct  576  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVADFPPIKSMGLNHLWVD  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AY ALHRVR
Sbjct  636  VFIMALMLVGYRLVAYFALHRVR  658



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score =   298 bits (762),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  436  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLV LIAGGYY+Q
Sbjct  496  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DFP +K++G NHMWVD
Sbjct  556  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVMDFPPIKSMGLNHMWVD  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML GYR +AYLAL RVR
Sbjct  616  VFIMALMLFGYRLVAYLALRRVR  638



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF  I+YWMG
Sbjct  453  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  513  GLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+++DYYECSKG +CRV DFP VK+VG NH+W+D
Sbjct  573  QIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  633  VCIMALMLVGYRLVAYLALHRVQ  655



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAFT I+YWMGGLK
Sbjct  453  PLYNAVFTFPQERLMLIKERSSGMYRLSSYFLARTVGDLPMELALPTAFTIIIYWMGGLK  512

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P+  TF LS LIVL++VLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYYVQQIP
Sbjct  513  PDFTTFILSWLIVLYNVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  572

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYS+YC+K+LLGVQY++NDYYECS+G +CRVA+FP VKAVG NH+WVDVS+
Sbjct  573  PFIVWLKYLSYSYYCYKMLLGVQYSENDYYECSEGVFCRVAEFPAVKAVGLNHLWVDVSI  632

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MAMMLVGYR IAY+ALHRVR
Sbjct  633  MAMMLVGYRLIAYMALHRVR  652



>ref|XP_003612480.1| ABC transporter-like protein [Medicago truncatula]
Length=652

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  450  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  509

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLV LIAGGYY+Q
Sbjct  510  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  569

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DFP +K++G NHMWVD
Sbjct  570  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVMDFPPIKSMGLNHMWVD  629

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML GYR +AYLAL RVR
Sbjct  630  VFIMALMLFGYRLVAYLALRRVR  652



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   298 bits (763),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF  I+YWMG
Sbjct  473  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMG  532

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  533  GLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  592

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+++DYYECSKG +CRV DFP VK+VG NH+W+D
Sbjct  593  QIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID  652

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  653  VCIMALMLVGYRLVAYLALHRVQ  675



>gb|KDP37809.1| hypothetical protein JCGZ_06711 [Jatropha curcas]
Length=290

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  86   GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  145

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  146  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  205

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  206  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  265

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  266  VCIMALMLVGYRLVAYLALHRVQ  288



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   296 bits (757),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLV+Q LGLAFGA LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYNVLVAQGLGLAFGAFLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+YC+KLLLGVQY+D+DYYECSKG +CRV DFP VK++G N +W+D
Sbjct  565  HIPPFIVWLKYLSYSYYCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSMGLNSLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYRFIAY+ALHRV+
Sbjct  625  VSVMALMLVGYRFIAYMALHRVK  647



>gb|KJB51502.1| hypothetical protein B456_008G219500 [Gossypium raimondii]
Length=657

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERR+LIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  453  GFYPLYNAVFTFPQERRILIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  513  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY ++DYYECSKG +CRV D P +K++G +HMW+D
Sbjct  573  QIPAFIVWLKYLSYSYYCYKLLLGVQYKEDDYYECSKGVWCRVGDLPAIKSMGLSHMWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR IAY+ALHRVR
Sbjct  633  VSIMALMLVGYRLIAYMALHRVR  655



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  449  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  509  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQ+ND+DYYECSKG  C+V +FP +K+VG NH+WVD
Sbjct  569  QIPPFIEWLKYLSYSYYCYKLLVGVQFNDDDYYECSKGVLCKVGEFPQIKSVGLNHLWVD  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MAMMLVGYR IAYLAL RVR
Sbjct  629  VTIMAMMLVGYRLIAYLALLRVR  651



>ref|XP_011071699.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   295 bits (755),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLS+YFLA+TVGDLP+ELALPTAFTFI YWMG
Sbjct  451  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSAYFLARTVGDLPMELALPTAFTFIFYWMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQA TLASVTTLV LIAGGYYV+
Sbjct  511  GLKPDPSSFVLSLLVVLFSVLVSQSLGLAFGAILMDVKQAATLASVTTLVFLIAGGYYVR  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGV YN++DYYEC+K  YCRV+D+P +K+VG +H+W+D
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVHYNEDDYYECAKEVYCRVSDYPAIKSVGLSHLWMD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+M +MLVGYRFIAY+ALHRVR
Sbjct  631  MSIMVLMLVGYRFIAYIALHRVR  653



>gb|KHN16959.1| ABC transporter G family member 14 [Glycine soja]
Length=569

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  367  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMG  426

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  427  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  486

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQYND+D+YECSKG  C+V +FP +K+VG NH+WVD
Sbjct  487  QIPPFIEWLKYLSYSYYCYKLLVGVQYNDDDHYECSKGVLCKVGEFPPIKSVGLNHLWVD  546

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR IAYLAL R+R
Sbjct  547  VAIMALMLVGYRLIAYLALQRMR  569



>gb|EYU37490.1| hypothetical protein MIMGU_mgv1a026680mg [Erythranthe guttata]
Length=524

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAFTFI YWMG
Sbjct  322  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFTFIFYWMG  381

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLLIVLFSVLVSQ LGLAFGAILMDVKQA TLASVTT+V LIAGGYYV+
Sbjct  382  GLKADPITFILSLLIVLFSVLVSQGLGLAFGAILMDVKQAATLASVTTMVFLIAGGYYVR  441

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WLKYLSYS+YC++LLLGVQYN++D+YEC KG YCRVAD+P +KAVG + +WVD
Sbjct  442  HIPPFISWLKYLSYSYYCYRLLLGVQYNEDDFYECEKGVYCRVADYPAIKAVGLSDLWVD  501

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+M +MLVGYR IAYLAL RVR
Sbjct  502  VSIMMVMLVGYRLIAYLALQRVR  524



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  427  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  486

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  487  GLKPDPTTFILSLLVVLYNVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  546

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+D+DYYECSKG +CRV DFP VK++G N++W+D
Sbjct  547  QIPSFIVWLKYLSYSYYCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSMGLNNLWID  606

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AY+ALHRV+
Sbjct  607  VSVMALMLVGYRLVAYMALHRVK  629



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWM 
Sbjct  453  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMA  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  513  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY ++DYYECSKG +CRV D P +K++G +HMW+D
Sbjct  573  QIPAFIVWLKYLSYSYYCYKLLLGVQYKEDDYYECSKGVWCRVGDLPAIKSMGLSHMWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR IAY+ALHRVR
Sbjct  633  VSIMALMLVGYRLIAYMALHRVR  655



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  459  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  518

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+ +TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  519  GLKPDLVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  578

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DF  +K++G NHMWVD
Sbjct  579  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVVDFGPIKSMGLNHMWVD  638

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AY ALHRVR
Sbjct  639  VFIMALMLVGYRLVAYFALHRVR  661



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  512  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQYN++DYYECSKG  CRV D P +K++G NH+WVD
Sbjct  572  QIPAFIVWLKYLSYSYYCYKLLLGVQYNEDDYYECSKGVLCRVGDLPAIKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAY+ALHRVR
Sbjct  632  VCIMALMLVGYRLIAYMALHRVR  654



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   294 bits (752),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>ref|XP_007156346.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
 gb|ESW28340.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
Length=648

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF FI+YWMG
Sbjct  446  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVFIIYWMG  505

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P PLTF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  506  GLNPHPLTFFLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  565

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQY D+DYYECSKG  C+V +FP +K+VG NH+WVD
Sbjct  566  QIPPFIEWLKYLSYSYYCYKLLVGVQYMDDDYYECSKGVLCKVGEFPPIKSVGLNHLWVD  625

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+MAMMLVGYR +AYLAL RVR
Sbjct  626  MSIMAMMLVGYRLVAYLALQRVR  648



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  437  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  497  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+D DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  557  QIPPFIVWLKYLSYSYYCYKLLLGIQYSDEDYYECSEGVWCRVGDFPGIKAMGLNNLWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  617  VLVMGVMLVGYRLMAYMALHRVK  639



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  437  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  497  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  557  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDEDYYECSEGVWCRVGDFPGIKAMGLNNLWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  617  VLVMGVMLVGYRLMAYMALHRVK  639



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   293 bits (749),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  454  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFAIIIYWMG  513

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY+Q
Sbjct  514  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  573

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQYND+D+YECSKG  C+V +FP +K+VG NH+WVD
Sbjct  574  QIPPFIEWLKYLSYSYYCYKLLVGVQYNDDDHYECSKGVLCKVGEFPPIKSVGLNHLWVD  633

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR IAYLAL R+R
Sbjct  634  VAIMALMLVGYRLIAYLALQRMR  656



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GAILMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN++D+YECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYCYKLLLGVQYNEDDHYECSKGVLCRVGDFPAVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRMVAYLALHRVQ  654



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   294 bits (752),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECS+G +CRV DFPG+KA+G N +W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNSLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>ref|XP_010054006.1| PREDICTED: ABC transporter G family member 14 [Eucalyptus grandis]
 gb|KCW78389.1| hypothetical protein EUGRSUZ_D02559 [Eucalyptus grandis]
Length=653

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  450  GFYPLYNAVFTFPQERRMLLKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  509

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTT+V LIAGGYY+Q
Sbjct  510  GLKPNPATFILSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTMVFLIAGGYYIQ  569

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC++LLLGVQY+++D YEC+KG  CRV DFP VKAVG N++W+D
Sbjct  570  QIPPFIEWLKYLSYSYYCYRLLLGVQYSNDDVYECAKGELCRVGDFPAVKAVGLNNLWLD  629

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA MLVGYR IAY+ALHRV
Sbjct  630  VFIMASMLVGYRLIAYVALHRV  651



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLIAYMALHRVK  646



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  442  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  501

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  502  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  561

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  562  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  621

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  622  VFVMGVMLVGYRLMAYMALHRVK  644



>ref|XP_004291249.1| PREDICTED: ABC transporter G family member 14 [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   291 bits (746),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVVIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  517  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVG-FNHMWV  214
            QIPPFI+WLKYLSYSFYC+KLLLGVQY ++DYYECSKG  CRV D P VK++G  N++W+
Sbjct  577  QIPPFIVWLKYLSYSFYCYKLLLGVQYREDDYYECSKGVLCRVGDLPAVKSMGDLNNLWI  636

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYRF+AYLALHRVR
Sbjct  637  DVSILALMLLGYRFMAYLALHRVR  660



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLMAYMALHRVK  646



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G +++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLSNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLIAYMALHRVK  646



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14-like [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score =   290 bits (743),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF FI+Y+MG
Sbjct  451  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P P TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  511  GLDPHPTTFLLSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY++ D YEC KG +C+V DFP VK+VG + +WVD
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVQYHNGDVYECGKGEFCQVVDFPAVKSVGLDRLWVD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLALHRVR
Sbjct  631  VCIMALMLVGYRLIAYLALHRVR  653



>ref|XP_004164431.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
14-like [Cucumis sativus]
Length=655

 Score =   290 bits (743),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF FI+Y+MG
Sbjct  451  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P P TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  511  GLDPHPTTFLLSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY++ D YEC KG +C+V DFP VK+VG + +WVD
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVQYHNGDVYECGKGEFCQVVDFPAVKSVGLDRLWVD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLALHRVR
Sbjct  631  VCIMALMLVGYRLIAYLALHRVR  653



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   290 bits (742),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  436  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLV LIAGGYYVQ
Sbjct  496  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  556  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY ALHRV+
Sbjct  616  VFVMGVMLVGYRLMAYFALHRVK  638



>gb|KJB25133.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=644

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  440  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  499

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  500  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  559

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FILWLKYLSYS+YC+KLLLGVQYN++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  560  QIPSFILWLKYLSYSYYCYKLLLGVQYNEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  619

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+ALHRVR
Sbjct  620  VAIMALMLLGYRLLAYMALHRVR  642



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF FI+Y+MG
Sbjct  451  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P P TF LSLL+VL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  511  GLDPHPTTFLLSLLVVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+  D YEC KG +CRV DFP VK+VG + +WVD
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVQYHKGDVYECGKGEFCRVVDFPAVKSVGLDRLWVD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR IAYLALHRVR
Sbjct  631  VCIMAIMLIGYRLIAYLALHRVR  653



>gb|KJB25132.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=653

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  449  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  509  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FILWLKYLSYS+YC+KLLLGVQYN++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  569  QIPSFILWLKYLSYSYYCYKLLLGVQYNEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+ALHRVR
Sbjct  629  VAIMALMLLGYRLLAYMALHRVR  651



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score =   288 bits (736),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLV L+AGGYYVQ
Sbjct  495  GLKADPVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  465  GFYPLYNAVFTFPQERSMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  524

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL++L++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  525  GLKADPITFILSLLVILYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  584

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  585  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  644

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  645  VCIMALMLVGYRLVAYLALHRVQ  667



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  470  GFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMG  529

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  530  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  589

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV D P +K++ G NH+W+
Sbjct  590  QIPAFIIWLKYLSYSYYCYKLLLGVQYDEDDYYECSKGVLCRVGDLPAIKSMGGLNHLWI  649

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  650  DVSILALMLLGYRLLAYLALHRVR  673



>ref|XP_010111780.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXC31694.1| ABC transporter G family member 14 [Morus notabilis]
Length=666

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER ML+KERSSGMYRLSSYFLAKT+GDLPLELALPTAF FI+YWMG
Sbjct  462  GFYPLYNAVFTFPQERTMLMKERSSGMYRLSSYFLAKTIGDLPLELALPTAFVFIIYWMG  521

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  522  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  581

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYND+DYYECS G +C +ADFP VK++G  ++W+D
Sbjct  582  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDDDYYECSPGVWCPIADFPAVKSMGLRNLWMD  641

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYRF+AYLAL RVR
Sbjct  642  VFIMALMLVGYRFLAYLALQRVR  664



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  430  GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  489

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  490  GLKADPITFILSLLVVLYNVLVSQSLGLALGAILMDIKQATTLASVTTLVFLIAGGYYVQ  549

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKY+SYS+YC+KLLLGVQY ++DYYECSKG  CRV DFP VK++G NH+W+D
Sbjct  550  QIPSFIVWLKYVSYSYYCYKLLLGVQYREDDYYECSKGVLCRVGDFPAVKSMGLNHLWID  609

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL RV+
Sbjct  610  VCIMALMLVGYRLIAYLALSRVQ  632



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  549  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMG  608

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  609  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  668

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G  H+W+
Sbjct  669  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLEHLWL  728

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  729  DVSILALMLLGYRLLAYLALHRVR  752



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLS+YFLA+TV DLP+ELALPTAFTFI YWMG
Sbjct  444  GFYPLYNAVFTFPQERSMLIKERSSGMYRLSAYFLARTVADLPMELALPTAFTFIFYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLLIVLFSVLVSQSLGLAFGA+LMDVKQA TLASVTTLV LIAGGYYV+
Sbjct  504  GLKPDPTTFVLSLLIVLFSVLVSQSLGLAFGAVLMDVKQAATLASVTTLVFLIAGGYYVR  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGV Y +NDYYEC++  YCRV+D+P VK+VG  ++WVD
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVHYTENDYYECAEKVYCRVSDYPAVKSVGLTNLWVD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +SVM +ML+GYR +AY ALHRV+
Sbjct  624  MSVMLLMLIGYRLVAYRALHRVQ  646



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   285 bits (729),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+T+GDLPLELALPTAF FI+YWMG
Sbjct  436  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARTIGDLPLELALPTAFVFIIYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+  TF LSLL+VL+SVLV+Q LGLAFGA+LM+VKQATTLASVTTLV LIAGGYYVQ
Sbjct  496  GLKPDATTFILSLLVVLYSVLVAQGLGLAFGALLMNVKQATTLASVTTLVFLIAGGYYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+YC+KLLLG+QY D+D YECSKG +CRV DFP +K++G +++WVD
Sbjct  556  HIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDVYECSKGVWCRVGDFPAIKSMGLHNLWVD  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  616  VFVMGVMLVGYRLLAYMALHRVK  638



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK + +TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLV L+AGGYYVQ
Sbjct  495  GLKADSVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK + +TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLV L+AGGYYVQ
Sbjct  495  GLKADSVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>ref|XP_008347334.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Malus domestica]
Length=771

 Score =   288 bits (736),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  565  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMG  624

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  625  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  684

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G  H+W+
Sbjct  685  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLEHLWL  744

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  745  DVSILALMLLGYRLLAYLALHRVR  768



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  462  GFYPLYNAVFTFPQERRMLIKERSSGMYQLSSYFLARTVGDLPLELALPTAFVLIIYWMG  521

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  522  GLKPDPFTFILSLLVVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  581

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G +H+W+
Sbjct  582  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLDHLWL  641

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++ +ML+GYR +AYLALHRVR
Sbjct  642  DVSILGLMLLGYRLLAYLALHRVR  665



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 189/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  467  GFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMG  526

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYY+Q
Sbjct  527  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  586

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIP FI+WLKYLSYS+YC+KLLLGVQY++++YYECSKG  CRV D P +K++ G NH+W+
Sbjct  587  QIPAFIVWLKYLSYSYYCYKLLLGVQYDEDEYYECSKGVLCRVGDLPAIKSMGGLNHLWI  646

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  647  DVSILALMLLGYRLLAYLALHRVR  670



>ref|XP_010251517.1| PREDICTED: ABC transporter G family member 14-like [Nelumbo nucifera]
Length=650

 Score =   283 bits (724),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  449  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVIIIYWMGGLK  508

