BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013L20

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239742.1|  PREDICTED: inositol phosphorylceramide glucu...    237   6e-71   Solanum lycopersicum
ref|XP_010319283.1|  PREDICTED: inositol phosphorylceramide glucu...    233   2e-69   Solanum lycopersicum
ref|XP_004236792.1|  PREDICTED: inositol phosphorylceramide glucu...    233   3e-69   Solanum lycopersicum
ref|XP_009771065.1|  PREDICTED: putative glucuronosyltransferase ...    229   5e-69   Nicotiana sylvestris
ref|XP_006361430.1|  PREDICTED: putative glucuronosyltransferase ...    230   3e-68   Solanum tuberosum [potatoes]
ref|XP_006361429.1|  PREDICTED: putative glucuronosyltransferase ...    230   4e-68   Solanum tuberosum [potatoes]
ref|XP_009599298.1|  PREDICTED: putative glucuronosyltransferase ...    228   2e-67   Nicotiana tomentosiformis
ref|XP_006346008.1|  PREDICTED: putative glucuronosyltransferase ...    226   6e-67   Solanum tuberosum [potatoes]
gb|KDP23737.1|  hypothetical protein JCGZ_23570                         226   2e-66   Jatropha curcas
ref|XP_011038459.1|  PREDICTED: inositol phosphorylceramide glucu...    224   5e-66   Populus euphratica
ref|XP_011038458.1|  PREDICTED: inositol phosphorylceramide glucu...    224   7e-66   Populus euphratica
ref|XP_002319122.1|  hypothetical protein POPTR_0013s04660g             223   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010247242.1|  PREDICTED: inositol phosphorylceramide glucu...    221   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002266145.1|  PREDICTED: inositol phosphorylceramide glucu...    219   8e-64   Vitis vinifera
ref|XP_002522004.1|  glycogenin, putative                               221   3e-63   
gb|KHG12487.1|  Glycogenin-1                                            217   4e-63   Gossypium arboreum [tree cotton]
gb|KJB82306.1|  hypothetical protein B456_013G188300                    216   6e-63   Gossypium raimondii
ref|XP_009779488.1|  PREDICTED: putative glucuronosyltransferase ...    216   7e-63   Nicotiana sylvestris
ref|XP_009343790.1|  PREDICTED: putative glucuronosyltransferase ...    216   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_008370762.1|  PREDICTED: putative glucuronosyltransferase ...    213   1e-61   
ref|XP_007147201.1|  hypothetical protein PHAVU_006G104100g             211   4e-61   Phaseolus vulgaris [French bean]
ref|XP_010922963.1|  PREDICTED: inositol phosphorylceramide glucu...    210   2e-60   Elaeis guineensis
ref|XP_007030330.1|  Plant glycogenin-like starch initiation prot...    209   2e-60   
gb|KEH24575.1|  glucuronosyltransferase PGSIP8                          210   2e-60   Medicago truncatula
gb|ADY38797.1|  plant glycogenin-like starch initiation protein         207   2e-60   Coffea arabica [arabica coffee]
gb|KHN31485.1|  Glycogenin-1                                            209   3e-60   Glycine soja [wild soybean]
ref|XP_010102196.1|  hypothetical protein L484_024477                   210   3e-60   
ref|XP_006437457.1|  hypothetical protein CICLE_v10031149mg             204   3e-60   
ref|XP_009401946.1|  PREDICTED: putative glucuronosyltransferase ...    208   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO49228.1|  hypothetical protein CISIN_1g008931mg                   208   1e-59   Citrus sinensis [apfelsine]
ref|XP_006484615.1|  PREDICTED: putative glucuronosyltransferase ...    208   1e-59   Citrus sinensis [apfelsine]
emb|CAN77613.1|  hypothetical protein VITISV_036932                     209   1e-59   Vitis vinifera
ref|XP_006437458.1|  hypothetical protein CICLE_v10031149mg             204   1e-59   
ref|XP_011101631.1|  PREDICTED: inositol phosphorylceramide glucu...    211   1e-59   
ref|XP_009379742.1|  PREDICTED: putative glucuronosyltransferase ...    207   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_004494729.1|  PREDICTED: putative glucuronosyltransferase ...    207   2e-59   Cicer arietinum [garbanzo]
ref|XP_008366883.1|  PREDICTED: putative glucuronosyltransferase ...    207   3e-59   Malus domestica [apple tree]
ref|XP_008807617.1|  PREDICTED: putative glucuronosyltransferase ...    206   4e-59   Phoenix dactylifera
ref|XP_007205021.1|  hypothetical protein PRUPE_ppa003817mg             206   5e-59   
gb|KGN61301.1|  hypothetical protein Csa_2G078050                       204   5e-59   
ref|XP_009606765.1|  PREDICTED: putative glucuronosyltransferase ...    206   7e-59   Nicotiana tomentosiformis
emb|CDO99980.1|  unnamed protein product                                206   7e-59   Coffea canephora [robusta coffee]
gb|KHG20951.1|  Glycogenin-1                                            202   7e-59   Gossypium arboreum [tree cotton]
ref|XP_003590989.1|  Glycogenin-1                                       205   1e-58   Medicago truncatula
gb|ABZ89190.1|  hypothetical protein 46C02.16                           205   1e-58   Coffea canephora [robusta coffee]
ref|XP_006437460.1|  hypothetical protein CICLE_v10031149mg             205   1e-58   Citrus clementina [clementine]
ref|XP_008218517.1|  PREDICTED: putative glucuronosyltransferase ...    204   2e-58   
ref|XP_004152810.1|  PREDICTED: putative glucuronosyltransferase ...    205   2e-58   Cucumis sativus [cucumbers]
ref|XP_010675056.1|  PREDICTED: inositol phosphorylceramide glucu...    202   2e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006604859.1|  PREDICTED: putative glucuronosyltransferase ...    200   1e-56   Glycine max [soybeans]
gb|EYU19884.1|  hypothetical protein MIMGU_mgv1a004141mg                199   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_004302108.1|  PREDICTED: inositol phosphorylceramide glucu...    199   1e-56   Fragaria vesca subsp. vesca
ref|XP_008441775.1|  PREDICTED: putative glucuronosyltransferase ...    199   2e-56   Cucumis melo [Oriental melon]
ref|XP_006604858.1|  PREDICTED: putative glucuronosyltransferase ...    199   2e-56   Glycine max [soybeans]
ref|XP_007030331.1|  Plant glycogenin-like starch initiation prot...    196   1e-55   
ref|XP_009384656.1|  PREDICTED: LOW QUALITY PROTEIN: putative glu...    193   4e-54   
ref|XP_004495592.1|  PREDICTED: putative glucuronosyltransferase ...    192   7e-54   Cicer arietinum [garbanzo]
gb|AIL52751.1|  putative glucuronosyltransferase PGSIP6-like protein    189   1e-52   Dendrobium officinale
ref|XP_006833264.1|  hypothetical protein AMTR_s01134p00004530          186   6e-52   
ref|XP_007143949.1|  hypothetical protein PHAVU_007G116100g             186   1e-51   Phaseolus vulgaris [French bean]
ref|XP_003556480.1|  PREDICTED: putative glucuronosyltransferase ...    186   2e-51   Glycine max [soybeans]
gb|KHN14829.1|  Glycogenin-1                                            185   3e-51   Glycine soja [wild soybean]
ref|XP_006297372.1|  hypothetical protein CARUB_v10013391mg             182   5e-50   Capsella rubella
gb|EEC77645.1|  hypothetical protein OsI_16652                          181   2e-49   Oryza sativa Indica Group [Indian rice]
gb|ABR16625.1|  unknown                                                 179   1e-48   Picea sitchensis
ref|XP_010485804.1|  PREDICTED: inositol phosphorylceramide glucu...    178   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010463911.1|  PREDICTED: inositol phosphorylceramide glucu...    177   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010104622.1|  hypothetical protein L484_021999                   178   5e-48   
ref|XP_010104620.1|  hypothetical protein L484_021997                   176   5e-48   Morus notabilis
ref|XP_010413938.1|  PREDICTED: inositol phosphorylceramide glucu...    174   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006408197.1|  hypothetical protein EUTSA_v10020458mg             174   3e-47   Eutrema salsugineum [saltwater cress]
ref|XP_002446789.1|  hypothetical protein SORBIDRAFT_06g022680          173   9e-47   Sorghum bicolor [broomcorn]
emb|CDY21129.1|  BnaA01g33600D                                          172   3e-46   Brassica napus [oilseed rape]
ref|XP_006400396.1|  hypothetical protein EUTSA_v10013196mg             171   7e-46   Eutrema salsugineum [saltwater cress]
gb|EEC73629.1|  hypothetical protein OsI_08135                          171   7e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_009125000.1|  PREDICTED: putative glucuronosyltransferase ...    171   8e-46   Brassica rapa
ref|XP_004976232.1|  PREDICTED: putative glucuronosyltransferase ...    171   8e-46   Setaria italica
ref|XP_002873897.1|  hypothetical protein ARALYDRAFT_488728             170   9e-46   