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P+   F LS L+VLFSVLVSQSLGLA+GAILMDVKQA TLASVTTLV LIAGGYYVQQIP
Sbjct  509  PDFTAFVLSWLVVLFSVLVSQSLGLAYGAILMDVKQAATLASVTTLVFLIAGGYYVQQIP  568

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLG+QY +NDYYECS+G +CRV DFP VK VG  ++WVDVS+
Sbjct  569  PFIVWLKYLSYSFYCYKLLLGIQYTENDYYECSQGMFCRVVDFPAVKVVGLKNLWVDVSI  628

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MAMMLVGYR IAY+AL RV+
Sbjct  629  MAMMLVGYRLIAYMALRRVQ  648



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  449  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  509  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLG+QY+++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  569  QIPSFIVWLKYLSYSYYCYKLLLGIQYDEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+AL+RVR
Sbjct  629  VAIMALMLLGYRLLAYMALYRVR  651



>ref|XP_010324497.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
 ref|XP_010324498.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
Length=598

 Score =   274 bits (700),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  396  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  455

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  456  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  515

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  516  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  575

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  576  VSVMAVMLVGYRVVAYLALTRVR  598



>ref|XP_010918656.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=648

 Score =   275 bits (703),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMY LSSY+LA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  447  PLYNAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYWMGGLK  506

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL++VLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLV LIAGGYYVQQIP
Sbjct  507  PHPTAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  566

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLGVQ+N+ND YECS G  C V +FP +K+VG NH+WVD S+
Sbjct  567  PFIVWLKYLSYSFYCYKLLLGVQFNENDSYECSPGVMCPVVEFPAIKSVGLNHLWVDASI  626

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR IAYLALHR++
Sbjct  627  MALMLMGYRLIAYLALHRLQ  646



>ref|XP_010324495.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum lycopersicum]
Length=671

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  469  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  528

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  529  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  588

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  589  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  648

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  649  VSVMAVMLVGYRVVAYLALTRVR  671



>ref|XP_010324496.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum lycopersicum]
Length=639

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  437  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  497  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  557  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  617  VSVMAVMLVGYRVVAYLALTRVR  639



>ref|XP_010918655.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=666

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMY LSSY+LA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  465  PLYNAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYWMGGLK  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL++VLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLV LIAGGYYVQQIP
Sbjct  525  PHPTAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLGVQ+N+ND YECS G  C V +FP +K+VG NH+WVD S+
Sbjct  585  PFIVWLKYLSYSFYCYKLLLGVQFNENDSYECSPGVMCPVVEFPAIKSVGLNHLWVDASI  644

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR IAYLALHR++
Sbjct  645  MALMLMGYRLIAYLALHRLQ  664



>ref|XP_006361228.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum tuberosum]
Length=659

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTV DLPLELALPTAFTFILYWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  517  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  577  QIPPFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  637  VSVMAVMLVGYRVVAYLALTRVR  659



>ref|XP_006361227.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum tuberosum]
Length=662

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTV DLPLELALPTAFTFILYWMG
Sbjct  460  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMG  519

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  520  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  579

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  580  QIPPFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  639

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  640  VSVMAVMLVGYRVVAYLALTRVR  662



>ref|XP_009802424.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=658

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  456  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  516  GLKADPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYND+DYYECSKG YC+VADFP +K++G N+MW+D
Sbjct  576  QIPSFIVWLKYLSYSYYSYKLLLGVQYNDSDYYECSKGVYCQVADFPAIKSIGLNNMWID  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR +AYLAL RVR
Sbjct  636  VSIMAVMLVGYRLVAYLALTRVR  658



>ref|XP_010943390.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=660

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMG
Sbjct  456  GFYPLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVLIIYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P+   F LSLL+VLFSVLVSQSLGLA GA+LMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  516  GLNPQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLASVTTLVFLIAGGYYVQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYSFYC+KLLLG+Q+++NDYYECS G  C V +FP +K+VG N+MWVD
Sbjct  576  HIPPFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGVMCPVVEFPAIKSVGLNNMWVD  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR +AYLALH ++
Sbjct  636  VCIMAIMLLGYRLVAYLALHHLQ  658



>ref|XP_010943389.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=661

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMG
Sbjct  457  GFYPLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVLIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P+   F LSLL+VLFSVLVSQSLGLA GA+LMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  517  GLNPQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLASVTTLVFLIAGGYYVQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYSFYC+KLLLG+Q+++NDYYECS G  C V +FP +K+VG N+MWVD
Sbjct  577  HIPPFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGVMCPVVEFPAIKSVGLNNMWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR +AYLALH ++
Sbjct  637  VCIMAIMLLGYRLVAYLALHHLQ  659



>ref|XP_010676724.1| PREDICTED: ABC transporter G family member 14 [Beta vulgaris 
subsp. vulgaris]
Length=634

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 182/207 (88%), Gaps = 4/207 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY+LSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  428  GFYPLYNAVFTFPQERRMLIKERTSGMYKLSSYFLARTIGDLPLELALPTAFVFIIYWMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P+ F LSL++VL++VLV+QSLGLA GAILMD+K ATTLASVTTLV LIAGGYYVQ
Sbjct  488  GLKPNPIVFVLSLIVVLYNVLVAQSLGLAIGAILMDIKPATTLASVTTLVFLIAGGYYVQ  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
            QIPPFI+WLKYLSYS+YC+KLLLGVQY  ND Y C    +K  +C+V D P VK++G +H
Sbjct  548  QIPPFIVWLKYLSYSYYCYKLLLGVQYQQNDTYPCIKMGNKWEWCKVVDVPAVKSMGLDH  607

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRVR  142
            +W+DV V+ +MLVGYR +AYLAL RVR
Sbjct  608  LWIDVCVLGLMLVGYRLLAYLALQRVR  634



>ref|XP_009631041.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=660

 Score =   270 bits (689),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLV LIAGGYY+Q
Sbjct  517  GLKADPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLL VQYND+D+YECSKG YC+VADFP +K+VG N+MW+D
Sbjct  577  QIPSFIVWLKYLSYSYYSYKLLLEVQYNDSDFYECSKGVYCQVADFPAIKSVGLNNMWID  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+ML+GYR +AYLAL RVR
Sbjct  637  VSIMAVMLIGYRLVAYLALTRVR  659



>ref|XP_010910173.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=653

 Score =   269 bits (688),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  452  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  511

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYYVQ IP
Sbjct  512  PGASSFLLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  571

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D YECS G  CRV DFP +K+VG +HMW+DV +
Sbjct  572  SFIVWLKYLSFSFYCYKLLLGVQFRDDDVYECSPGVLCRVVDFPAIKSVGLHHMWIDVCI  631

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+ YR IAYLALHR++
Sbjct  632  MALMLIAYRLIAYLALHRLQ  651



>ref|XP_010910172.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=668

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 158/200 (79%), Positives = 178/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  467  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  526

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYYVQ IP
Sbjct  527  PGASSFLLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  586

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D YECS G  CRV DFP +K+VG +HMW+DV +
Sbjct  587  SFIVWLKYLSFSFYCYKLLLGVQFRDDDVYECSPGVLCRVVDFPAIKSVGLHHMWIDVCI  646

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+ YR IAYLALHR++
Sbjct  647  MALMLIAYRLIAYLALHRLQ  666



>ref|XP_008805673.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=666

 Score =   268 bits (684),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER +LIKERSSGMY LSSYFLA+T GDLP+ELALP AF  I+YWMGGLK
Sbjct  465  PLYNAVFTFPQERPILIKERSSGMYHLSSYFLARTAGDLPMELALPIAFVLIIYWMGGLK  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLLIVLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLV LIAGGYYVQQIP
Sbjct  525  PHPASFILSLLIVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLL+GVQ+++ DY+ECS G  C V +FP +K+VG NHMWVDV +
Sbjct  585  PFIVWLKYLSYSFYCYKLLIGVQFSEEDYFECSPGVLCPVVEFPAIKSVGLNHMWVDVCI  644

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR +AYLALHR++
Sbjct  645  MALMLLGYRLVAYLALHRLQ  664



>ref|XP_008797958.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=649

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSG YRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  447  PLYNAVFTFPQERSMLIKERSSGTYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  506

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   +F LSLL+VL SVLVSQSLGLAFGAILMDVKQATTLASVTTLV LIAGGYYVQ IP
Sbjct  507  PSASSFLLSLLVVLLSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  566

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D Y+CS G  CR ADFP +K+VG +HMW+DV +
Sbjct  567  RFIVWLKYLSFSFYCYKLLLGVQFRDDDVYQCSPGVLCRAADFPAIKSVGLHHMWIDVCI  626

Query  201  MAMMLVGYRFIAYLALHRVR  142
            M +ML+GYR IAYLALHR++
Sbjct  627  MVLMLIGYRLIAYLALHRLQ  646



>ref|XP_011028515.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTCGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GAILMDVKQATTLASVTTLV LIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRMVAYLALHRVQ  654



>ref|XP_002304113.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
 gb|EEE79092.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
Length=656

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GA+LMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGALLMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRLVAYLALHRVQ  654



>ref|XP_009397435.1| PREDICTED: ABC transporter G family member 14 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   261 bits (668),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER ML KE++SGMYRLSSYFLA+T GDLP+ELALPTAFTFI+YWMGGL+
Sbjct  455  PLYNAVFTFPQERPMLRKEQASGMYRLSSYFLARTAGDLPMELALPTAFTFIIYWMGGLR  514

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
             +P+ F LSLL+VLFSVLV+QSLGLA GAILMDVKQATTLASVTTLV L+AGGYYVQQIP
Sbjct  515  SDPVAFLLSLLVVLFSVLVAQSLGLAVGAILMDVKQATTLASVTTLVFLMAGGYYVQQIP  574

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PF++WLKYLSYSFYC+KLLLGVQ++++D YECS G  C V D+P +K+VG  H+W+DV +
Sbjct  575  PFVVWLKYLSYSFYCYKLLLGVQFSEHDAYECSSGVMCPVIDYPAIKSVGLGHIWIDVCI  634

Query  201  MAMMLVGYRFIAYLALHRVR  142
            M +MLVGYR +AYLALH ++
Sbjct  635  MGLMLVGYRLVAYLALHHLQ  654



>ref|XP_011013139.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
 ref|XP_011015812.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTCGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GA+LMD+KQATTLASVTTLV LIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGALLMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  HIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRLVAYLALHRVQ  654



>ref|XP_009384518.1| PREDICTED: ABC transporter G family member 14-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   254 bits (648),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 153/200 (77%), Positives = 176/200 (88%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER ML KE+++GMYRLSSYFLA+T GDLP+ELALPTAFTFI+YWMGGL 
Sbjct  442  PLYNAVFTFPQERPMLRKEQAAGMYRLSSYFLARTAGDLPMELALPTAFTFIMYWMGGLD  501

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P PLTF LSLL+VLFSVLV+QSLGLA GA+LMDVKQATTLASVTTLV L+AGGYYVQQIP
Sbjct  502  PHPLTFLLSLLVVLFSVLVAQSLGLAVGAMLMDVKQATTLASVTTLVFLMAGGYYVQQIP  561

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WL+YLSYSFYC+KLLLGVQ+ ++D YECSKG  C V ++  +K+VG   MWVDV V
Sbjct  562  PFIAWLRYLSYSFYCYKLLLGVQFTEHDSYECSKGVMCPVMEYQAIKSVGLRRMWVDVCV  621

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+MLVGYR +AYLAL  ++
Sbjct  622  MAVMLVGYRIVAYLALRHLQ  641



>ref|XP_006659869.1| PREDICTED: ABC transporter G family member 14-like [Oryza brachyantha]
Length=379

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  176  PLYNAVFTFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  235

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  236  PRPGAFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  295

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  296  PFVGWLRWLNYSFYCYRLLIGIQFGDGGAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  355

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAY+AL R++
Sbjct  356  CVMALLLVGYRVIAYIALDRLK  377



>ref|NP_001182828.1| hypothetical protein [Zea mays]
 gb|ACR34766.1| unknown [Zea mays]
 gb|AFW57204.1| hypothetical protein ZEAMMB73_095241 [Zea mays]
Length=331

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  129  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  188

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  189  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  248

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  249  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  308

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  309  VMALMLVGYRVVAYIALDRLK  329



>dbj|BAJ97566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  484  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTTADLPMELGLPTAFVLILYWMGGLD  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  544  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  604  PFIGWLKWLNYSFYCYRLLLGIQFRDGSAVYDCGGGALCPVADFPAIKAVGLNNHWVDVC  663

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  664  VMALLLVGYRVVAYLALDRLQ  684



>dbj|BAJ95904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  484  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  544  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  604  PFIGWLKWLNYSFYCYRLLLGIQFRDGSAVYDCGGGALCPVADFPAIKAVGLNNHWVDVC  663

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  664  VMALLLVGYRVVAYLALDRLQ  684



>ref|XP_008390022.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=367

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  166  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFXTICYWMSGLK  225

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLV L+ GGYY+Q +P
Sbjct  226  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHMP  285

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG + MW+DV+ 
Sbjct  286  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDDMWIDVAA  345

Query  201  MAMMLVGYRFIAYLAL  154
            +A+MLVGYR +AY+AL
Sbjct  346  LAVMLVGYRVLAYVAL  361



>gb|EEC82957.1| hypothetical protein OsI_27950 [Oryza sativa Indica Group]
Length=761

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  558  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  617

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  618  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  677

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  678  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  737

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  738  CVMALLLVGYRVIAYLALDRLK  759



>gb|EAZ41641.1| hypothetical protein OsJ_26175 [Oryza sativa Japonica Group]
Length=757

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  554  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  613

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  614  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  673

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  674  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  733

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  734  CVMALLLVGYRVIAYLALDRLK  755



>dbj|BAC99536.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
 dbj|BAC99846.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
Length=757

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  554  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  613

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  614  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  673

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  674  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  733

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  734  CVMALLLVGYRVIAYLALDRLK  755



>gb|AFW57205.1| hypothetical protein ZEAMMB73_095241 [Zea mays]
Length=595

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  393  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  452

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  453  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  512

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  513  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  572

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  573  VMALMLVGYRVVAYIALDRLK  593



>ref|XP_009356025.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILM+VKQ TTLASVT LV L+ GGYY+Q IP
Sbjct  542  PSLVTFALTLFIVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG ++MW+DV+ 
Sbjct  602  PFIAWLKYVSFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIKCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYRF+AY+AL 
Sbjct  662  LAVMLVGYRFLAYMALR  678



>ref|XP_008662280.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=727

 Score =   234 bits (597),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  525  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  584

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  585  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  644

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  645  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  704

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  705  VMALMLVGYRVVAYIALDRLK  725



>ref|XP_009336649.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   233 bits (594),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFVTISYWMSGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLV L+ GGYY+Q +P
Sbjct  542  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHLP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG ++MW+DV+ 
Sbjct  602  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>ref|XP_008389336.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
 ref|XP_008367026.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
Length=683

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFXTICYWMSGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLV L+ GGYY+Q +P
Sbjct  542  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHMP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG + MW+DV+ 
Sbjct  602  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDDMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>gb|KDP29341.1| hypothetical protein JCGZ_18262 [Jatropha curcas]
Length=682

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 166/196 (85%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSGMYRLSSY+LA+  GDLP+EL LPT F  I YWMGGLK
Sbjct  481  PLFNAIFTFPQERPMLIKERSSGMYRLSSYYLARIAGDLPMELVLPTIFVTISYWMGGLK  540

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAILM+VKQATTLASVT LV L+AGGYY+Q IP
Sbjct  541  PSLVTFILTLLIILFNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLAGGYYIQHIP  600

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC KG +CRV DFP +K +G ++MW DV+ 
Sbjct  601  QFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEKGIHCRVMDFPAIKYLGVDNMWGDVAA  660

Query  201  MAMMLVGYRFIAYLAL  154
            +++MLVGYR +AYLAL
Sbjct  661  LSIMLVGYRILAYLAL  676



>ref|XP_003573439.1| PREDICTED: ABC transporter G family member 14 [Brachypodium distachyon]
Length=711

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 166/202 (82%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER  L+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  508  PLYNAVFVFPLERPFLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  567

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  568  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  627

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LLLG+Q+ D   YYEC S G  C VA+FP +KAVG  + WVDV
Sbjct  628  PFVGWLRWLNYSFYCYRLLLGIQFPDGGGYYECGSGGAMCPVAEFPAIKAVGLENHWVDV  687

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR +AYLAL R++
Sbjct  688  CVMALLLVGYRVVAYLALDRLQ  709



>gb|EMS54909.1| ABC transporter G family member 14 [Triticum urartu]
Length=421

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 163/201 (81%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  219  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  278

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  279  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  338

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH-YCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D        G   C +A+FP +KAVG N+ WVDV 
Sbjct  339  PFIGWLKWLNYSFYCYRLLLGIQFRDGGGLYDCGGGALCPIAEFPAIKAVGLNNHWVDVC  398

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  399  VMALLLVGYRVVAYLALDRLQ  419



>ref|XP_008361741.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L +VL++VLVSQ LGLA GAILM+VKQ TTLASVT LV L+ GGYY+Q IP
Sbjct  542  PSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+  VG ++MW+DV+ 
Sbjct  602  PFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIXCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+M VGYRF+AY+AL 
Sbjct  662  LAVMXVGYRFLAYVALR  678



>ref|XP_008339724.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L +VL++VLVSQ LGLA GAILM+VKQ TTLASVT LV L+ GGYY+Q IP
Sbjct  542  PSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+  VG ++MW+DV+ 
Sbjct  602  PFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIXCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+M VGYRF+AY+AL 
Sbjct  662  LAVMXVGYRFLAYVALR  678



>ref|XP_010096709.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXB65561.1| ABC transporter G family member 14 [Morus notabilis]
Length=634