ref|XP_010454088.1|  PREDICTED: inositol phosphorylceramide glucu...    170   9e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006648850.1|  PREDICTED: putative glucuronosyltransferase ...    170   1e-45   Oryza brachyantha
ref|XP_010420611.1|  PREDICTED: inositol phosphorylceramide glucu...    169   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008661816.1|  PREDICTED: uncharacterized protein LOC100279...    169   2e-45   Zea mays [maize]
ref|NP_001146086.1|  uncharacterized protein LOC100279618 precursor     169   2e-45   Zea mays [maize]
ref|XP_010492852.1|  PREDICTED: inositol phosphorylceramide glucu...    168   8e-45   Camelina sativa [gold-of-pleasure]
gb|KFK26089.1|  hypothetical protein AALP_AA8G201300                    167   1e-44   Arabis alpina [alpine rockcress]
ref|XP_010024933.1|  PREDICTED: putative glucuronosyltransferase ...    167   2e-44   Eucalyptus grandis [rose gum]
ref|NP_001047475.1|  Os02g0624400                                       167   2e-44   
ref|XP_006287478.1|  hypothetical protein CARUB_v10000689mg             166   3e-44   Capsella rubella
ref|XP_006653601.1|  PREDICTED: putative glucuronosyltransferase ...    166   3e-44   Oryza brachyantha
ref|XP_009126256.1|  PREDICTED: putative glucuronosyltransferase ...    166   5e-44   Brassica rapa
emb|CDY29996.1|  BnaC01g40120D                                          165   7e-44   Brassica napus [oilseed rape]
ref|XP_009131669.1|  PREDICTED: putative glucuronosyltransferase ...    165   8e-44   Brassica rapa
ref|XP_003580141.1|  PREDICTED: inositol phosphorylceramide glucu...    163   3e-43   Brachypodium distachyon [annual false brome]
emb|CDX88935.1|  BnaA03g07140D                                          162   6e-43   
gb|EMS55946.1|  Glycogenin-1                                            160   2e-42   Triticum urartu
ref|XP_010235727.1|  PREDICTED: LOW QUALITY PROTEIN: inositol pho...    161   2e-42   
dbj|BAJ88570.1|  predicted protein                                      160   4e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK37856.1|  hypothetical protein AALP_AA3G038100                    159   2e-41   Arabis alpina [alpine rockcress]
ref|NP_197349.2|  plant glycogenin-like starch initiation protein 6     158   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EMT33175.1|  hypothetical protein F775_16539                         159   2e-41   
gb|AAL58891.1|AF462795_1  AT5g18480/F20L16_200                          156   2e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02625.1|  BnaC02g08100D                                          154   6e-40   
emb|CDX70822.1|  BnaC03g09060D                                          153   2e-39   
dbj|BAK04525.1|  predicted protein                                      152   2e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010558734.1|  PREDICTED: inositol phosphorylceramide glucu...    150   3e-38   Tarenaya hassleriana [spider flower]
emb|CDY58112.1|  BnaA02g35140D                                          148   8e-38   Brassica napus [oilseed rape]
gb|EPS68223.1|  hypothetical protein M569_06549                         147   3e-37   Genlisea aurea
gb|KJB44790.1|  hypothetical protein B456_007G273500                    142   3e-36   Gossypium raimondii
ref|XP_006606473.1|  PREDICTED: putative glucuronosyltransferase ...    141   2e-35   Glycine max [soybeans]
ref|XP_002971046.1|  hypothetical protein SELMODRAFT_62885              137   5e-34   
ref|XP_002962043.1|  hypothetical protein SELMODRAFT_62883              137   5e-34   
ref|XP_001759731.1|  predicted protein                                  129   5e-31   
ref|XP_001784830.1|  predicted protein                                  125   1e-29   
gb|KHN43170.1|  Glycogenin-1                                            126   6e-29   Glycine soja [wild soybean]
ref|NP_001053320.2|  Os04g0517400                                       119   1e-28   
emb|CAE05448.4|  OSJNBa0073E02.8                                        119   1e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AFK39755.1|  unknown                                                 114   5e-27   Lotus japonicus
gb|AAZ31066.1|  putative glycogenin glucosyltransferase                 110   2e-26   Medicago sativa [alfalfa]
ref|XP_002954821.1|  hypothetical protein VOLCADRAFT_106550           54.7    2e-05   Volvox carteri f. nagariensis



>ref|XP_004239742.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Solanum lycopersicum]
Length=533

 Score =   237 bits (605),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GG+S+ VCFAA  +S+GLS++IIPRQ+MPWTGL LMYEWTFTLF L FGSYL+LV 
Sbjct  361  AFL-GGISVCVCFAAVLVSLGLSLVIIPRQVMPWTGLFLMYEWTFTLFFLQFGSYLYLVY  419

Query  460  HWGKMAGNQAGHSRPKS--LAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLF  293
             WGK   N+AG SR  S  L ++S KGH+  QSCCD+ A  YGLGMAFLAIL P+LP +F
Sbjct  420  QWGKAVANRAGQSRANSTSLDHESGKGHQRQQSCCDIAACYYGLGMAFLAILAPALPSIF  479

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            GIT+LF RLGLMV GG+VLASFMTYA+EHL+IRSFTRG E+KD+ RS S+ FF
Sbjct  480  GITALFLRLGLMVVGGLVLASFMTYAAEHLSIRSFTRGFEEKDMHRSRSICFF  532



>ref|XP_010319283.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X2 [Solanum lycopersicum]
Length=527

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            A++    +K     G +S+ VCFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L
Sbjct  344  AISSNQQLKMPTYLGAVSVCVCFAAALVSLGLPLLIIPRQVMPWTGLLLMYEWTFTLFFL  403

Query  490  SFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLA  323
             FGSYLHLV  WG++A NQ G   + P SL Y+  KGH+  QSCCD +AW YGLGMAFLA
Sbjct  404  LFGSYLHLVYQWGRVAANQPGQFPAHPVSLDYEPGKGHQRQQSCCDNEAWYYGLGMAFLA  463

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            I  P+LP +FG+TSLF RLGLMV GG++L SFMTYASEHL+IRSF RG E+++  RS SV
Sbjct  464  IAAPALPGVFGVTSLFLRLGLMVVGGLILTSFMTYASEHLSIRSFARGFEERNTPRSRSV  523

Query  142  *FF  134
             F 
Sbjct  524  CFL  526



>ref|XP_004236792.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like isoform X1 [Solanum lycopersicum]
Length=533

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 134/169 (79%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L FGSYLHLV  WG+
Sbjct  364  GAVSVCVCFAAALVSLGLPLLIIPRQVMPWTGLLLMYEWTFTLFFLLFGSYLHLVYQWGR  423

Query  448  MAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +A NQ G   + P SL Y+  KGH+  QSCCD +AW YGLGMAFLAI  P+LP +FG+TS
Sbjct  424  VAANQPGQFPAHPVSLDYEPGKGHQRQQSCCDNEAWYYGLGMAFLAIAAPALPGVFGVTS  483

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLMV GG++L SFMTYASEHL+IRSF RG E+++  RS SV F 
Sbjct  484  LFLRLGLMVVGGLILTSFMTYASEHLSIRSFARGFEERNTPRSRSVCFL  532



>ref|XP_009771065.1| PREDICTED: putative glucuronosyltransferase PGSIP6, partial [Nicotiana 
sylvestris]
Length=417

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 139/183 (76%), Gaps = 4/183 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            A++    +K     G +S+  CFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L
Sbjct  234  AISSNQPVKVPAFLGAISVCCCFAAALVSLGLPLLIIPRQLMPWTGLLLMYEWTFTLFFL  293

Query  490  SFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLA  323
             FGSYLHLV  WG++A NQ+G   + P SL Y+  KGH+  QSCCD+ AW YGLGMAFLA
Sbjct  294  LFGSYLHLVYQWGRVAANQSGQFLAHPVSLDYEPGKGHQRQQSCCDIAAWYYGLGMAFLA  353

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            I  P+LP +FG+TSLF RLGLMV GG++LASFMTYASEHL+IRSF RG E+++  ++ S 
Sbjct  354  IAAPALPGIFGVTSLFLRLGLMVVGGLILASFMTYASEHLSIRSFVRGYEERNTPKNRSA  413

Query  142  *FF  134
             F 
Sbjct  414  CFL  416



>ref|XP_006361430.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Solanum tuberosum]
Length=527

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L FGSYLH+V  WG+
Sbjct  358  GAISVCVCFAAALVSLGLPLLIIPRQVMPWTGLLLMYEWTFTLFFLLFGSYLHIVYQWGR  417