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGLK
Sbjct  433  PLFNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTVFVTVTYWMGGLK  492

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAILMDVKQATTLASVT LV L+ GGYY+Q+IP
Sbjct  493  PSLITFLLTLLIILFNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLVGGYYIQKIP  552

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY DN++YEC  G +CRV DFP +K +G ++ W DV+ 
Sbjct  553  AFIAWLKYISFSHYCYKLLVGVQYTDNEFYECGIGMHCRVMDFPAIKCLGLDNKWWDVAA  612

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY+AL
Sbjct  613  LTVMFVGYRLLAYVAL  628



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGL+
Sbjct  484  PMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTIFVAVTYWMGGLR  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P+ F L+LLI+L++VLVSQ LGLA GAI+M+VKQATTLASVT LV L+AGGYY+Q IP
Sbjct  544  PSPVNFMLTLLIILYNVLVSQGLGLALGAIVMEVKQATTLASVTMLVFLLAGGYYIQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+G QY ++DYY C  G +C++ DFP VK++G ++  +DV+ 
Sbjct  604  PFIAWLKYSSFSHYCYKLLVGAQYTEDDYYNCGTGVHCKIMDFPSVKSLGLDNKRLDVAA  663

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  664  LTVMLVGYRLMAYVALR  680



>ref|XP_007225163.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
 gb|EMJ26362.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
Length=683

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVSYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILMDVKQ TTLASVT LV L+ GGYY+Q IP
Sbjct  542  PSFVTFALTLSIVLYNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +C V DFP +K +G + MW DV+ 
Sbjct  602  SFIAWLKYISFSHYCYKLLVGVQYSANEVYECEMGMHCSVMDFPAIKYLGLDSMWSDVAA  661

Query  201  MAMMLVGYRFIAYLALHRVR  142
            +A+MLVGYR +AY+AL R+R
Sbjct  662  LAVMLVGYRVLAYVAL-RMR  680



>ref|XP_010556399.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=685

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 164/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER ML+KERSSGMYRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  485  PLFNAIFTFPQERPMLVKERSSGMYRLSSYYIARTVGDLPMELILPTIFVTISYWMGGLK  544

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P TF L+LLIVL++VLV+Q++GLA GAILMDVKQATTL+SVT LV L+AGGYY+Q IP
Sbjct  545  PSPTTFLLTLLIVLYNVLVAQAVGLAMGAILMDVKQATTLSSVTMLVFLLAGGYYIQHIP  604

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKA--VGFNHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY  N+ YEC  G  CRV D+ G++   +G N+M  DV
Sbjct  605  GFIAWLKYISFSHYCYKLLVGVQYTGNEVYECGLGLRCRVMDYEGIRNLMIGNNNMMWDV  664

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLVGYR +AYLAL  +
Sbjct  665  LALGIMLVGYRVLAYLALRNL  685



>ref|XP_010265331.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=666

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGL+
Sbjct  465  PMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARIAGDLPMELVLPTIFVSVTYWMGGLR  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P+ F L+LLI+L++VLVSQ LGLA GAILM++KQATTLASVT LV L+A GYY+Q IP
Sbjct  525  PSPVNFLLTLLIILYNVLVSQGLGLALGAILMELKQATTLASVTMLVFLLASGYYIQHIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKY S+S YC+KLL+GVQY ++DYY+C  G +C++ +FP VK +G N+M +DV+ 
Sbjct  585  AFIVWLKYTSFSHYCYKLLVGVQYTEDDYYDCGIGLHCKIFNFPAVKNLGINNMGLDVAA  644

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR IAY+AL 
Sbjct  645  LTVMLVGYRLIAYVALR  661



>gb|KHN07535.1| ABC transporter G family member 21 [Glycine soja]
Length=566

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+NAVF FP ER ML+KERSSGMY LSSY++A+ VGDLP+E  LPT F  I YWMG
Sbjct  362  GFYPLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDLPMEFVLPTIFVAISYWMG  421

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY++
Sbjct  422  GLKPSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIR  481

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY+ N+ Y+C  G +CR+ DF  +K +G + +W D
Sbjct  482  HIPFFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRHGLHCRIRDFLAIKCLGLDSLWGD  541

Query  210  VSVMAMMLVGYRFIAYLAL  154
            V+V+A+ML+GYR +AYLAL
Sbjct  542  VAVLAVMLIGYRVVAYLAL  560



>gb|EPS63929.1| hypothetical protein M569_10851 [Genlisea aurea]
Length=634

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQ+R +L KE+SS MYRLSSYFLA+TV DLPL+LALP AFT + Y+MG
Sbjct  428  GFYPLYNAVFTFPQDRAILRKEKSSSMYRLSSYFLARTVADLPLDLALPAAFTVVFYFMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P PL F LSLL +L +VLVSQ LGL FGA+LMDVKQA TLASVTTLV LIAGGYYV+
Sbjct  488  GLTPRPLPFLLSLLNILLAVLVSQGLGLLFGALLMDVKQAATLASVTTLVFLIAGGYYVR  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
            +IPPFI W++YLS+S+Y +++LLGVQY + D YEC        YCRVADFP VKAVG   
Sbjct  548  RIPPFIGWIRYLSFSYYSYRMLLGVQYGEGDVYECGGGGGGTSYCRVADFPAVKAVGLGG  607

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
            +WVD + M  MLVGYR +AY AL R 
Sbjct  608  LWVDAAAMVAMLVGYRVLAYFALRRA  633



>ref|XP_008243143.1| PREDICTED: ABC transporter G family member 21 [Prunus mume]
Length=683

 Score =   223 bits (568),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML+KERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPMERPMLVKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVSYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILMDVKQ TTLASVT LV L+AGGYY+Q IP
Sbjct  542  PSFVTFALTLSIVLYNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLAGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +C V +FP +K +G + MW DV+ 
Sbjct  602  SFIAWLKYISFSHYCYKLLVGVQYSANEVYECEMGMHCSVMNFPAIKYLGLDSMWSDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>ref|XP_004972751.1| PREDICTED: ABC transporter G family member 14-like [Setaria italica]
Length=747

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 165/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  539  PLYNAVFTFPLERPMLLKERSSGMYRLSSYFASRAAADLPMELGLPTAFVLILYWMGGLD  598

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  599  PHPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  658

Query  381  PFILWLKYLSYSFYCFKLLLGVQY-NDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ N   YY+C  G  C VA+FP +KAVG N+ WVDV 
Sbjct  659  PFVAWLRWLNYSFYCYRLLLGIQFPNGGGYYDCGGGAMCPVAEFPAIKAVGLNNHWVDVC  718

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AY+AL R++
Sbjct  719  VMALLLVGYRVVAYIALDRLK  739



>gb|KHN07718.1| ABC transporter G family member 21, partial [Glycine soja]
Length=602

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  400  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLK  459

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GA+LMDVKQATTLASVT LV L+AGGYY+QQIP
Sbjct  460  PSLVTFVLTLLIMLFNVLVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIP  519

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G  +C+V DFP +K +G + +W DV+
Sbjct  520  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGLDSLWGDVA  579

Query  204  VMAMMLVGYRFIAYLALH  151
            V+A+ML+GYR +AYLAL 
Sbjct  580  VLAVMLIGYRVVAYLALR  597



>ref|XP_002443920.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
 gb|EES13415.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
Length=749

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 159/203 (78%), Gaps = 3/203 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  545  PLYNAVFTFPLERPMLVKERCSGMYRLSSYLASRAATDLPMELGLPTAFVLILYWMGGLD  604

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+V LIAGGYYVQ IP
Sbjct  605  PRPAPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  664

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND---NDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            PF+ WL++L+YSFYC++LLLG+Q+ +           G  C VA+FP +KAVG N+ WVD
Sbjct  665  PFVAWLRWLNYSFYCYRLLLGIQFPNGGGYYDCGDGHGKLCAVAEFPAIKAVGLNNHWVD  724

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VMA++LVGYR +AY+AL R++
Sbjct  725  VCVMALLLVGYRVVAYIALDRLK  747



>ref|XP_002314895.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
 gb|EEF01066.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
Length=683

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL +PT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPTIFVTVTYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LL++LF+VLVSQ LGLA GAILMDVKQATTLASVT LV L+AGGYY+Q IP
Sbjct  542  PSLITFVLTLLVILFNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+  + Y+C    +CRV DFP +K +G ++MW D + 
Sbjct  602  PFIAWLKYISFSHYCYKLLVGVQYSATEVYDCGLQMHCRVMDFPAIKYLGLDNMWWDAAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  662  LTIMLVGYRLLAYVALR  678



>gb|KHN37813.1| ABC transporter G family member 21 [Glycine soja]
Length=666

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  464  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  523

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY+QQ+P
Sbjct  524  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  583

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNH-MWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP +K +G +  MW DV+
Sbjct  584  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGPGLHCRVRDFPAIKCMGLDDTMWGDVA  643

Query  204  VMAMMLVGYRFIAYLAL  154
             + +ML+GYR +AYLAL
Sbjct  644  ALTVMLIGYRVVAYLAL  660



>ref|XP_006589394.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=684

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 163/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY+QQ+P
Sbjct  542  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNH-MWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP +K +G +  MW DV+
Sbjct  602  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGPGLHCRVRDFPAIKCMGLDDTMWGDVA  661

Query  204  VMAMMLVGYRFIAYLAL  154
             + +ML+GYR +AYLAL
Sbjct  662  ALTVMLIGYRVVAYLAL  678



>gb|AIU41651.1| ABC transporter family protein [Hevea brasiliensis]
Length=680

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F    YWMG
Sbjct  476  GFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTIFVIFTYWMG  535

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   +TF L+LLI+LF+VLVSQ LGLA GAILM+ KQATTLASVT LV L+AGGYY+Q
Sbjct  536  GLKSSVITFVLTLLIILFNVLVSQGLGLALGAILMEAKQATTLASVTMLVFLLAGGYYIQ  595

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WLKY+S+S +C+KLL+GVQY+ N+ YEC  G  CRV DFP +K +G ++   D
Sbjct  596  HIPPFIAWLKYISFSHFCYKLLVGVQYSANEVYECELGMDCRVMDFPAIKCLGTDNKGWD  655

Query  210  VSVMAMMLVGYRFIAYLALH  151
            V+ +++MLVGYR +AY+AL 
Sbjct  656  VAALSIMLVGYRLLAYVALR  675



>ref|XP_002524381.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37992.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=709

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER +LIKERSSGMYRLSSY+ A+  GDLP+EL +P  F  + YWMGGLK
Sbjct  508  PLFNAIFAFPQERPILIKERSSGMYRLSSYYFARMAGDLPMELVMPIIFVTVAYWMGGLK  567

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GA+LMDVKQ TTLASVT LV L+AGGYY+Q IP
Sbjct  568  PSLITFVLTLLIILFNVLVSQGLGLALGAVLMDVKQGTTLASVTMLVFLLAGGYYIQHIP  627

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP ++ +G ++MW DV+ 
Sbjct  628  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEAGMHCRVMDFPAIRYLGLDNMWWDVAA  687

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYRF+AY+AL 
Sbjct  688  LLIMLVGYRFLAYVALR  704



>ref|XP_004496215.1| PREDICTED: ABC transporter G family member 21-like [Cicer arietinum]
Length=681

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMY LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  480  PLFNAIFAFPLERPMLTKERSSGMYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGLK  539

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY+Q++P
Sbjct  540  PSLITFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKMP  599

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ YEC +G +CRV DFP +K +  ++MWVDV+ 
Sbjct  600  SFIAWLKYISFSHYCYKLLVGVQYSVSEVYECRQGLHCRVRDFPAIKCLEIDNMWVDVAA  659

Query  201  MAMMLVGYRFIAYLALH  151
            + +M +G+R +AYLAL 
Sbjct  660  LTIMFIGFRVVAYLALR  676



>ref|XP_007153314.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
 gb|ESW25308.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
Length=671

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R MLIKERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  470  PLFNAIFAFPLDRPMLIKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMEGLK  529

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF  +LLI+LF+VLVSQ +GLA GAIL+DVKQATTLASVT LV L+AGGYY+Q+IP
Sbjct  530  PSLVTFVFTLLIMLFNVLVSQGIGLALGAILIDVKQATTLASVTMLVFLLAGGYYIQKIP  589

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL GVQY+ N+ YEC  G +C++ DFP +K +G +++W DV V
Sbjct  590  FFISWLKYISFSHYCYKLLAGVQYSVNEVYECGHGLHCKIRDFPAIKCLGLDNLWKDVVV  649

Query  201  MAMMLVGYRFIAYLALHR  148
            + +ML+GYR +AYLAL +
Sbjct  650  LTIMLIGYRVVAYLALRK  667



>ref|XP_003520157.2| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=680

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  478  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLK  537

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GA+LMDVKQATTLASVT LV L+AGGYY+QQIP
Sbjct  538  PSLVTFVLTLLIMLFNVLVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIP  597

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G  +C+V DFP +K +G + +W DV+
Sbjct  598  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGLDSLWGDVA  657

Query  204  VMAMMLVGYRFIAYLAL  154
            V+A+M +GYR +AYLAL
Sbjct  658  VLAVMFIGYRVVAYLAL  674



>ref|XP_010528033.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=684

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 162/201 (81%), Gaps = 3/201 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER ML+KERSSGMY+LSSYF+A+TVGDLP+EL LPT F  + YWM GLK
Sbjct  485  PLFNAIFTFPQERPMLLKERSSGMYKLSSYFVARTVGDLPMELILPTVFITVTYWMSGLK  544

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+LLIVL++VLV+Q +GLA GAILMDVKQATTL+SVT LV L+AGGYY+Q IP
Sbjct  545  PSLTTFLLTLLIVLYNVLVAQGVGLAMGAILMDVKQATTLSSVTMLVFLLAGGYYIQHIP  604

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV--GFNHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY  N+ YEC  G +CRV D+ G++ +  G N MW DV
Sbjct  605  AFIAWLKYISFSHYCYKLLVGVQYTGNEVYECGLGLHCRVMDYEGIRNLMTGDNMMW-DV  663

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLVGYR +AYLAL  +
Sbjct  664  VALGIMLVGYRVLAYLALRNL  684



>ref|XP_011008785.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
 ref|XP_011008793.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
Length=684

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL +PT F  + YWMGGLK
Sbjct  483  PLSNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPTIFVTVAYWMGGLK  542

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAIL+DVKQATTLASV  LV L+AGGYY+Q IP
Sbjct  543  PSLITFVLTLLIILFNVLVSQGLGLALGAILIDVKQATTLASVIMLVFLLAGGYYIQHIP  602

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+  + Y+C    +CRV DFP +K +G ++MW D + 
Sbjct  603  PFIAWLKYVSFSHYCYKLLVGVQYSATEVYDCGLQMHCRVMDFPDIKYLGLDNMWWDAAA  662

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  663  LTIMLVGYRLLAYVALR  679



>gb|KHN00888.1| ABC transporter G family member 21 [Glycine soja]
Length=674

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY+ A+ VGDLP+EL LPT F  I YWMGGL 
Sbjct  472  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFVTISYWMGGLN  531

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQAT+LASVT LV L+AGGYY+QQ+P
Sbjct  532  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMP  591

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G +CRV DFP +K +   + MW DV+
Sbjct  592  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLHCRVRDFPAIKCLELEDTMWGDVA  651

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  652  ALTVMLIGYRVVAYLALR  669



>ref|XP_003591854.1| ABC transporter G family member [Medicago truncatula]
 gb|AES62105.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=665

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  463  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGLK  522

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY+Q++P
Sbjct  523  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKMP  582

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY S+S YC+KLL+GVQ++ N+ YEC +G +CR  DFP +K +   +MW DV+ 
Sbjct  583  SFIAWLKYFSFSHYCYKLLVGVQFSVNEVYECREGLHCRARDFPAIKCLELGNMWGDVAA  642

Query  201  MAMMLVGYRFIAYLALHR  148
            + +M VGYR +AYLAL R
Sbjct  643  LTIMFVGYRVVAYLALRR  660



>ref|XP_003556255.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=682

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY+ A+ VGDLP+EL LPT F  I YWMGGL 
Sbjct  480  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFITISYWMGGLN  539

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQAT+LASVT LV L+AGGYY+QQ+P
Sbjct  540  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMP  599

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G +CRV DFP +K +   + MW DV+
Sbjct  600  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLHCRVRDFPAIKCLELEDTMWGDVA  659

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  660  ALTVMLIGYRVVAYLALR  677



>ref|XP_007046353.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY02185.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=684

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 160/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKER+SGMYRLSSY+ A+T GDLP+EL LPT F  + YWMGGLK
Sbjct  483  PLFNAIFAFPQERPMLIKERASGMYRLSSYYFARTAGDLPMELVLPTIFVTVTYWMGGLK  542

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLIVLF+VLVSQ LGLA GAILMDVKQ TTLASVT LV L+AGGYY+Q IP
Sbjct  543  PSLVTFVLTLLIVLFNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLAGGYYIQHIP  602

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S +C+KLL+GVQY+ N+ YEC  G +C++ DFP +K +G ++   DV+ 
Sbjct  603  LFIAWLKYISFSHFCYKLLVGVQYSVNEVYECDIGMHCKIMDFPAIKYLGLDNKLWDVAA  662

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  663  LTIMLVGYRLLAYVALR  679



>ref|XP_006573283.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=678

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVF FP ER ML+KERSSGMY LSSY++A+ VGDLP+E  LPT F  I YWMGGLK
Sbjct  477  PLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDLPMEFVLPTIFVTISYWMGGLK  536

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY++ IP
Sbjct  537  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIRHIP  596