Query  448  MAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +A NQ G   + P SL Y+  KGH+  QSCCD  AW YGLGMAFLAI  P+LP +FG+TS
Sbjct  418  VAANQPGQFPAHPVSLDYEPGKGHQRQQSCCDNSAWYYGLGMAFLAIAAPALPGVFGVTS  477

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLMV GG++L SFMTYASEHL+IRSF RG E+++  +S SV F 
Sbjct  478  LFLRLGLMVVGGLILTSFMTYASEHLSIRSFARGYEERNTPKSRSVCFL  526



>ref|XP_006361429.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Solanum tuberosum]
Length=533

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L FGSYLH+V  WG+
Sbjct  364  GAISVCVCFAAALVSLGLPLLIIPRQVMPWTGLLLMYEWTFTLFFLLFGSYLHIVYQWGR  423

Query  448  MAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +A NQ G   + P SL Y+  KGH+  QSCCD  AW YGLGMAFLAI  P+LP +FG+TS
Sbjct  424  VAANQPGQFPAHPVSLDYEPGKGHQRQQSCCDNSAWYYGLGMAFLAIAAPALPGVFGVTS  483

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLMV GG++L SFMTYASEHL+IRSF RG E+++  +S SV F 
Sbjct  484  LFLRLGLMVVGGLILTSFMTYASEHLSIRSFARGYEERNTPKSRSVCFL  532



>ref|XP_009599298.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=530

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL G +S+  CFAAA +S+GL +LIIPRQ+MPWTGL+LMYEWTFTLF L FGSYLHLV 
Sbjct  358  AFL-GAISVCCCFAAALVSLGLPLLIIPRQVMPWTGLLLMYEWTFTLFFLLFGSYLHLVY  416

Query  460  HWGKMAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLF  293
             WG++A NQ+G   + P SL Y+  KGH+  QSCCD+ AW YGLGMAFLAI  P+LP +F
Sbjct  417  QWGRVAVNQSGQFLAHPVSLDYEPGKGHQRQQSCCDIAAWYYGLGMAFLAIAAPALPGIF  476

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            G+TSLF RLGLMV GG++LASF TYASEHL+IRSF RG E+++  ++ SV F 
Sbjct  477  GVTSLFLRLGLMVVGGLILASFTTYASEHLSIRSFVRGYEERNTPKNRSVCFL  529



>ref|XP_006346008.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Solanum 
tuberosum]
Length=533

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 5/173 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GG+S+ VCFAA  +S+GLS++IIPRQ+MPWTGL+LMYEWTFTL  L FGSYL+LV 
Sbjct  361  AFL-GGISVCVCFAAVLVSLGLSLVIIPRQVMPWTGLLLMYEWTFTLLFLQFGSYLYLVY  419

Query  460  HWGKMAGNQAGHSRPKS--LAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLF  293
             WGK   NQAG  R  S  L ++S KGH+  QS CD+ A  YGLGMAFLAIL P+LP +F
Sbjct  420  QWGKAVANQAGQFRADSTSLDHESGKGHQRQQSYCDIAACYYGLGMAFLAILAPALPSIF  479

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            GIT+LF RLGLMV GG+VL SFMTYA+EHL+IRSFTRG E+KD+ RS S+ F 
Sbjct  480  GITALFLRLGLMVVGGLVLLSFMTYAAEHLSIRSFTRGFEEKDMHRSRSICFL  532



>gb|KDP23737.1| hypothetical protein JCGZ_23570 [Jatropha curcas]
Length=539

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 131/167 (78%), Gaps = 3/167 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIF CF AA +S+  S+ I+PRQ+MPWTGL+LMYEWTFT F L FG +LHL   WGK
Sbjct  371  GGLSIFACFMAALVSLAFSLAIVPRQVMPWTGLLLMYEWTFTTFFLLFGGFLHLTYIWGK  430

Query  448  MAGNQAG-HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
            M  NQA   S P+S  Y++ KGH+   S CD+  W YGLGMAFLAI  P+LPC+FGIT+L
Sbjct  431  MTANQAYLSSHPESFDYETGKGHQWQGSSCDVATWYYGLGMAFLAIAVPALPCIFGITAL  490

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
            FARLGL+VAGGIVLASFMTYASEHLAI+SF RG+ED++  RS S+ F
Sbjct  491  FARLGLVVAGGIVLASFMTYASEHLAIKSFLRGIEDREATRSRSLCF  537



>ref|XP_011038459.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X2 [Populus euphratica]
Length=543

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIF+CF A  +++G  + I+PRQ+MPWTGL+LMYEWTFT+F L FG +LHL+  WGK
Sbjct  372  GGVSIFMCFMAVLIALGFGLSIVPRQVMPWTGLLLMYEWTFTIFFLLFGGFLHLIYLWGK  431

Query  448  MAGNQAGHSRP--KSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                QA    P  +SLAYDS KGHRQ S CD+ AW YGLGMA LA+  PSLPC+FG+T+L
Sbjct  432  RMSTQAASLSPHSESLAYDSRKGHRQGSACDVAAWYYGLGMALLAVGAPSLPCIFGVTAL  491

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            F RLGLMVAGG+VLASFMTYASEHLAIRSF +G ED+D  R+ S
Sbjct  492  FLRLGLMVAGGLVLASFMTYASEHLAIRSFLKGFEDRDTARARS  535



>ref|XP_011038458.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 isoform X1 [Populus euphratica]
Length=549

 Score =   224 bits (571),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIF+CF A  +++G  + I+PRQ+MPWTGL+LMYEWTFT+F L FG +LHL+  WGK
Sbjct  378  GGVSIFMCFMAVLIALGFGLSIVPRQVMPWTGLLLMYEWTFTIFFLLFGGFLHLIYLWGK  437

Query  448  MAGNQAGHSRP--KSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                QA    P  +SLAYDS KGHRQ S CD+ AW YGLGMA LA+  PSLPC+FG+T+L
Sbjct  438  RMSTQAASLSPHSESLAYDSRKGHRQGSACDVAAWYYGLGMALLAVGAPSLPCIFGVTAL  497

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            F RLGLMVAGG+VLASFMTYASEHLAIRSF +G ED+D  R+ S
Sbjct  498  FLRLGLMVAGGLVLASFMTYASEHLAIRSFLKGFEDRDTARARS  541



>ref|XP_002319122.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 ref|XP_006375861.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|EEE95045.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
 gb|ERP53658.1| hypothetical protein POPTR_0013s04660g [Populus trichocarpa]
Length=546

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIF+CF A  +++G  + I+PRQ+MPWTGL+LMYEWTFT+F L FG +LHL+  WGK
Sbjct  378  GGVSIFMCFMALLIALGFGLSIVPRQVMPWTGLLLMYEWTFTIFFLLFGGFLHLIYIWGK  437

Query  448  MAGNQAGHSRP--KSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                QA    P  +SLAYDS KGHRQ S CD+ AW YGLGMA LA+  PSLPC+FG+T+L
Sbjct  438  RMATQAASLSPHSESLAYDSRKGHRQGSTCDVAAWYYGLGMALLAVGAPSLPCIFGVTAL  497

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FFY  131
            F RLGLMVAGG+VLASFMTYASEHLAIRSF +G ED+D  R+ +  F +
Sbjct  498  FLRLGLMVAGGLVLASFMTYASEHLAIRSFLKGFEDRDTARARNECFLF  546



>ref|XP_010247242.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Nelumbo nucifera]
Length=546

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+FVCF AA +S+ L+++I+PRQ+MPWTGL+LMYEW FT+F + FG Y+HL+  WG+
Sbjct  378  GGISVFVCFLAAVVSIALALVIVPRQVMPWTGLLLMYEWIFTIFFILFGGYIHLIYQWGR  437

Query  448  MAGNQAGH--SRPKSLAYDSAKGHR-QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
            M   QAG   + P+S  YDS KGHR  S CD   W YGLGMAFLA+  PSLPCL GIT++
Sbjct  438  MTATQAGSVSNHPESSDYDSRKGHRLVSNCDFATWYYGLGMAFLAVAAPSLPCLLGITAM  497

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            F RLGLMV GG+VLASFMTYASEHLAIR+F +G+ED+D  +  S+
Sbjct  498  FTRLGLMVVGGLVLASFMTYASEHLAIRAFLKGLEDRDAPQIRSL  542



>ref|XP_002266145.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Vitis vinifera]
 emb|CBI22393.3| unnamed protein product [Vitis vinifera]
Length=546

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 128/169 (76%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ +CF  A +S+ L++ ++PRQ+MPWTGL+LMYEW FT F L FG YLHL+  WGK
Sbjct  377  GGISVVICFMVAVVSLALALSVVPRQVMPWTGLLLMYEWAFTSFFLLFGGYLHLIYQWGK  436

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            M  +QAG   SRP S  YDS KGH++  S CD   W YGLGMAFLA+  PSLPC+FG+T+
Sbjct  437  MTASQAGSFASRPVSADYDSGKGHQRQVSSCDAATWYYGLGMAFLAVAAPSLPCVFGVTA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGL+  G ++LASFMTYA+EHLAIRSF +G+ED+D  RS SV F 
Sbjct  497  LFLRLGLIAVGALILASFMTYAAEHLAIRSFVKGLEDRDTPRSRSVCFL  545