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ Y+C +G + R+ DFP +K +G + +W DV+V
Sbjct  597  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRQGLHYRIRDFPAIKCLGLDSLWGDVAV  656

Query  201  MAMMLVGYRFIAYLAL  154
            +A+ML+GYR +AYLAL
Sbjct  657  LAVMLIGYRVVAYLAL  672



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21 [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  493  PLFNAIFAFPMERPMLRKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVAYWMGGLK  552

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +T+ L+L IVLF+VLVSQ LGLA GAILMDVKQ TTLASVT LV L+ GGYY+Q +P
Sbjct  553  PSLVTYGLTLFIVLFNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLVGGYYIQHMP  612

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+  + YEC  G  CRV D+P VK VG + +W DV+ 
Sbjct  613  GFIAWLKYISFSHYCYKLLLGVQYSVKEVYECDLGVRCRVIDYPAVKFVGLDGLWSDVAA  672

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  673  LGVMLVGYRVLAYVALR  689



>ref|XP_010681458.1| PREDICTED: ABC transporter G family member 21 [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ER+SGMY LS+Y+LA+ VGDLP+EL LPT F  I Y+MGGLK
Sbjct  176  PLFNAIFVFPQERPMLIRERASGMYHLSAYYLARMVGDLPMELVLPTIFVSITYYMGGLK  235

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P PLTF L+L IVL++VLVSQ LGLA GA+LMDVKQATTLASV  LV L+AGGYY+Q IP
Sbjct  236  PSPLTFILTLAIVLYNVLVSQGLGLALGAMLMDVKQATTLASVIMLVFLLAGGYYIQHIP  295

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY   + YEC     C+V D+P +K +G +++  DV+ 
Sbjct  296  PFIAWLKYVSFSHYCYKLLIGVQYLGYEVYECGLKMRCKVVDYPTIKHLGIHNLGFDVTA  355

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY AL
Sbjct  356  LTIMFVGYRLLAYAAL  371



>ref|XP_007143780.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
 gb|ESW15774.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
Length=681

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  479  PLFNAIFAFPLERPMLIKERSSGMYQLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  538

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L++LI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LV L+AGGYY+QQ+P
Sbjct  539  PSLVTFVLTILIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  598

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+ VQY  N+ YEC  G +CRV DFP +K +   ++MW +V+
Sbjct  599  AFIAWLKYISFSHYCYKLLVAVQYPINEVYECGPGLHCRVRDFPAIKCLELDDNMWGEVA  658

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  659  ALTVMLIGYRIVAYLALR  676



>ref|XP_010648137.1| PREDICTED: ABC transporter G family member 21 [Vitis vinifera]
 emb|CBI27088.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLI+ERSSGMYRLSSY+ A+  GDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLPMELVLPTIFVTIAYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  LTF L+LL++L++VLVSQ LGLA GAI+MDVKQ T LASVT LV L+AGGYY+Q IP
Sbjct  535  PSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTALASVTMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY +N+ YEC    +C+V +FP +K +G +H   DV+ 
Sbjct  595  PFIAWLKYISFSHYCYKLLVGVQYAENEVYECGLRMHCKVWEFPAIKYLGIDHWAWDVAA  654

Query  201  MAMMLVGYRFIAYLALH  151
            + +M VGYR +AY AL 
Sbjct  655  LTVMFVGYRALAYAALR  671



>emb|CAN62390.1| hypothetical protein VITISV_039480 [Vitis vinifera]
Length=696

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLI+ERSSGMYRLSSY+ A+  GDLP+EL LPT F  I YWMGGLK
Sbjct  495  PLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLPMELVLPTIFVTIAYWMGGLK  554

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  LTF L+LL++L++VLVSQ LGLA GAI+MDVKQ T LASVT LV L+AGGYY+Q IP
Sbjct  555  PSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTALASVTMLVFLLAGGYYIQHIP  614

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY +N+ YEC    +C+V +FP +K +G +H   DV+ 
Sbjct  615  PFIAWLKYISFSHYCYKLLVGVQYAENEVYECGLRMHCKVWEFPAIKYLGIDHWAWDVAA  674

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY AL
Sbjct  675  LTVMFVGYRALAYAAL  690



>ref|XP_006484387.1| PREDICTED: ABC transporter G family member 21-like [Citrus sinensis]
Length=691

 Score =   212 bits (539),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LV L+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>ref|XP_006437762.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
 gb|ESR51002.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
Length=691

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LV L+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>gb|KDO70136.1| hypothetical protein CISIN_1g005545mg [Citrus sinensis]
Length=691

 Score =   211 bits (538),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 159/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVAYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LV L+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>gb|KJB50814.1| hypothetical protein B456_008G188000 [Gossypium raimondii]
Length=690

 Score =   211 bits (538),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 156/199 (78%), Gaps = 2/199 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKE SSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGLK
Sbjct  486  PLFNAIFAFPQERPMLIKEGSSGMYRLSSYYVARTTGDLPMELVLPTIFVTVTYWMGGLK  545

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLIV  +VLVSQ LGLA GAILMDVKQATTLASVT LV L+ GGYY+  +P
Sbjct  546  PSLVTFVLTLLIVHLNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLVGGYYIHHMP  605

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF--NHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G  C+V DFP +K +G   N+ W DV
Sbjct  606  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEIGRRCKVMDFPAIKYLGLDNNNRWWDV  665

Query  207  SVMAMMLVGYRFIAYLALH  151
            + +A+ML GYR +AY+ L 
Sbjct  666  AALAIMLAGYRLLAYVGLR  684



>ref|XP_010066762.1| PREDICTED: ABC transporter G family member 21 [Eucalyptus grandis]
 gb|KCW64799.1| hypothetical protein EUGRSUZ_G02369 [Eucalyptus grandis]
Length=679

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVF FP ER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGLK
Sbjct  478  PLFNAVFAFPLERPMLIKERSSGMYRLSSYYFARIAGDLPMELVLPTIFVTVTYWMGGLK  537

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+LLI+LF+VLVSQ LGLA GA+LMD KQ TTLASVT LV L+ GGYY+Q IP
Sbjct  538  PSLGTFVLTLLIILFNVLVSQGLGLALGAVLMDAKQGTTLASVTMLVFLLVGGYYIQHIP  597

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC++LL+GVQY+ N+ Y+C  G  CRV DFP +  +G +++  DV+ 
Sbjct  598  SFIAWLKYVSFSHYCYELLVGVQYSVNEVYDCGAGRQCRVMDFPAISCLGLDNLLRDVAA  657

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  658  LAVMLVGYRLLAYMALR  674



>ref|XP_011077437.1| PREDICTED: ABC transporter G family member 21 [Sesamum indicum]
Length=672

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++AVF FPQE  ML +E SSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  471  PLFSAVFVFPQEWSMLTRECSSGMYRLSSYYFARTVGDLPMELVLPTIFVTISYWMGGLK  530

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L I+L +VLV+Q LGLA GA+LM+VKQATTL+SV  LV L+A GYY+Q IP
Sbjct  531  PSLITFLLTLWIILLNVLVAQGLGLALGAVLMNVKQATTLSSVLMLVFLLASGYYIQHIP  590

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y+C  G+ CR  DFP +K +G +HM +DV  
Sbjct  591  PFIDWLKYISFSHYCYKLLVGVQYSPNEVYDCGLGYVCRAVDFPAIKYLGIDHMGLDVIA  650

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  651  LMLMLVGYRLLAYVALR  667



>emb|CDP00551.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NAVF FPQE+ ML +ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWM GLK
Sbjct  477  PMFNAVFAFPQEQPMLTRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVIVTYWMSGLK  536

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ  GLA GAILMD+KQATTL+SV  LV L+A GYY++ IP
Sbjct  537  PSLVTFVLTLLIILFNVLVSQGFGLALGAILMDLKQATTLSSVMMLVFLLASGYYIRHIP  596

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S Y +KLLL VQY++N+ Y+C  G +CRV D P +K +G  ++ +DV+ 
Sbjct  597  PFIAWLKYISFSHYSYKLLLAVQYSNNELYQCGVGVHCRVMDNPAIKFLGIENLGMDVAA  656

Query  201  MAMMLVGYRFIAYLALHRVR  142
            +A+ML+GYR +AY+AL R+R
Sbjct  657  LAVMLIGYRLLAYIAL-RLR  675



>ref|XP_006395639.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
 gb|ESQ32925.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
Length=670

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  472  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  531

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  532  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  591

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +CRV D+ G+K +   +M  DV  
Sbjct  592  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGLGLHCRVMDYEGIKNLRIGNMMWDVLA  651

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR  AYLAL  +
Sbjct  652  LAIMLLLYRVFAYLALRNL  670



>ref|XP_010514180.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=673

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  535  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  595  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLRIGNMMWDVLA  654

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  655  LAIMLLSYRVLAYLALRNL  673



>ref|XP_006855537.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
 gb|ERN17004.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
Length=646

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ ++FTFPQER ML KERSS MYRLS+YF+A+  GDLP+EL LPT+F  I+YWMG
Sbjct  441  GFFPLFQSIFTFPQERLMLHKERSSAMYRLSAYFMARIAGDLPMELLLPTSFVTIIYWMG  500

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+PL F  +L +VL++VL++  LGLA GA++M+++ ATTL SV TL  ++ GGY++Q
Sbjct  501  GLKPDPLHFLCTLFVVLYNVLIAGGLGLAIGAMVMNLRNATTLGSVITLTFMLTGGYFIQ  560

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            ++P F+ W++Y+S + Y FKLLLG QY+ ++ YEC  G  CR+ADFP +KA+G +HM   
Sbjct  561  KVPVFMAWIRYISMTHYTFKLLLGSQYSVDEMYECEPGKSCRIADFPMIKAIGLDHMVRS  620

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
              V+ +MLVGYR +AY +L R+
Sbjct  621  ALVLWIMLVGYRLVAYASLTRI  642



>ref|XP_010425209.1| PREDICTED: ABC transporter G family member 21 isoform X1 [Camelina 
sativa]
Length=672

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  534  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYSWDEVYECGSGLHCSVMNYEGIKNLRIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAIMLLLYRVLAYLALRNL  672



>ref|XP_002876921.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53180.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  473  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  532

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  533  PSLTTFIMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  592

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY   + YEC  G +C V D+ G++ +   +M  DV  
Sbjct  593  GFIAWLKYVSFSHYCYKLLVGVQYTWGEVYECGSGLHCSVMDYEGIRNLRIGNMMWDVLA  652

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  653  LAIMLLLYRVLAYLALRNL  671



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+GDLP+EL LPT F  I YWM 
Sbjct  395  GFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVIITYWMA  454

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP  + F  +L  +LFSVLVSQSLGLA GA +MD K AT L SV  L  L+AGGYYVQ
Sbjct  455  GLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAGGYYVQ  514

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG QY   D Y CS    C V DFP V+ VG +   + 
Sbjct  515  NVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKTTCLVGDFPAVQLVGLDKQILA  574

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R+
Sbjct  575  AVALAIMLVGYRLIAYIALMRI  596



>ref|XP_006290691.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
 gb|EOA23589.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
Length=673

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  535  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G  C V ++ G+K +   +M  DV  
Sbjct  595  SFISWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLQCSVMNYEGIKNLKIGNMMWDVLA  654

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  655  LAIMLLLYRVLAYLALRNL  673



>ref|XP_010502439.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Camelina sativa]
Length=672

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  534  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLMIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAIMLLLYRVLAYLALRNL  672



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+GDLP+EL LPT F  I YWM 
Sbjct  415  GFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVIITYWMA  474

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP  + F  +L  +LFSVLVSQSLGLA GA +MD K AT L SV  L  L+AGGYYVQ
Sbjct  475  GLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAGGYYVQ  534

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG QY   D Y CS    C V DFP V+ VG +   + 
Sbjct  535  NVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKTTCLVGDFPAVQLVGLDKQILA  594

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R+
Sbjct  595  AVALAIMLVGYRLIAYIALMRI  616



>gb|EMT29518.1| hypothetical protein F775_52365 [Aegilops tauschii]
Length=571

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 145/201 (72%), Gaps = 17/201 (8%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  385  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  444

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ                G  +  + 
Sbjct  445  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQ----------------GTTLASVV  488

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
              +  + +L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  489  TMVFLIAWLNYSFYCYRLLLGIQFRDGGALYDCGGGALCPVADFPAIKAVGLNNHWVDVC  548

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  549  VMALLLVGYRVVAYLALDRLQ  569



>emb|CDY48079.1| BnaA06g33490D [Brassica napus]
Length=665

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVFTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  467  PLFNAVFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  526

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A T +SV  LV L+AGGYY+Q IP
Sbjct  527  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIP  586

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  587  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGYMMWDVLA  646

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  647  LALMLFLYRVLAYLALRNL  665



>ref|XP_009152126.1| PREDICTED: ABC transporter G family member 21 [Brassica rapa]
Length=666

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  468  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A T +SV  LV L+AGGYY+Q IP
Sbjct  528  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  588  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGYMMWDVLA  647

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  648  LALMLFLYRVLAYLALRNL  666



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMG
Sbjct  467  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMG  526

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    TF ++L+IVL+SVLVSQ +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q
Sbjct  527  GLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  586

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  587  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRLGNMMWD  646

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  647  VLALTLMLLLYRFLAYVALRNL  668



>ref|XP_009129040.1| PREDICTED: ABC transporter G family member 21-like [Brassica 
rapa]
Length=669

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMG
Sbjct  468  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMG  527

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    TF ++L+IVL+SVLVSQ +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q
Sbjct  528  GLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  587

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  588  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRLGNMMWD  647

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  648  VLALTLMLLLYRFLAYVALRNL  669



>gb|KFK39853.1| hypothetical protein AALP_AA3G297000 [Arabis alpina]
Length=672

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILM+ K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  534  PSLATFLMTLMIVLYNVLVAQGVGLAIGAILMEAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ Y+C  G +C V D+ G+K +   +M  DV  
Sbjct  594  GFIAWLKYISFSHYCYKLLVGVQYSWDEVYDCGLGLHCSVMDYEGIKNLKIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A ML+ YR ++YLAL  +
Sbjct  654  LAFMLIFYRVLSYLALRNL  672



>ref|XP_009586692.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
tomentosiformis]
Length=675

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  LTF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  535  PSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFINWLKYISFSHYCYKLLLGVQYSKNELYECGIGKYCEVMEFPAIKVLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV YR +AY+AL 
Sbjct  655  LVVMLVVYRLLAYVALR  671



>emb|CDX99764.1| BnaC02g35560D [Brassica napus]
Length=685

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 157/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY+ A+TVGDLP+EL LPT F  I YWMG
Sbjct  484  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYTARTVGDLPMELILPTIFVTITYWMG  543

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    TF ++L+IVL++VLVSQ +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q
Sbjct  544  GLKSSLTTFIMTLMIVLYNVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  603

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  604  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCGVMDYEGIKNLSLGNMMWD  663

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  664  VLALTLMLLLYRFLAYVALRNL  685



>gb|KDP27016.1| hypothetical protein JCGZ_20951 [Jatropha curcas]
Length=621

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFEAIFTFPQERRMLAKERSSGTYRLSSYFMSRLVSDLPMELVLPTVFITITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P  F  +L ++L+SVLVSQ LGLA GA +MD K+ATTL SV  L  L+AGGYYVQ
Sbjct  474  GLKPTPQNFFYTLFVLLYSVLVSQGLGLALGAAVMDQKKATTLGSVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KYLS S Y +KLL+G QY  N+ Y C +   C V DFP VK VG +   V 
Sbjct  534  HVPSFIAWIKYLSISQYTYKLLVGSQYKANETYPCGE-SVCLVGDFPLVKTVGLDGQIVS  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +ML+GYR IAYLAL RV
Sbjct  593  AVALGIMLLGYRLIAYLALMRV  614



>emb|CDY51602.1| BnaCnng21050D [Brassica napus]
Length=666

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 154/199 (77%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  468  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  528  PSLSTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+ VQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  588  GFIAWLKYISFSHYCYKLLVEVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGNMMWDVLA  647

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  648  LALMLFLYRVLAYLALRNL  666



>gb|EYU26406.1| hypothetical protein MIMGU_mgv1a004006mg [Erythranthe guttata]
Length=549

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+A T+GDLP+EL LPT F  I YWM 
Sbjct  342  GFYPLFQAIFTFPQERLMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFTITYWMA  401

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F   L ++L+SVL +Q LGLA GA +MD+K AT L SV  L  L+A GYYVQ
Sbjct  402  GLKPAAGPFFSGLFVLLYSVLCAQGLGLAIGAAVMDMKAATVLGSVIMLTFLLASGYYVQ  461

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KYLS S Y FKLLLG QY+  + Y C   G  C V DFP VKAVG +   V
Sbjct  462  HVPVFIGWIKYLSISQYAFKLLLGTQYSVGETYPCGGGGRRCLVEDFPAVKAVGLDGQVV  521

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+M+VGYR IAY+AL R+
Sbjct  522  SAVALALMIVGYRLIAYVALMRI  544



>ref|XP_009768130.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=674

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  474  PLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  LTF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  534  PSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ Y+C  G YC V +FP +K +G +++ +DV  
Sbjct  594  IFINWLKYISFSHYCYKLLLGVQYSRNEVYQCGIGKYCEVVEFPAIKVLGIDNLVLDVVA  653

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV YR +AY+AL 
Sbjct  654  LVVMLVVYRLLAYVALR  670



>ref|XP_006878615.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 156/204 (76%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKE-RSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWM  574
            GF+PL++AVF FPQER +L+KE R+S  YRLSSYF A+T+GDLP ELALPT F  + Y+ 
Sbjct  444  GFFPLFHAVFAFPQERAILMKEQRTSSYYRLSSYFTARTLGDLPTELALPTLFVLLSYFT  503

Query  573  GGLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYV  394
            GGLKP    FTL+LL++L +VLVSQ LGLA GA+LMDVK+ TTLASV TLV L+AGGYYV
Sbjct  504  GGLKPTFTNFTLTLLVILLNVLVSQGLGLALGAVLMDVKKGTTLASVITLVFLLAGGYYV  563

Query  393  QQIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWV  214
            Q++P FI WLKY+S+S+YC+KLLLGVQY + D Y C  G  CRV D P V  VG  +   
Sbjct  564  QRVPSFIAWLKYVSFSYYCYKLLLGVQYGEGDVYGCGTG-LCRVVDLPAVANVGVGNKGR  622

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DV  + +M+VGYR IAY AL R++
Sbjct  623  DVGALVVMMVGYRLIAYAALRRLK  646



>ref|XP_009793168.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=644

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 153/197 (78%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER  LI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  444  PLFSAIFAFPQERPKLIRERSSGMYRLSSYYFARTVGDLPMELILPTIFVTITYWMGGLK  503

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  + F L+LLI+L +VLV+Q LGLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  504  PSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  563

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             F+ WLKY+S+S YC+KLL+GVQY+  + YEC     C+V DFP +K +G +++ +D+  
Sbjct  564  SFVTWLKYVSFSHYCYKLLVGVQYSRFEVYECGIDEECKVMDFPAIKCLGIDNLALDLVA  623

Query  201  MAMMLVGYRFIAYLALH  151
            + +M V +R +AY+AL 
Sbjct  624  LVVMFVIFRVLAYVALR  640



>gb|EYU28941.1| hypothetical protein MIMGU_mgv1a002356mg [Erythranthe guttata]
Length=684

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQE+ ML +E SSGMYRLSSY+ A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLFNAIFVFPQEKPMLARETSSGMYRLSSYYTARIVGDLPMELVLPTLFVTITYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+L IVL +VLV+Q LGLA GA+LMDVKQATTL+SV  LV L+  GYY+Q IP
Sbjct  542  PSLITFLLTLSIVLLNVLVAQGLGLALGAVLMDVKQATTLSSVLMLVFLLVSGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S +C++LL+GVQY++N+ YEC  G  CRV D P +K +G +++  DV+ 
Sbjct  602  PFIDWLKYVSFSQFCYRLLVGVQYSENEVYECGLGSVCRVVDSPAIKYLGIHNLAADVAA  661

Query  201  MAMMLVGYRFIAYLAL  154
            +A+MLVGYR +AY+AL
Sbjct  662  LAVMLVGYRVLAYVAL  677



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+++TVGDLP+EL LPT F  I YW+ 
Sbjct  410  GFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYWIA  469

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP  L F  +L  +LFSVLVS  LGLA GA++MD K AT L SV  L   +AGGYYV 
Sbjct  470  GLKPFALNFFSTLFTLLFSVLVSHGLGLALGALVMDQKSATILGSVIMLSFTLAGGYYVH  529

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLL+G Q+   + Y C     C V DFP +K+VG     + 
Sbjct  530  HVPSFIAWIKYISISQYTFKLLIGSQFEAGETYTCGINTTCYVEDFPAIKSVGIGDKAIS  589

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  +A+MLV YR +AY+AL R+
Sbjct  590  VVALAIMLVAYRLLAYVALMRI  611



>ref|NP_001189973.1| ABC transporter G family member 21 [Arabidopsis thaliana]
 sp|Q7XA72.2|AB21G_ARATH RecName: Full=ABC transporter G family member 21; Short=ABC transporter 
ABCG.21; Short=AtABCG21; AltName: Full=White-brown 
complex homolog protein 21; Short=AtWBC21 [Arabidopsis thaliana]
 dbj|BAB03081.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE77044.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=672

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP
Sbjct  534  PSLTTFIMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMDYEGIKNLRIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAVMLLLYRVLAYLALRNL  672



>ref|XP_006366061.1| PREDICTED: ABC transporter G family member 21-like [Solanum tuberosum]
Length=675

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P+ +TF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  535  PKFVTFILTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFINWLKYISFSHYCYKLLLGVQYSRNEVYECGIGKYCEVLEFPPIKYLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLAL  154
            + +MLV YR +AY+AL
Sbjct  655  LVVMLVVYRLLAYVAL  670



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+++TVGDLP+EL LPT F  I YWM 
Sbjct  410  GFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYWMA  469

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +L  +LFSVLVSQ LGLA GA++MD K AT L SV  L   +AGGYYV 
Sbjct  470  GLKPFAPNFFSTLFTLLFSVLVSQGLGLALGALVMDQKSATILGSVIMLSFTLAGGYYVH  529

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLL+G Q+   + Y C     C V DFP +K+VG     + 
Sbjct  530  HVPSFIAWIKYISISQYTFKLLIGSQFEPGETYPCGLNATCYVEDFPAIKSVGLGDKAIS  589

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +MLV YR +AY+AL R+
Sbjct  590  VVALGIMLVAYRLLAYVALMRI  611



>ref|XP_010034170.1| PREDICTED: ABC transporter G family member 9 [Eucalyptus grandis]
Length=651

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 144/202 (71%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+NA+FTFP+ER ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM 
Sbjct  443  GFYPLFNAIFTFPKERMMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTVFVAITYWMA  502

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            G+KP    F  +L ++L+SVLV+Q LGLA GA++MD + AT L SV  L  L+AGGYYVQ
Sbjct  503  GMKPTAGNFLYTLFVLLYSVLVAQGLGLAIGAVVMDQQSATILGSVLMLTFLLAGGYYVQ  562

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +PPFI W++YLS S Y +KLL+  Q+  +D Y C     C V D+PG+K VG +   V 
Sbjct  563  NVPPFIAWIRYLSISHYTYKLLMTSQFRPDDTYPCGGDSSCLVGDYPGIKEVGLDGQAVS  622

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M V YR IAY+AL R+
Sbjct  623  AVALGIMFVAYRLIAYVALMRI  644



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 141/202 (70%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+A T+GDLP+EL LPT F  I YWM 
Sbjct  413  GFYPLFQAIFTFPQERMMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFVITYWMA  472

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+P  F   L  +L+SVL SQ LGLA GA +M+ K AT L SV  L  L+A GYYVQ
Sbjct  473  GLKPDPRCFFAGLFTLLYSVLCSQGLGLALGAAVMNQKSATILGSVIMLTFLLASGYYVQ  532

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLLLG Q+   + Y C  G  C V DF  +K VG     + 
Sbjct  533  HVPAFISWIKYISISQYTFKLLLGSQFKPGETYPCGNGKTCLVEDFGMIKPVGLGGHAIA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  +A+MLVGYR +AY+AL R+
Sbjct  593  VIALAVMLVGYRLVAYVALMRI  614



>ref|XP_004236984.1| PREDICTED: ABC transporter G family member 21 [Solanum lycopersicum]
Length=675

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSGMYRLSSY+ A++VGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARSVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P+ LTF L+LLI+L +VLVSQ +GLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  535  PKFLTFILTLLIILLNVLVSQGIGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFIDWLKYISFSHYCYKLLLGVQYSRNEVYECGIGKYCEVLEFPPIKYLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLAL  154
            + +MLV YR +AY+AL
Sbjct  655  LVVMLVVYRLLAYVAL  670



>ref|XP_010277245.1| PREDICTED: ABC transporter G family member 9-like [Nelumbo nucifera]
Length=981

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  AVFTFPQER MLIKERSSGMYRLSSYF+++T+GDLP+ELALPTAF  I YWM 
Sbjct  776  GFFPLVQAVFTFPQERMMLIKERSSGMYRLSSYFISRTIGDLPMELALPTAFVAITYWMA  835

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            G KP   +F  +L +VL SV+VSQ LGLA G+I+M+ K AT L SV   + L+ GGYY+Q
Sbjct  836  GFKPSATSFMETLYVVLLSVMVSQGLGLAIGSIVMNPKAATVLGSVVINIFLLTGGYYIQ  895

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            +IPPF+ W+KY+S S Y +KLLLG QY+ ++ Y C     CRV DFP VK  G +   + 
Sbjct  896  KIPPFMEWIKYISISHYNYKLLLGAQYSADETYPCDFNVTCRVGDFPTVKYAGLDRKAIS  955

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M + YR IAY+AL RV
Sbjct  956  YIALGIMFLAYRLIAYIALMRV  977



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 148/202 (73%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+NA+FTFPQER ML KER+SGMYRLSSYF+A+T+GDLP+EL LP+ F  I YWM 
Sbjct  420  GFFPLFNAIFTFPQERLMLEKERASGMYRLSSYFMARTIGDLPMELVLPSVFITITYWMA  479

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    +F    L++L++VLV+Q LGLA GA+++D K AT L SV  L  ++AGGYYVQ
Sbjct  480  GLKATAASFLGCWLVLLYAVLVAQGLGLAVGALVLDQKNATILGSVIMLSFILAGGYYVQ  539

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KL +  QYN  + Y C++   C V DFP +K++G + ++  
Sbjct  540  HVPSFIAWIKYVSIGQYAYKLFIMSQYNPGETYPCAENKTCLVEDFPSIKSIGPHGLFSS  599

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  MA+MLVGYR +AY+AL R+
Sbjct  600  VVAMAIMLVGYRLVAYIALMRI  621



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL  A+FTFPQER ML KERSSGMYRLS+YF+A+T+GDLP+EL LPT FT I YWM G
Sbjct  423  FFPLLQAIFTFPQERMMLEKERSSGMYRLSAYFMARTIGDLPMELVLPTIFTVITYWMTG  482

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP  L F  +L  +L++VLVSQ LGLA GA++MD + AT L SV  L   +AGGY+VQ 
Sbjct  483  LKPSALNFFSTLFSILYNVLVSQGLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQH  542

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QYN  + Y C     C V DFP +K +G     + +
Sbjct  543  VPWFISWIKYISISQYTYKLLLGSQYNHGETYSCGINATCLVEDFPTIKTIGIGGKGISM  602

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+M  GYRF+AY+AL RV
Sbjct  603  VALAVMFFGYRFLAYVALMRV  623



>gb|KHG01243.1| ABC transporter G family member 9 [Gossypium arboreum]
Length=629

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP+ER ML KERSSG YRLSSYF+++   DLP+EL LPT F  I YWM 
Sbjct  419  GFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVFLTITYWMA  478

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +L ++LFSVLVSQ LGLA GA++MD+K AT L SV  L   +AGGYY+Q
Sbjct  479  GLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFFLAGGYYIQ  538

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWV  214
             +PPFI W+KY+S S + +KLLLG QY  N+ Y C      C + DF G+K+VG N   V
Sbjct  539  HVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHSKTCLIGDFQGIKSVGLNGQVV  598

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLV YR IAYLAL R+
Sbjct  599  SAVALAIMLVMYRLIAYLALMRI  621



>gb|KJB62742.1| hypothetical protein B456_009G433300 [Gossypium raimondii]
Length=629

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP+ER ML KERSSG YRLSSYF+++   DLP+EL LPT F  I YWM 
Sbjct  419  GFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVFITITYWMA  478

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +L ++LFSVLVSQ LGLA GA++MD+K AT L SV  L   +AGGYY+Q
Sbjct  479  GLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFFLAGGYYIQ  538

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWV  214
             +PPFI W+KY+S S + +KLLLG QY  N+ Y C      C + DF G+K+VG N   V
Sbjct  539  HVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHMKTCLIGDFQGIKSVGLNGQVV  598

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLV YR IAYLAL R+
Sbjct  599  SAVALAIMLVMYRLIAYLALMRI  621



>ref|XP_010502438.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=185

 Score =   183 bits (464),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 0/185 (0%)
 Frame = -3

Query  699  MLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKPEPltftlsllivl  520
            MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLKP   TF ++L+IVL
Sbjct  1    MLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFLMTLMIVL  60

Query  519  fsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIPPFILWLKYLSYSFY  340
            ++VLV+Q +GLA GAILMD K+A TL+SV  LV L+AGGYY+Q IP FI WLKY+S+S Y
Sbjct  61   YNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGFIAWLKYVSFSHY  120

Query  339  CFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSVMAMMLVGYRFIAYL  160
            C+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  +A+ML+ YR +AYL
Sbjct  121  CYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLMIGNMMWDVLALAIMLLLYRVLAYL  180

Query  159  ALHRV  145
            AL  +
Sbjct  181  ALRNL  185



>ref|XP_009593646.1| PREDICTED: ABC transporter G family member 21 [Nicotiana tomentosiformis]
Length=644

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSG+YRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  444  PLFSAIFAFPQERPMLIRERSSGIYRLSSYYFARTVGDLPMELILPTIFVTVTYWMGGLK  503

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  + F L+LLI+L +VLV+Q LGLA GAILMDVKQATTL+SV  LV L+A GYY+Q IP
Sbjct  504  PSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  563

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             F+ WLKY+S+S YC+KLL+GVQY+  + YEC  G  CRV DFP +K +G +++ +D+  
Sbjct  564  SFVAWLKYVSFSHYCYKLLVGVQYSRFEVYECGIGEECRVMDFPAIKCLGIDNLVLDLVA  623

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV +R +AY+AL 
Sbjct  624  LVVMLVVFRILAYVALR  640



>ref|XP_008457190.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
 ref|XP_008457191.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
Length=673

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++++T GDLP+EL LPT F  + YWMGGL 
Sbjct  468  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMSRTAGDLPMELVLPTVFVTVTYWMGGLN  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  + F L+LL+VL +VLVSQ LGLA GAILM+VKQATTLASVT LV L+ GGYY++ IP
Sbjct  528  PSMIPFLLTLLVVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             F+ WLKY+S+S YC+KL++G+QYN  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  588  HFMSWLKYVSFSHYCYKLVVGIQYNSLNEAYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  647

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  648  DVAALFFMLVGYRILAFLAL  667



>gb|AFK38841.1| unknown [Lotus japonicus]
Length=145

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -3

Query  576  MGGLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYY  397
            MGGLKP+P+TF LSL++VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLV LIAGGYY
Sbjct  1    MGGLKPDPMTFILSLVVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYY  60

Query  396  VQQIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMW  217
            +QQIPPFI+WLKYLSYSFYC+KLLLGVQYN+NDYYECS+G +C+  DFP +K++G +H+W
Sbjct  61   IQQIPPFIVWLKYLSYSFYCYKLLLGVQYNENDYYECSEGKFCKAVDFPPIKSMGLDHLW  120

Query  216  VDVSVMAMMLVGYRFIAYLALHRVR  142
            VDV +MA+MLVGYR +AY ALH VR
Sbjct  121  VDVFIMALMLVGYRLLAYFALHGVR  145



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLS+YF+A+TVGDLP+EL LPT F  I Y+M G
Sbjct  426  FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFIARTVGDLPMELVLPTIFVVITYFMAG  485

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LK     F  +L  +L++VLVSQ LGLA GA++MD K AT L SV  L   +AGGY+VQ 
Sbjct  486  LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  545

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C+    C V DFP +K +G     + V
Sbjct  546  VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYTCAINATCLVEDFPSIKTIGLGGKGISV  605

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML+GYRF+AY+AL R+
Sbjct  606  VALAIMLLGYRFLAYVALMRI  626



>ref|XP_009383080.1| PREDICTED: ABC transporter G family member 9 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 149/201 (74%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLSSYF A+ VGDLP+EL LP  F  I YWMGG
Sbjct  430  FYPVFEAIFTFPQERTMLTKERSSGMYRLSSYFAARLVGDLPMELILPIIFITITYWMGG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP  + F ++L ++L  VLV+Q +GLA GA++MD+K ATTL S+  L  ++AGG+YVQ 
Sbjct  490  LKPVAVNFFMNLAVLLLCVLVAQGMGLALGALVMDLKTATTLGSILMLSFMLAGGFYVQN  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IPPFI W+KY+S S+Y FKL +  QY+ ND Y+C+    C++ADFP +K VGF+H  + V
Sbjct  550  IPPFIEWIKYISLSYYTFKLQIASQYSPNDTYQCTPSMRCQIADFPSIKLVGFDHKALAV  609

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLV YR  AYL L RV
Sbjct  610  FALLLMLVLYRLAAYLGLMRV  630



>ref|XP_009378509.1| PREDICTED: ABC transporter G family member 9 [Pyrus x bretschneideri]
Length=622

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER+SG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFQAIFTFPPERKMLEKERASGTYRLSSYFMSRIVADLPIELVLPTLFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +L  +L SVLV+Q +GLA GA++MD K+AT LASV  L  L+AGGYYVQ
Sbjct  474  GLKPSAGNFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y ++LLLG QY  ++ Y C  G  C V DFP +K+ G +     
Sbjct  534  HVPAFISWIKYISLSNYSYRLLLGSQYKKSETYPCD-GRVCSVGDFPTIKSAGLDGQSSA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +M+VGYRFI+YLAL R+
Sbjct  593  VVALVIMVVGYRFISYLALMRI  614



>ref|XP_008237669.1| PREDICTED: ABC transporter G family member 9-like [Prunus mume]
Length=614

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+FTFPQER ML KERSSG Y LSSYF+++ V DLP+ELALPT F  I YWM 
Sbjct  412  GFFPLLQAIFTFPQERMMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+A  LASV  +   +AGG++VQ
Sbjct  472  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQ  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KLLLG QYN+ND Y C  G  C V DFP +K VG +     
Sbjct  532  HVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSG-LCLVRDFPSIKHVGLSGQIGA  590

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R 
Sbjct  591  AVALAIMLVGYRLIAYIALMRT  612