>ref|XP_002522004.1| glycogenin, putative [Ricinus communis]
 gb|EEF40408.1| glycogenin, putative [Ricinus communis]
Length=776

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIFVCF AA +S+  S+ I+PRQ+MPWTG++LMYEWTFT+F + FG YLHL   WGK
Sbjct  610  GGLSIFVCFMAALMSIAFSLAIVPRQVMPWTGMLLMYEWTFTIFFVLFGGYLHLAHLWGK  669

Query  448  MAGNQAG-HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
            M   Q    S P+S  ++S KGH++  S CD+  W YGLGMAFLAI TPSLPC+FGIT+L
Sbjct  670  MTATQVFISSNPESSDHESGKGHQRQGSLCDVGTWYYGLGMAFLAIATPSLPCIFGITAL  729

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            F RLGL+VAGGIVLASFMTYASEHLAIR+F +G +D D  R+ S+
Sbjct  730  FMRLGLVVAGGIVLASFMTYASEHLAIRAFLKGFDDWDTTRARSI  774



>gb|KHG12487.1| Glycogenin-1 [Gossypium arboreum]
Length=542

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+FVCF AA +S+G+SI I+PRQ+MPWTGL+LMYEWTF++F LSFG++LHL+  WGK
Sbjct  377  GAISVFVCFMAALVSLGISISIVPRQVMPWTGLLLMYEWTFSIFFLSFGAFLHLIYLWGK  436

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFA  272
                    SR   +  DS KG+RQ S CD+  W YGLGMAFLAI  PSLPC+FGIT+LF 
Sbjct  437  REPGPVS-SRMDPIDSDSRKGYRQASSCDIVTWYYGLGMAFLAIAAPSLPCIFGITALFM  495

Query  271  RLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            RLGLMV GG++LA+FMTYASEHLAIRSF +G+ED++  RS S  F 
Sbjct  496  RLGLMVVGGLILAAFMTYASEHLAIRSFLKGLEDRNTTRSRSACFL  541



>gb|KJB82306.1| hypothetical protein B456_013G188300 [Gossypium raimondii]
Length=542

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+FVCF AA +S+G+SI I+PRQ+MPWTGL+LMYEWTF++F LSFG++LHL+  WGK
Sbjct  377  GAISVFVCFMAAVVSLGISISIVPRQLMPWTGLLLMYEWTFSIFFLSFGAFLHLIYLWGK  436

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFA  272
                    SR   +  DS KG+RQ S CD+  W YGLGMAFLAI  PSLPC+FGIT+LF 
Sbjct  437  REPGPVS-SRMDPIDSDSRKGYRQASSCDIVTWYYGLGMAFLAIAAPSLPCIFGITALFM  495

Query  271  RLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            RLGLMV GG++LA+FMTYASEHLAIRSF +G+ED++  RS S  F 
Sbjct  496  RLGLMVVGGLILAAFMTYASEHLAIRSFLKGLEDRNTTRSRSACFL  541



>ref|XP_009779488.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
sylvestris]
Length=533

 Score =   216 bits (550),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 131/168 (78%), Gaps = 5/168 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GG+S+ VCFAA   S+GLS++IIPRQ+MPWTGL+LMYEWTFTLF L FGSYLHL+ 
Sbjct  362  AFL-GGISVCVCFAAVLASLGLSLVIIPRQVMPWTGLLLMYEWTFTLFFLLFGSYLHLIY  420

Query  460  HWGKMAGNQAGH--SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLF  293
             WGK   N+A    + P SL ++S KGH+  QSCCD+ A  YGLGMA LAIL P+LP +F
Sbjct  421  QWGKAVANRARQFQAHPASLDHESGKGHQVQQSCCDIAACYYGLGMASLAILAPALPSIF  480

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            GIT+LF RLGLMV GG+VLASFMTYASEHL+IRSF  G E+   QR +
Sbjct  481  GITALFLRLGLMVVGGLVLASFMTYASEHLSIRSFMSGFEEGGTQRRS  528



>ref|XP_009343790.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 135/183 (74%), Gaps = 4/183 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     K     GG+SI VCF AA +++ LS+ I+PRQ+MPWTGL+LMYEWTFT+F +
Sbjct  366  SINPNHQTKVPVYLGGISIVVCFMAALVALALSLAIVPRQVMPWTGLLLMYEWTFTVFFI  425