>ref|XP_004170842.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=673

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGL 
Sbjct  468  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTAGDLPMELVLPTVFVTVTYWMGGLN  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLIVL +VLVSQ LGLA GAILM+VKQATTLASVT LV L+ GGYY++ IP
Sbjct  528  PSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             FI WLKY+S+S YC+KL++  QY+  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  588  LFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  647

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  648  DVTALXFMLVGYRILAFLAL  667



>ref|XP_007199008.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
 gb|EMJ00207.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
Length=614

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+FTFPQER+ML KERSSG Y LSSYF+++ V DLP+ELALPT F  I YWM 
Sbjct  412  GFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+A  LASV  +   +AGG++VQ
Sbjct  472  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQ  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KLLLG QYN+ND Y C  G  C V DFP +K VG +     
Sbjct  532  HVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSG-VCLVRDFPSIKHVGLSGQIGA  590

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVG R IAYLAL R 
Sbjct  591  AVALAIMLVGCRLIAYLALMRT  612



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL  A+FTFPQER ML KERSSGMYRLS+YF+A+T+GDLP+EL LPT FT I YWM G
Sbjct  423  FFPLLQAIFTFPQERMMLEKERSSGMYRLSAYFIARTIGDLPMELVLPTIFTVITYWMTG  482

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP    F  +L  +L++VLVSQSLGLA GA++MD + AT L SV  L   +AGGY+VQ 
Sbjct  483  LKPSAFNFFSTLFTILYNVLVSQSLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQH  542

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C     C V DFP +K++G     + +
Sbjct  543  VPWFISWIKYISISQYTYKLLLGSQYSRGETYSCGINATCLVEDFPTIKSIGLGGKGISM  602

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+M  GYR +AY+AL RV
Sbjct  603  VALAVMFFGYRLLAYVALMRV  623



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   192 bits (487),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 143/201 (71%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLS+YF+A+TVGDLP+EL LPT F  I Y+M G
Sbjct  432  FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFMARTVGDLPMELVLPTIFVVITYFMAG  491

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LK     F  +L  +L++VLVSQ LGLA GA++MD K AT L SV  L   +AGGY+VQ 
Sbjct  492  LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  551

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C     C V DFP +K +G     + V
Sbjct  552  VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYACGINTTCLVEDFPSIKTIGLGGKGISV  611

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML+GYRF+AY+AL R+
Sbjct  612  LALAIMLLGYRFLAYVALMRI  632



>ref|XP_008799253.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KER SGMYRLSSYF A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LK    +F ++L I+L  VL++Q LG A GA++MD+K +TTLASV  L  ++AGGYYVQ 
Sbjct  475  LKHSLWSFLITLSIMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGYYVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+SY +Y FK+ +  QY+  D YECS G  C V   P +  VGF+H  + +
Sbjct  535  VPPFIAWIKYISYIYYTFKIQISAQYSSGDTYECSGGQRCPVESVPAIAVVGFSHQSLAI  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + +M + +R +AY+AL RV
Sbjct  595  AALFIMFIFFRVVAYVALMRV  615



>ref|XP_008775311.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KER SGMYRLSSYF A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LK    +F ++L ++L  VL++Q LG A GA++MD+K +TTLASV  L  ++AGGYYVQ 
Sbjct  475  LKRSLWSFLITLSVMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGYYVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+SY +Y FK+ +  QY+  D YECS G  C V   P +  VGF+H  + +
Sbjct  535  VPPFIAWIKYISYIYYTFKIQISAQYSPGDTYECSSGQRCPVESVPAIAVVGFSHQSLAI  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + +M + +R +AY+AL RV
Sbjct  595  AALFIMFIFFRVVAYVALMRV  615



>ref|XP_004252106.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=1013

 Score =   194 bits (493),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 106/201 (53%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -3

Query  747   FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
             FY ++  +FTFPQER ML KERSSGMYRLS+YF+A TVGDLP+EL LPT  T I YWM G
Sbjct  808   FYSVFQGIFTFPQERMMLEKERSSGMYRLSAYFVAMTVGDLPMELVLPTISTLITYWMAG  867

Query  567   LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
             LKP    F  +L  +L++VLVSQSLGLA GA++MD + AT  A V  +   +AGG+YV  
Sbjct  868   LKPSAWRFFSTLFSLLYNVLVSQSLGLAIGAMVMDEQSATVFALVILISFTLAGGFYVHH  927

Query  387   IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
             +P FI W+K++S + Y +KLLLG QY+  + Y C     C V DFP +K +G     + +
Sbjct  928   VPKFIAWIKHVSITQYAYKLLLGSQYSPGETYSCGINATCLVEDFPSIKTIGLGGKVISI  987

Query  207   SVMAMMLVGYRFIAYLALHRV  145
               +A+ML+GYRF+AY+AL R+
Sbjct  988   VALAIMLLGYRFLAYIALKRI  1008



>ref|XP_004139018.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=666

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGL 
Sbjct  461  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTAGDLPMELVLPTVFVTVTYWMGGLN  520

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLIVL +VLVSQ LGLA GAILM+VKQATTLASVT LV L+ GGYY++ IP
Sbjct  521  PSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  580

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             FI WLKY+S+S YC+KL++  QY+  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  581  LFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  640

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  641  DVTALFFMLVGYRILAFLAL  660



>ref|XP_011042498.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 142/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PL+ A+FTFPQERRML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P  F L+L ++L+SVLV+  LGLA GA++++ + AT   SV  L  L+AGGYYV 
Sbjct  472  GLKGSPGNFFLTLSVLLYSVLVAGGLGLAIGALVLNRRSATITGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG QY   D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQYKPGDTYTCVGAGGVCLVGDYPAIKKVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
             V  + +MLVGYR IAYLAL R+
Sbjct  592  GVVALGIMLVGYRLIAYLALMRI  614



>gb|KGN61520.1| hypothetical protein Csa_2G153580 [Cucumis sativus]
Length=673

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/200 (63%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGL 
Sbjct  468  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTAGDLPMELVLPTVFVTVTYWMGGLN  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P  +TF L+LLIVL +VLVSQ LGLA GAILM+VKQATTLASVT LV L+ GGYY++ IP
Sbjct  528  PSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             FI WLKY+S+S YC+KL++  QY+  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  588  LFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  647

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  648  DVTALFFMLVGYRILAFLAL  667



>ref|XP_008226675.1| PREDICTED: ABC transporter G family member 9 [Prunus mume]
Length=622

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER+ML KERSSG YRLSSYF+++ V DLP+EL LP  F  I YWM 
Sbjct  414  GFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+AT LASV  L  L+AGGYYVQ
Sbjct  474  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG  Y+ +D Y C  G  C V +FP +K VG +     
Sbjct  534  HVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCDSG-VCLVREFPNIKHVGLDGQISG  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A MLVGYR I YLAL R+
Sbjct  593  AVALATMLVGYRLIGYLALMRI  614



>ref|XP_007021331.1| White-brown-complex ABC transporter family [Theobroma cacao]
 gb|EOY12856.1| White-brown-complex ABC transporter family [Theobroma cacao]
Length=626

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 143/200 (72%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+ DLP+EL LPTAF  I YWM GLK
Sbjct  419  PLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIADLPMELILPTAFVTITYWMAGLK  478

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P    F  +L  +LF VLVSQSLGLA GA++M++K AT L SV  L  L+AGG+Y+Q +P
Sbjct  479  PTAGNFLHTLFALLFCVLVSQSLGLALGALVMELKSATILGSVVILTFLLAGGFYIQHVP  538

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI W+KY+S S + +KL+LG QY  N+ Y C   G  C V DFP +K +  +   +   
Sbjct  539  PFISWIKYISISHHTYKLVLGSQYKPNETYPCDDPGKVCLVGDFPTIKNMNLDGQLLSAV  598

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLV YR IAYLAL R+
Sbjct  599  ALAIMLVVYRMIAYLALMRI  618



>ref|XP_007214012.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
 gb|EMJ15211.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
Length=622

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER+ML KERSSG YRLSSYF+++ V DLP+EL LP  F  I YWM 
Sbjct  414  GFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+AT LASV  L  L+AGGYYVQ
Sbjct  474  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG  Y+ +D Y C  G  C V +FP +K VG +     
Sbjct  534  HVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCDSG-VCLVREFPNIKHVGLDGQISG  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A MLVGYR I YLAL R+
Sbjct  593  AVALATMLVGYRLIGYLALMRI  614



>ref|XP_010520902.1| PREDICTED: ABC transporter G family member 9-like [Tarenaya hassleriana]
Length=620

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/204 (56%), Positives = 144/204 (71%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSGMY+LSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  411  GFFPLFQAIFTFPQERRMLEKERSSGMYKLSSYFMSRVVVDLPMELVLPTIFVVITYWMA  470

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P P  F L+L  +LF+VLVS  LGLA GA++MD+K ATTL SV  L  L+AGGYYVQ
Sbjct  471  GLNPNPRNFFLTLFGLLFNVLVSGGLGLALGAVVMDLKSATTLGSVIMLAFLLAGGYYVQ  530

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG--HYCRVADFPGVKAVGFNHMW  217
             +PPF+ W+KY+S   Y +KLL+  QY  +D Y C       C V DF  +K +G +   
Sbjct  531  HVPPFVSWIKYISIGNYAYKLLVLAQYKADDTYPCGADGRSVCYVGDFGAIKNIGLDGEA  590

Query  216  VDVSVMAMMLVGYRFIAYLALHRV  145
            + V  + +MLVGYR IAY+AL RV
Sbjct  591  MSVLALFLMLVGYRLIAYVALMRV  614



>ref|XP_006370303.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
 gb|ERP66872.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
Length=619

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PL+ A+FTFPQERRML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFLTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P  F L+L ++L+SVLV+  LGLA GA++++ + AT   SV  L  L+AGGYYV 
Sbjct  472  GLKGSPGNFFLTLFVLLYSVLVAGGLGLAIGALVLNQRSATITGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG QY  +D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQYKPSDTYTCGGAGGVCLVGDYPAIKKVGLDDQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +MLVGYR IAYLAL R+
Sbjct  592  GAVALGIMLVGYRLIAYLALMRI  614



>ref|XP_008386302.1| PREDICTED: ABC transporter G family member 9-like [Malus domestica]
Length=622

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER SG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFQAIFTFPPERKMLEKERXSGTYRLSSYFMSRIVADLPMELVLPTLFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP    F  +L  +L SVLV+Q +GLA GA++MD K+AT LASV  L  L+AGGYYVQ
Sbjct  474  GLKPSAANFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y ++LLLG QY  ++ Y C  G  C V +FP +K+ G +     
Sbjct  534  HVPAFISWIKYISLSNYSYRLLLGSQYKKSETYPCD-GRVCSVGEFPTIKSAGLDGQSSA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +M++GYRFI+YLAL R+
Sbjct  593  VVALVIMVMGYRFISYLALMRI  614



>ref|XP_001780064.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
 gb|EDQ55167.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
Length=584

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+++A+FTFPQER MLIKER+SGMYRLS+YF+A+ +GD+PLEL LPT F  I+YWM GLK
Sbjct  379  PVFSAIFTFPQERAMLIKERASGMYRLSAYFMARVIGDMPLELVLPTIFITIVYWMAGLK  438

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
               L F L+LL++L++VLVSQ LGL  GA LMDVK+ATTLASV  L  L+AGGYY+Q  P
Sbjct  439  QTFLAFILTLLVILYTVLVSQGLGLTLGAALMDVKKATTLASVIMLTLLLAGGYYIQNTP  498

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHY--CRVADFPGVKAVGFNHMWVDV  208
             +I W+KYLS S++ +KL L  QY+ +  Y CS G    CR+AD+P V  VG + + +  
Sbjct  499  KWIAWIKYLSVSYWSYKLQLAAQYSPDQTYACSTGSSGRCRIADYPAVANVGLDQLGIAA  558

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
              MA+MLVGYR  AY  L R++
Sbjct  559  MAMAIMLVGYRLSAYFFLSRIK  580



>gb|KDP27020.1| hypothetical protein JCGZ_20955 [Jatropha curcas]
Length=568

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PLY A+FTFP ERRML KERSSG YRLSSYF+++  GDLP+EL LPT F  I YWM 
Sbjct  363  GFIPLYQAIFTFPTERRMLAKERSSGTYRLSSYFISRMAGDLPMELLLPTIFVTITYWMA  422

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P  F  +L ++LF+VL+ QSLGLA GA++M+ K AT L S+  L   +AGGY+++
Sbjct  423  GLKPTPQNFLHTLFVLLFNVLLWQSLGLALGALIMNQKSATILGSIINLSFQLAGGYFIR  482

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            Q+P FI W+KY+S S Y +KLLLG QY  ++ Y C  G  C + ++P +K VG +   + 
Sbjct  483  QVPFFIAWIKYISISRYTYKLLLGSQYKPSETYPCGDG-VCSIRNYPSIKIVGLDGQLLS  541

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M +GYR IAYLAL R+
Sbjct  542  AFALGIMFLGYRLIAYLALMRI  563



>ref|XP_010921129.1| PREDICTED: ABC transporter G family member 9 [Elaeis guineensis]
Length=619

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP Y A+FTFPQER ML KER SGMYRLSSY++A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPAYQAIFTFPQERTMLTKERVSGMYRLSSYYVARMVGDLPMELILPIVFITITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LK    +F ++L ++L  VL++Q LG A GA++MD+K +TTLASV  L  ++AGG++VQ 
Sbjct  475  LKRTASSFFITLFVMLLEVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGFFVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+SY +Y FK+ +  Q++  + Y+CS GH C + D P + AVG +H  + V
Sbjct  535  VPRFIAWIKYISYIYYTFKVQISSQFSPGETYQCSGGHRCPIEDVPMISAVGLDHRSLAV  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + MML+ +R +AY+AL R+
Sbjct  595  AALFMMLIFFRVVAYVALMRI  615



>ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=627

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 149/207 (72%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL+LPT F  I YWM 
Sbjct  418  GFFPLFQAIFTFPQELLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFILITYWMA  477

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK + L F  +LL +L  VLVSQ LGLA GA +MD K ATTLASV  L  L+AGG+YVQ
Sbjct  478  GLKGKLLNFLYTLLTLLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLAGGFYVQ  537

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S ++Y ++L +  QY+D + Y CS G  CRVA+FP +K  GF H  + 
Sbjct  538  HVPVFISWVKYISINYYNYQLFIASQYSDGETYPCSTGQ-CRVAEFPSIKQTGF-HFNLQ  595

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              VMA     +M++GYR IAY+AL R+
Sbjct  596  EQVMAASALVIMMIGYRLIAYVALMRI  622



>ref|XP_009395262.1| PREDICTED: ABC transporter G family member 9-like [Musa acuminata 
subsp. malaccensis]
Length=622

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            +Y  + A+FTFPQER ML KERSSGMYRLSSYF+A+T+GDLP+EL+LP AF  I YW+GG
Sbjct  418  YYASFQAIFTFPQERTMLSKERSSGMYRLSSYFIARTLGDLPMELSLPIAFVTITYWLGG  477

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP   +F + L  +L SV+V+QSLGLA GA + ++K  + L +V  ++  +A G+YVQ 
Sbjct  478  LKPVASSFLICLSALLLSVVVAQSLGLAIGAFVTNLKSGSALLTVLMVIFQLASGFYVQN  537

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+S+++Y FKL +  QY+  D Y+C++   C V++FP  K +GF+   + V
Sbjct  538  VPPFISWVKYVSFNYYTFKLQIASQYSPTDTYQCTRTTTCPVSEFPSFKLLGFDKRALSV  597

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +M+  +RFIAYL L RV
Sbjct  598  IALFLMMFIFRFIAYLGLLRV  618



>ref|XP_006359002.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=629

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 140/201 (70%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FY ++  +FTFPQER ML KERSSGMYRLS+YF+A TVGDLP+EL LPT  T I YWM G
Sbjct  424  FYSVFQGIFTFPQERMMLEKERSSGMYRLSAYFMAMTVGDLPMELVLPTISTVITYWMAG  483

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP    F  +L  +L++VLVSQSLGLA GA++MD K AT LA V  +   +AGG+YVQ 
Sbjct  484  LKPSAGRFFSTLFSLLYNVLVSQSLGLAIGAMVMDEKSATVLALVILISFTLAGGFYVQH  543

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+K++S + Y +KLLLG QY+  + Y C     C V D P +K +G     + +
Sbjct  544  VPRFIAWIKHVSITQYAYKLLLGSQYSPGETYSCGLNATCLVEDSPSIKTIGLGGKGISI  603

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML G+RF+AY+AL R+
Sbjct  604  VALAVMLFGFRFLAYVALMRI  624



>gb|KHN36795.1| ABC transporter G family member 9 [Glycine soja]
Length=555

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 149/207 (72%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL+LPT F  I YWM 
Sbjct  346  GFFPLFQAIFTFPQELLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFILITYWMA  405

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK + L F  +LL +L  VLVSQ LGLA GA +MD K ATTLASV  L  L+AGG+YVQ
Sbjct  406  GLKGKLLNFLYTLLTLLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLAGGFYVQ  465

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S ++Y ++L +  QY+D + Y CS G  C+VA+FP +K  GF H  + 
Sbjct  466  HVPVFISWVKYISINYYNYQLFIASQYSDGEAYPCSTGQ-CQVAEFPSIKQTGF-HFNLQ  523

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              VMA     +M++GYR IAY+AL R+
Sbjct  524  EQVMAASALVIMMIGYRLIAYVALMRI  550



>ref|XP_009143407.1| PREDICTED: ABC transporter G family member 9 [Brassica rapa]
 emb|CDX89252.1| BnaA01g16410D [Brassica napus]
Length=638

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 147/203 (72%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFP+ERRML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPEERRMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P+P  F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYV+ 
Sbjct  490  LNPKPANFLLTLLVLLAHVLVSGGLGLALGALVMDQKTATTLGSVMMLTFLLAGGYYVRH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK--GHYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S S+Y +KLL+  QY +N++Y C +     C V DF G+K +GF+    
Sbjct  550  VPVFIAWIKYVSISYYTYKLLILGQYTENEWYPCGENGNSKCHVGDFEGIKLIGFHSGLA  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A MLVGYR +AY+AL R+
Sbjct  610  SSFALAAMLVGYRVVAYIALMRI  632



>ref|XP_011095242.1| PREDICTED: ABC transporter G family member 9-like isoform X2 
[Sesamum indicum]
Length=618

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 140/201 (70%), Gaps = 2/201 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            ++P + A+FT PQER ML KERSSGMYRLSS+F+A T+GDLP++L LPT +  + YWM G
Sbjct  413  YFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTLTYWMAG  472

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP+P  F     I L++V+ SQ LGLA GA++MD+K AT L ++ +LV  +AGGY+VQ 
Sbjct  473  LKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAGGYFVQN  532

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IP F+ WLKYLS   + FKLLLG QY   + Y C+    C V DFP +KA+G       +
Sbjct  533  IPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNKTCLVEDFPPIKAIGGQA--ASI  590

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              MA+M VGYR IAYLAL R+
Sbjct  591  IAMAIMFVGYRLIAYLALMRI  611



>ref|XP_011095241.1| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Sesamum indicum]
Length=654

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 140/201 (70%), Gaps = 2/201 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            ++P + A+FT PQER ML KERSSGMYRLSS+F+A T+GDLP++L LPT +  + YWM G
Sbjct  449  YFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTLTYWMAG  508

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            LKP+P  F     I L++V+ SQ LGLA GA++MD+K AT L ++ +LV  +AGGY+VQ 
Sbjct  509  LKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAGGYFVQN  568

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IP F+ WLKYLS   + FKLLLG QY   + Y C+    C V DFP +KA+G       +
Sbjct  569  IPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNKTCLVEDFPPIKAIGGQA--ASI  626

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              MA+M VGYR IAYLAL R+
Sbjct  627  IAMAIMFVGYRLIAYLALMRI  647



>emb|CDY29304.1| BnaC01g19560D [Brassica napus]
Length=638

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFP+ERRML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPEERRMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P+P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYV+ 
Sbjct  490  LNPKPVNFLLTLLVLLAHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGYYVRH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK--GHYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S S+Y +KLL+  QY ++++Y C +     C V DF G+K +GF+    
Sbjct  550  VPVFIAWIKYVSISYYTYKLLILGQYTESEWYPCGEIGNSKCHVGDFEGIKLIGFHSGLA  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A MLVGYR +AY+AL R+
Sbjct  610  SSFALAAMLVGYRVVAYIALMRI  632



>ref|XP_004244204.1| PREDICTED: ABC transporter G family member 9 [Solanum lycopersicum]
Length=613

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP ER ML KER+SG YRLSSYF+++ VGDLP+EL LPT F  I YW  
Sbjct  406  GFYPLFQAIFTFPPERMMLEKERASGTYRLSSYFMSRIVGDLPMELVLPTIFVIIAYWTT  465

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P+ F  +L  VL+ VLV+Q LGLA GA++MD+K AT LASVT L   +  G++V 
Sbjct  466  GLKQSPVNFFSTLFTVLYGVLVAQGLGLAIGAMIMDLKSATVLASVTMLSFTLVSGFFVH  525

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECS-KGHYCRVADFPGVKAVGFNHMWV  214
             +P FI WLKY+S + Y FKLL+G QY + + Y C      C V DFP +K+VG     +
Sbjct  526  HVPSFISWLKYISLTQYTFKLLVGSQYEEGEMYHCGVVDATCYVHDFPAIKSVGLGGNAI  585

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
             V  + +MLVGYR +AYL L R+
Sbjct  586  SVVALTIMLVGYRVLAYLVLTRI  608



>ref|XP_010675645.1| PREDICTED: ABC transporter G family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=636

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL++A+F FP ER +L KERSSGMYRLSSYF A+ V DLP+EL LPT +  I Y+MG
Sbjct  416  GFFPLFDAIFAFPPERMVLAKERSSGMYRLSSYFFARMVSDLPVELILPTVYVIITYFMG  475

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    +F   L  +L S++VSQ LGLA GA++MD+K ATTL SV  L  L+AGG+YVQ
Sbjct  476  GLKRNAASFLYYLFSLLLSIMVSQGLGLALGALVMDLKAATTLGSVLMLTFLLAGGFYVQ  535

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECS-KGHYCRVADFPGVKAVGFNHMWV  214
             IP FI W+KYLS   Y FKLLLG Q+   D Y C      C V DFP +++VG    +V
Sbjct  536  NIPAFIKWIKYLSILNYNFKLLLGSQFKPGDTYPCDGDTKVCLVEDFPSIRSVGIRGQFV  595

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
               V+ +M VGYR IAY AL R+
Sbjct  596  SAIVLVIMFVGYRLIAYFALTRI  618



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9 [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 141/204 (69%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER+SG YRLSSYF+++ +GDLP+EL LPT F  I+YWM 
Sbjct  425  GFFPLFQAIFTFPPERKMLEKERTSGTYRLSSYFMSRIIGDLPMELVLPTLFITIVYWMA  484

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            G K     F  +L ++L  VLV+Q +GLA GA++MD++ AT L SV  L  L+AGGYYVQ
Sbjct  485  GFKTTAGNFFHTLFVLLLLVLVAQGMGLALGAVVMDLQSATVLGSVLMLSFLLAGGYYVQ  544

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC--SKGHYCRVADFPGVKAVGFNHMW  217
             +P FI W+KY+S S + +KLL+G QY  +D + C       C V DFP +K +G +   
Sbjct  545  HVPRFISWIKYISISNHAYKLLIGSQYKGSDTFPCVNDANRLCLVRDFPNIKTIGLDGQV  604

Query  216  VDVSVMAMMLVGYRFIAYLALHRV  145
              +  +A+MLV YR IAY+AL R+
Sbjct  605  NALVALAIMLVFYRLIAYIALMRI  628



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 146/203 (72%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  432  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  491

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYV+ 
Sbjct  492  LNPNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLAFLLAGGYYVRH  551

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W++YLS  +Y +KLL+  QY +N +Y C +     C V DF G+K +GF+    
Sbjct  552  VPVFISWIQYLSIGYYTYKLLILGQYTENQWYPCGENGKLKCYVGDFEGIKHIGFHSGLS  611

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  612  SAFALAVMLVGYRIVAYIALMRI  634



>ref|XP_002533914.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28469.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=632

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSGMYRLSSYF+++TV DLP+EL LP  F  I YWM 
Sbjct  422  GFFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRTVSDLPMELVLPAIFVIITYWMA  481

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +L +VLF+VLV+Q LGLA GAI++D + ATT+ SV  L   +  GYYVQ
Sbjct  482  GLKSTAVNFLNTLFVVLFNVLVAQGLGLALGAIVLDQRSATTVGSVLMLSFQLVSGYYVQ  541

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC--SKGHYCRVADFPGVKAVGFNHMW  217
             +P FI W+KY+S S Y ++LLLG QY   D Y C  +    C V D+P +K VG     
Sbjct  542  NVPIFIGWIKYISISQYTYRLLLGSQYKQTDTYPCNTTASGVCLVGDYPAIKMVGLG---  598

Query  216  VDVSVMA-----MMLVGYRFIAYLALHRV  145
            VD  ++A     +MLV +R IAYLAL R+
Sbjct  599  VDGQIIAAVALLIMLVLFRVIAYLALTRI  627



>ref|XP_006493205.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=650

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 140/206 (68%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+ TFP ER ML KERSSGMYRLSSY +AKT GD  +EL LPT F  I YWMG
Sbjct  440  GFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTAGDFVMELVLPTVFVIITYWMG  499

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +L   L++ LV+QSLGLA GA++++ ++A T+A+   L  L+ GG++VQ
Sbjct  500  GLKARVINFLSTLAATLYTALVAQSLGLAVGALVLNQRKAGTIATTLMLTFLLTGGFFVQ  559

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH----YCRVADFPGVKAVGFNH  223
             +P FI WL+YLS++ Y +KLLL  QYN ND Y C+        C V DFP +K VG N+
Sbjct  560  DVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYICASNSNSNATCLVGDFPRIKFVGLNN  619

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
              + V +MA M V Y+ I YLAL RV
Sbjct  620  KLLSVVMMAAMFVCYKLITYLALRRV  645



>emb|CDY29837.1| BnaA03g48580D [Brassica napus]
Length=644

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P+P+ F L+LLI+L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>emb|CDX92829.1| BnaC07g40870D [Brassica napus]
Length=644

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P+P+ F L+LL +L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLTLLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKMKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>ref|XP_006441201.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
 gb|ESR54441.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
Length=607

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 140/206 (68%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+ TFP ER ML KERSSGMYRLSSY +AKT GD  +EL LPT F  I YWMG
Sbjct  397  GFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTTGDFVMELVLPTVFVIITYWMG  456

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +L   L++ LV+QSLGLA GA +++ ++A T+A+   L  L+ GG+++Q
Sbjct  457  GLKARVINFLSTLAATLYTALVAQSLGLAVGAFVLNQRKAGTIATTLMLTFLLTGGFFLQ  516

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH----YCRVADFPGVKAVGFNH  223
             +P FI WL+YLS++ Y +KLLL  QYN ND Y C+        C V DFP +K VG N+
Sbjct  517  DVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYVCASNSNSNATCLVGDFPRIKFVGLNN  576

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
              + V +MA+M V Y+ I YLAL RV
Sbjct  577  KLLSVVMMAVMFVCYKLITYLALRRV  602



>ref|XP_006447786.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
 gb|ESR61026.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
Length=608

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 137/200 (69%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FT PQE++ML KE SSGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  406  PMLECIFTLPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  465

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P    F  +L ++LFSVL SQ LGLA GA++M+ K AT L S+   + ++AGGYYVQ +P
Sbjct  466  PTASNFFETLFVLLFSVLESQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  525

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKYLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG N     V 
Sbjct  526  SFIAWLKYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLNRKDYSVI  585

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  586  ALAIMLVGYRLIAYIALMRI  605



>gb|EPS69022.1| hypothetical protein M569_05746, partial [Genlisea aurea]
Length=577

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 141/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+F FP+E+ ML KERSSGMYRLSSYF+A  + DLP++L LPTAF  ++Y+M 
Sbjct  372  GFYPLFQAIFIFPKEKMMLKKERSSGMYRLSSYFMALNLSDLPMQLVLPTAFFAVIYFMS  431

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+P P  F  +L ++LFSVLVS SLGLA GA +MD K AT + +V  L  L+AGGYYV+
Sbjct  432  GLRPSPAAFFSALSVLLFSVLVSHSLGLAIGAAVMDEKSATMMGTVIMLGFLLAGGYYVR  491

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +  F+ W+KY+S S Y +KLL+G Q+   + Y+C  G  C V DFP VKAVG       
Sbjct  492  HVAGFVSWIKYVSISHYTYKLLIGAQFEGGERYDCG-GRVCFVRDFPMVKAVGLGGSGWS  550

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  M +MLV Y  +AYLAL R+
Sbjct  551  VGAMVIMLVVYSVVAYLALMRI  572



>gb|KDP27018.1| hypothetical protein JCGZ_20953 [Jatropha curcas]
Length=338

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 132/202 (65%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
             F PL  A FTFP+ER+ML KE SSG YR SSYF+++ + DLP+ELALPT F  I YWMG
Sbjct  133  AFVPLNQATFTFPKERKMLTKELSSGTYRPSSYFMSRMISDLPMELALPTVFVTITYWMG  192

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP P  F  SL ++LF+VLVSQ +GLA GA +MD K A  L  V  L   ++ G+++Q
Sbjct  193  GLKPAPKNFLPSLFVILFNVLVSQGMGLALGATIMDQKSAAVLGQVIMLSFQLSAGFFIQ  252

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY S  F   KLLLG QY  +D Y C +G  C V DF  +K  G +     
Sbjct  253  HVPSFIGWIKYFSICFNALKLLLGSQYKPSDTYPCGEG-VCSVGDFHMIKTAGLDGQVQS  311

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A++LVG+R +AYLA+ R+
Sbjct  312  AITLAVLLVGFRLLAYLAIIRI  333



>ref|XP_009137658.1| PREDICTED: ABC transporter G family member 9-like [Brassica rapa]
Length=644

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQ+R+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQQRKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L P+P+ F L+LLI+L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>gb|KJB13426.1| hypothetical protein B456_002G073600 [Gossypium raimondii]
Length=627

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 100/203 (49%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PLY A+FTFPQER ML KERS+G+YRLSSYF+++ + DLP+EL LP  F  I YWM 
Sbjct  417  GLFPLYQAIFTFPQERLMLEKERSAGLYRLSSYFMSRIISDLPMELTLPIVFITISYWMA  476

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP   +F  +L  ++  VL SQ +GLA GA++M+ K A TL S+  L  L+A GYY+Q
Sbjct  477  GLKPTAGSFLYTLFALILCVLGSQGIGLAIGALVMNTKSAATLGSIIMLTFLLASGYYIQ  536

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWV  214
            Q P F+ W+KY++ + Y +KLLLG QY  +D Y C++ G  C V DF  +K VG +   +
Sbjct  537  QFPGFMSWIKYIALTHYAYKLLLGSQYQPHDTYPCNEPGKVCLVGDFQPIKTVGLDGQLI  596

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +M++ YR +AYLAL R+
Sbjct  597  SAVALILMVLIYRLVAYLALMRI  619



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLS+YF+++ V DLP+EL LPT F  I Y+M 
Sbjct  388  GFFPLFQAIFTFPQELMMLEKERSSGMYRLSAYFISRMVADLPMELVLPTIFLLITYFMA  447

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +L  +L +VLVSQ LGLA GA+++D K ATTLASV  L  L+AGG+YVQ
Sbjct  448  GLKATVINFFQTLFSLLLNVLVSQGLGLALGAVVLDQKSATTLASVIMLCFLLAGGFYVQ  507

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI+W+KY+S S+Y ++L +G QY+  D Y CS G  C + +FP +K +G +   + 
Sbjct  508  NVPKFIVWVKYVSVSYYTYQLFIGSQYHSGDTYPCSSGQ-CLIDEFPPIKQIGIDLNGLG  566

Query  210  VSVMAM--MLVGYRFIAYLALHRV  145
             + +A+  ML+GYR IAY AL R+
Sbjct  567  FAALALVIMLIGYRLIAYCALMRI  590



>ref|XP_006464709.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=628

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 140/200 (70%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FTFPQE++ML KE SSGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  424  PMLECIFTFPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  483

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P    F  +L ++LFSVLVSQ LGLA GA++M+ K AT L S+   + ++AGGYYVQ +P
Sbjct  484  PTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  543

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI W++YLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG +  +  V 
Sbjct  544  SFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKYYSVI  603

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  604  ALAIMLVGYRLIAYIALMRI  623



>ref|XP_010433373.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=638

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 143/203 (70%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ V DLP+EL LP  F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVADLPMELILPCCFLLITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L   P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  490  LNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +K+L+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKILILGQYTENEWYPCGENEKLKCHVGDFEGIKHIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  610  SAVALAVMLVGYRVIAYIALMRI  632



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 148/209 (71%), Gaps = 2/209 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+  +FTFPQER+ML KERSSGMYRLS+YF+++ VGDLP+EL LP  F  I YWM 
Sbjct  430  GFFPLFQQIFTFPQERKMLEKERSSGMYRLSAYFMSRVVGDLPMELILPFLFLAITYWMA  489

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL P+   F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYV+
Sbjct  490  GLNPKFENFLLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLAFLLAGGYYVR  549

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMW  217
             +P FI W++Y+S  +Y +KLL+  QY ++++Y C +     C V DF G+K +GF    
Sbjct  550  HVPVFISWIRYVSIGYYTYKLLILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFGSGL  609

Query  216  VDVSVMAMMLVGYRFIAYLALHRVR*SSS  130
            V    +A MLVGYRF+AYLAL R+  S S
Sbjct  610  VPALALAAMLVGYRFVAYLALMRIGKSKS  638



>ref|XP_002316916.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE97528.1| ABC transporter family protein [Populus trichocarpa]
Length=619

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 141/203 (69%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GFFPLFQAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P  F  +L ++L+SVLVS  LGLA GA++++ K AT + SV  L  L+AGGYYV 
Sbjct  472  GLKGTPGNFLHTLFVLLYSVLVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG Q+   D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCLVGDYPAIKQVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
              +V+ +MLV YR IA+ AL R+
Sbjct  592  GAAVLGIMLVVYRLIAFFALMRI  614



>ref|XP_010448138.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
 ref|XP_010448139.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
Length=638

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I Y+M G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFLIITYFMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L   P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  490  LNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTENEWYPCGENEKLKCHVGDFEGIKHIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  610  SAVALAVMLVGYRVIAYIALMRI  632



>ref|XP_007149612.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
 gb|ESW21606.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
Length=624

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 144/207 (70%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL LPT F FI YWM 
Sbjct  415  GFFPLFQAIFTFPQELTMLQKERSSGMYRLSSYFMSRVVADLPMELVLPTIFLFITYWMA  474

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +LL +L +VL +Q LGLA GA +MD K ATTLASV  L  L+AGG+YVQ
Sbjct  475  GLKANVVNFMYTLLSLLLNVLTAQGLGLALGACVMDQKAATTLASVIMLCFLLAGGFYVQ  534

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S+Y ++L +G QY+  + Y C  G  C + +FP +K +G  H  + 
Sbjct  535  HVPNFIAWIKYISISYYTYQLFIGSQYSYGETYPCLTGQ-CSIVEFPSIKQIGV-HFGLH  592

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              +MA     +ML+ YR IAY+AL R+
Sbjct  593  DQLMAALGLLIMLIVYRLIAYIALMRI  619



>ref|XP_010256405.1| PREDICTED: ABC transporter G family member 25 [Nelumbo nucifera]
Length=663

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 143/208 (69%), Gaps = 5/208 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G  P +NAVFTFPQER + IKER+SGMY LSSYF+A+ VGDLP+EL LPT F+ + YWM 
Sbjct  455  GVMPSFNAVFTFPQERAVFIKERASGMYTLSSYFMARIVGDLPMELILPTVFSTVAYWMT  514

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+P+P  F L++L++L  VLV+Q LGLA GAI+MD KQA+T+ ++T L  ++ GG+YV 
Sbjct  515  GLRPDPGAFLLTILVLLGYVLVAQGLGLALGAIIMDAKQASTVVTITMLAFVLTGGFYVH  574

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYE----CSK-GHYCRVADFPGVKAVGFN  226
            +IP  + W+KYLS++FYC++LL+G+QY D         CS+ G       F      G  
Sbjct  575  KIPHCLAWIKYLSFTFYCYRLLIGIQYGDGKLISSLLGCSRIGSDRTDCGFVEGDVEGQI  634

Query  225  HMWVDVSVMAMMLVGYRFIAYLALHRVR  142
               V + +M +M VGYR IAY AL R++
Sbjct  635  RPVVSIGIMFLMFVGYRLIAYAALRRIK  662



>ref|XP_006451938.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
 gb|ESR65178.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
Length=628

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 139/200 (70%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FTFPQE++ML KE  SGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  424  PMLECIFTFPQEQKMLEKEIPSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  483

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIP  382
            P    F  +L ++LFSVLVSQ LGLA GA++M+ K AT L S+   + ++AGGYYVQ +P
Sbjct  484  PTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  543

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI W++YLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG +  +  V 
Sbjct  544  SFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKYYSVI  603

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  604  ALAIMLVGYRLIAYIALMRI  623



>ref|XP_011029437.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GFFPLFEAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK  P  F  +L ++L+SV+VS  LGLA GA++++ K AT + SV  L  L+AGGYYV 
Sbjct  472  GLKGTPRNFLHTLFVLLYSVVVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG Q+   D Y C   G  C + D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCFIGDYPAIKQVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +MLV YR IA+ AL R+
Sbjct  592  GAVALGIMLVVYRLIAFFALMRI  614



>ref|XP_010438619.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=636

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 4/203 (2%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFLLITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L   P+   L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  490  LNHNPVKNFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG--HYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+ Y  Y +KLL+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVGY--YTYKLLILGQYTENEWYPCGENLKLKCHVGDFEGIKHIGFHSGLV  607

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  608  SAVALAVMLVGYRVIAYIALMRI  630



>ref|XP_008781545.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
25 [Phoenix dactylifera]
Length=650

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 146/205 (71%), Gaps = 3/205 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTFPQER + IKERSSGMY LSSYF+A+  GDLP+EL LPT F  ILYWM 
Sbjct  446  GVFPSFNAVFTFPQERAIFIKERSSGMYTLSSYFMARMAGDLPMELILPTVFALILYWMA  505

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+PEP  F L+L+++L  VLV+Q LGLA GA +MD K+A+T+ +VT L  L+ GG+YVQ
Sbjct  506  GLRPEPEAFMLTLVVLLGYVLVAQGLGLALGAAIMDAKKASTVITVTMLAFLLTGGFYVQ  565

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P  ++W+KY S++FYC++LL+ +QY +++        + R       + +G   +  +
Sbjct  566  HVPSCVIWMKYTSFTFYCYRLLINLQYKESELATFLGLSHHRNGREAVEQELG-GQLSTE  624

Query  210  VSVMAM--MLVGYRFIAYLALHRVR  142
            + ++A+  M VGYRF+AYLAL R++
Sbjct  625  MCIVALVAMFVGYRFLAYLALRRIK  649



>ref|XP_006286036.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
 gb|EOA18934.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
Length=638

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 140/203 (69%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I Y+M G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFVLITYFMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L   P  F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  490  LNHHPANFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDDGKLKCHVGDFEGIKNIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAYLAL R+
Sbjct  610  SALALAVMLVGYRVIAYLALMRI  632



>ref|XP_007133073.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
 gb|ESW05067.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
Length=627

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G  PLY A+FTFPQE  ML KERSSGMY+LSSYF+++ VGDLP+EL LP+ F  I+YWM 
Sbjct  418  GGMPLYQAIFTFPQELIMLEKERSSGMYKLSSYFMSRMVGDLPMELVLPSIFLTIIYWMI  477

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK   + F  +LL +L  VLVSQ LGLA GAI+MD K ATTLASV  L  ++  GYY+Q
Sbjct  478  GLKNNVVNFLCTLLTILLDVLVSQGLGLAIGAIVMDQKSATTLASVIVLTSVLVTGYYIQ  537

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P F+ WLKY S ++Y + LL+G QY  +D Y C +G  C VA++P ++ +G +     
Sbjct  538  HVPKFVAWLKYFSINYYIYHLLIGSQYGSSDTYPCHQGQ-CLVAEYPLIEQMGLHLQGKI  596

Query  210  VSVMAM--MLVGYRFIAYLALHRV  145
            +S +A+  ML+GYR +AYLAL ++
Sbjct  597  MSALALFIMLIGYRLVAYLALMKI  620



>ref|XP_009416919.1| PREDICTED: ABC transporter G family member 25-like [Musa acuminata 
subsp. malaccensis]
Length=642

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 142/208 (68%), Gaps = 16/208 (8%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTF QER + IKERSSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  443  GVFPSFNAVFTFAQERAIFIKERSSGMYSLSSYFMARMAGDLPMELILPTVFTLILYWMA  502

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+ EP  F L++ ++L  VLV+Q LGLAFGA +MD KQA+T+A+VT L  L+ GG+YVQ
Sbjct  503  GLRAEPAAFLLTVAVLLGYVLVAQGLGLAFGAAIMDAKQASTIATVTMLAFLLTGGFYVQ  562

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQY--NDNDYYECSKGHYCRVADFPGVKAVGFNHMW  217
             IP  + W+KY+S++FY ++LL+ +QY  N+ DYY   KG           +  G     
Sbjct  563  NIPGCLAWMKYVSFTFYGYRLLISIQYRGNEMDYYIHRKGR----------EEEGDLVAQ  612

Query  216  VDVSV----MAMMLVGYRFIAYLALHRV  145
            VD SV    +  MLVGYR +AY+AL R 
Sbjct  613  VDASVCIVALIAMLVGYRVLAYIALRRT  640



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 137/203 (67%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YFL++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  490  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GFN   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  610  SALALTAMLVVYRVIAYIALTRI  632



>emb|CAB43874.1| putative protei [Arabidopsis thaliana]
 emb|CAB81392.1| putative protein [Arabidopsis thaliana]
Length=635

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 137/203 (67%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YFL++ VGDLP+EL LPT F  I YWM G
Sbjct  427  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAG  486

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  487  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  546

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GFN   V
Sbjct  547  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLV  606

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  607  SALALTAMLVVYRVIAYIALTRI  629



>ref|XP_009406087.1| PREDICTED: ABC transporter G family member 25-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 141/206 (68%), Gaps = 6/206 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +  +NAVFTFPQER + IKERSSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  442  GVFASFNAVFTFPQERAIFIKERSSGMYNLSSYFMARMAGDLPMELILPTVFTLILYWMA  501

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+ EP  F L+L ++L  VLV+Q LGL  GA +MD KQA+T+A+VT L  L+ GG+YVQ
Sbjct  502  GLRTEPGAFLLTLAVLLGYVLVAQGLGLVLGAAIMDAKQASTIATVTMLAFLLTGGFYVQ  561

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDN--DYYECSKGHYC-RVADFPGVKAVGFNHM  220
             IP  + WLKY+S++FYC++LL+ +QY     DY   S  H   R AD   V  V  +  
Sbjct  562  NIPSCLAWLKYISFTFYCYRLLIIIQYGGGQMDYLLASSHHRNKRDADGELVAQVSTS--  619

Query  219  WVDVSVMAMMLVGYRFIAYLALHRVR  142
             V ++ +  M VGYR +AY+AL R +
Sbjct  620  -VCIAALLAMFVGYRVLAYMALRRTK  644



>gb|KHN08925.1| ABC transporter G family member 9, partial [Glycine soja]
Length=592

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 137/200 (69%), Gaps = 3/200 (2%)
 Frame = -3

Query  738  LYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKP  559
            L+ A+FTFPQE  +L KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I+YWM GLKP
Sbjct  388  LFQAIFTFPQELTILKKERSSGMYRLSSYFMSRMVGDLPMELGLPTIFLAIVYWMAGLKP  447

Query  558  EPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIPP  379
                F  ++L V  +VLVSQ LGLA  AI+M+ K A+TLASV     ++ GGYY Q +P 
Sbjct  448  NVANFIYTMLSVFLNVLVSQGLGLAISAIVMEQKSASTLASVIMPTSILLGGYYNQHVPK  507

Query  378  FILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSVM  199
            FI WLKY S  +Y + L++G QY  +D Y CS G  C VA+ P +K VG +      + +
Sbjct  508  FIAWLKYFSTHYYVYHLVIGSQYGTSDTYPCSNGQ-CLVAEHPVIKQVGLHLQGKITAAL  566

Query  198  AM--MLVGYRFIAYLALHRV  145
            A+  ML+G+R +AYLAL R+
Sbjct  567  ALFIMLIGFRLVAYLALMRI  586



>ref|XP_003526081.1| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=624

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 137/200 (69%), Gaps = 3/200 (2%)
 Frame = -3

Query  738  LYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKP  559
            L+ A+FTFPQE  +L KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I+YWM GLKP
Sbjct  420  LFQAIFTFPQELTILKKERSSGMYRLSSYFMSRMVGDLPMELGLPTIFLAIVYWMAGLKP  479

Query  558  EPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQIPP  379
                F  ++L V  +VLVSQ LGLA  AI+M+ K A+TLASV     ++ GGYY Q +P 
Sbjct  480  NVANFIYTMLSVFLNVLVSQGLGLAISAIVMEQKSASTLASVIMPTSILLGGYYNQHVPK  539

Query  378  FILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSVM  199
            FI WLKY S  +Y + L++G QY  +D Y CS G  C VA+ P +K VG +      + +
Sbjct  540  FIAWLKYFSTHYYVYHLVIGSQYGTSDTYPCSNGQ-CLVAEHPVIKQVGLHLQGKITAAL  598

Query  198  AM--MLVGYRFIAYLALHRV  145
            A+  ML+G+R +AYLAL R+
Sbjct  599  ALFIMLIGFRLVAYLALMRI  618



>ref|XP_011096967.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
25 [Sesamum indicum]
Length=653

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 141/208 (68%), Gaps = 5/208 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTFPQER + +KER+SGMY LSSYF+A+  GDLP+EL LPT F  I YWM 
Sbjct  445  GVFPSFNAVFTFPQERAIFMKERASGMYTLSSYFMARITGDLPMELVLPTLFLSITYWMT  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKPE   F L+L++VL  VLVSQ LGLA GA++MD KQA+T+ +VT L  ++ GGYYV 
Sbjct  505  GLKPELSAFVLTLIVVLGYVLVSQGLGLALGALIMDAKQASTVVTVTMLAFVLTGGYYVH  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYE----CSKGHYCRVA-DFPGVKAVGFN  226
            ++P F+ W+KY+S +FY ++LL+ VQY + +       CS G   R    F      G  
Sbjct  565  KVPSFMSWIKYVSTTFYSYRLLIDVQYGEGEGISSLLGCSGGGRDRATCKFIDEDIRGQI  624

Query  225  HMWVDVSVMAMMLVGYRFIAYLALHRVR  142
            H  + V +M +M  GYR +AY+AL R+R
Sbjct  625  HPAMSVGIMLIMFAGYRLLAYIALRRIR  652



>ref|XP_009383524.1| PREDICTED: ABC transporter G family member 25-like [Musa acuminata 
subsp. malaccensis]
Length=639

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 137/204 (67%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +  +NAVFTFPQER + +KE+SSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  436  GVFASFNAVFTFPQERAIFVKEKSSGMYSLSSYFMARMAGDLPMELILPTVFTLILYWMA  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+ EP  F ++L ++L  VLV+Q LGL  GA +MD KQA+T+ ++T L  L+ GG+YVQ
Sbjct  496  GLRAEPAAFLITLAVLLGYVLVAQGLGLVVGAAIMDAKQASTVVTITMLAFLLTGGFYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDY-YECSKGHYCRVADFPGVKAVGFNHMWV  214
             IP F+ WLKY+S +FYC++LL+ +QY   +  Y     H     +  G  A G     V
Sbjct  556  NIPSFLAWLKYVSCTFYCYRLLVRIQYRGEEMEYFLGSSHQRSRREAEGEMA-GEVSTLV  614

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
             V  +  M VGYR +AY+AL R++
Sbjct  615  SVGALIAMFVGYRILAYVALRRIK  638



>ref|XP_002867504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 139/203 (68%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSG+YRLS YF+++ VGDLP+EL LPT F  I YWM G
Sbjct  431  FFPLFQQIFTFPQERAMLQKERSSGVYRLSPYFMSRLVGDLPMELILPTCFLVITYWMAG  490

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L  L+AGGYYVQ 
Sbjct  491  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGYYVQH  550

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N++Y C +     C V DF G+K +GFN   V
Sbjct  551  VPVFISWIKYVSIGYYTYKLLILGQYTANEWYPCGENGILRCHVGDFEGIKHIGFNSGLV  610

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  611  SALALTAMLVVYRVIAYIALTRI  633



>ref|XP_009604112.1| PREDICTED: ABC transporter G family member 25 [Nicotiana tomentosiformis]
Length=669

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 143/208 (69%), Gaps = 5/208 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVF FPQER + +KER+SGMY LSSYF+A+ VGDLP++L LPT F  I YWM 
Sbjct  461  GVFPSFNAVFAFPQERAIFVKERASGMYTLSSYFMARIVGDLPMDLILPTLFLAITYWMT  520

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLKP+ L F L+LL++L  V+VSQ LGLA GA++MD KQA+T+ +VT L  ++ GG+YV 
Sbjct  521  GLKPQLLAFLLTLLVLLSYVIVSQGLGLALGALIMDAKQASTVVTVTMLAFVLTGGFYVH  580

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYND----NDYYECSKGHYCRVA-DFPGVKAVGFN  226
            ++P  + W+KY+S +FYC+++L+ VQY +    +D   CS     R +  F      G  
Sbjct  581  KVPACLAWIKYISTTFYCYRVLINVQYGEGKEISDMLGCSNQRIDRASCKFIEQDINGHI  640

Query  225  HMWVDVSVMAMMLVGYRFIAYLALHRVR  142
            H    + ++ +M VGYR IAYLAL R+R
Sbjct  641  HPSASLGILLIMFVGYRLIAYLALRRIR  668



>ref|XP_004134251.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
 ref|XP_004172271.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
 gb|KGN56223.1| hypothetical protein Csa_3G101820 [Cucumis sativus]
Length=617

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 135/206 (66%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+ TFP+ER +L KERSSGMYRLSSYF+++T  DLP+EL LPT F  I+Y M 
Sbjct  406  GFFPLLQAIGTFPKERMILEKERSSGMYRLSSYFVSRTTTDLPMELVLPTVFVVIIYVMA  465

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GLK    +F  +L  +L SVLV+Q  GLA GA+++D   ATT ASV  L  L+  GY+VQ
Sbjct  466  GLKRTVASFFATLFSLLLSVLVAQGFGLAMGALVLDQTSATTFASVIMLCFLLTSGYFVQ  525

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
             +P FI W KY+S   Y +KLLL  QY  +D Y C    + G  C V +FP +K VG + 
Sbjct  526  HVPKFIAWTKYISIGTYSYKLLLISQYKASDTYPCPSNDNGGRACEVGEFPPIKQVGLDG  585

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
                VS M  MLVGYR +AY+AL R+
Sbjct  586  KLFAVSAMVAMLVGYRLVAYIALMRI  611



>ref|XP_010912511.1| PREDICTED: ABC transporter G family member 25-like [Elaeis guineensis]
Length=642

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 139/215 (65%), Gaps = 23/215 (11%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTFPQER + IKERSSGMY LSSYF+A+  GDLP+EL LPT F  ILYWM 
Sbjct  438  GVFPSFNAVFTFPQERAIFIKERSSGMYTLSSYFMARMAGDLPMELILPTVFALILYWMA  497

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQattlasvttlvxLIAGGYYVQ  391
            GL+PEP  F L+L ++L  VLV+Q LGLA GA ++D KQA+T+ +V  L  L+ GG+YVQ
Sbjct  498  GLRPEPGAFMLTLGVLLGYVLVAQGLGLALGAAMVDAKQASTVVTVVMLAFLLTGGFYVQ  557

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P  + W+KY S++FYC++LL+ VQY  ++           +A F G+   G     V+
Sbjct  558  NVPSCMTWMKYTSFTFYCYRLLIHVQYRGSE-----------LATFLGLSHHGKRRETVE  606

Query  210  ------------VSVMAMMLVGYRFIAYLALHRVR  142
                        +  +  M VGYR +AYLAL R+R
Sbjct  607  EELGGQLGSVACIVALVAMFVGYRLLAYLALRRIR  641



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050