Query  490  SFGSYLHLVQHWGKMAGNQAGHSR--PKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLA  323
             FG YLHL+ HWGK    QAG S   P+S+ YDS KGH++  S CD   + YGLGMAFLA
Sbjct  426  LFGGYLHLIYHWGKTTAVQAGTSPSGPESVDYDSGKGHQRQASLCDNATFYYGLGMAFLA  485

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            +  PSLPCLFGIT+LF RLGLMV GG+VLASFMTYASEHLA RSF RG ED+D  RS S+
Sbjct  486  VAAPSLPCLFGITALFLRLGLMVVGGLVLASFMTYASEHLATRSFLRGFEDRDATRSRSL  545

Query  142  *FF  134
              F
Sbjct  546  CLF  548



>ref|XP_008370762.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 134/183 (73%), Gaps = 4/183 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     K     GG+SI VCF AA +++ LS+ I+PRQ+MPWTGL+LMYEWTFT+F +
Sbjct  366  SINPNHQTKVPVYLGGISIVVCFMAALVALALSLAIVPRQVMPWTGLLLMYEWTFTIFFI  425

Query  490  SFGSYLHLVQHWGKMAGNQAGHSR--PKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLA  323
             FG YLHL+  WGK    QAG S   P+S+ YDS KGH++  S CD   + YGLGMAFLA
Sbjct  426  LFGGYLHLIYQWGKTTAVQAGTSPSGPESVDYDSGKGHQRQASXCDNATFYYGLGMAFLA  485

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            +  PSLPCLFGIT+LF RLGLMV GG+VLASFMTYASEHLA RSF RG ED+D  RS S+
Sbjct  486  VAAPSLPCLFGITALFLRLGLMVVGGLVLASFMTYASEHLATRSFLRGFEDRDATRSRSL  545

Query  142  *FF  134
              F
Sbjct  546  CLF  548



>ref|XP_007147201.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
 gb|ESW19195.1| hypothetical protein PHAVU_006G104100g, partial [Phaseolus vulgaris]
Length=531

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 136/185 (74%), Gaps = 9/185 (5%)
 Frame = -1

Query  688  HHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWT  509
            H  L  A NK      A+L GG+S+ VCF  A +S+GLS+LI+PRQ+MPWTGL+LMYEWT
Sbjct  347  HQLLHGAQNK----VPAYL-GGLSVCVCFMVAVVSLGLSLLIVPRQVMPWTGLLLMYEWT  401

Query  508  FTLFLLSFGSYLHLVQHWGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYGL  341
            +T+F + FG YL L+  WGK+ G++   S   P S  +DS K H++  S CD+  W YGL
Sbjct  402  YTIFFILFGGYLRLIYQWGKIVGSRVASSLSDPGSSNHDSEKRHQRPVSSCDITTWYYGL  461

Query  340  GMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            GMA LAI  PSLPCLFGIT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G +++D+
Sbjct  462  GMALLAIAAPSLPCLFGITALFVRLGLMVVGGIILASFMTYASEHLAIRSFLKGFDERDI  521

Query  160  QRSTS  146
              S++
Sbjct  522  AWSSN  526



>ref|XP_010922963.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Elaeis guineensis]
Length=543

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 125/166 (75%), Gaps = 4/166 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S   CF AA +SV L+  ++PRQ+MPWTGL+LMYEWTFT F ++FGSYL LV HWGK
Sbjct  374  GAVSAVFCFMAAIVSVALAFAVVPRQVMPWTGLLLMYEWTFTAFFITFGSYLRLVYHWGK  433

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
               NQAG   +   S  +DS KGH++  S CD+  W YG GMA LA+ TP+LPC  GITS
Sbjct  434  AMSNQAGTIVAYMDSSNHDSGKGHQRHASNCDIATWFYGTGMALLAVATPALPCALGITS  493

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            LFARLGLM AGG+VLASFMTYASEHLAIR+F RG++D+D  R+ +V
Sbjct  494  LFARLGLMAAGGLVLASFMTYASEHLAIRAFVRGLDDRDQPRTRNV  539



>ref|XP_007030330.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
 gb|EOY10832.1| Plant glycogenin-like starch initiation protein 6 isoform 1 [Theobroma 
cacao]
Length=536

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 133/180 (74%), Gaps = 4/180 (2%)
 Frame = -1

Query  673  PAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFL  494
            P +N           GG+S+FVCF AA +S+G+++ I+PRQ+MPWTGL+LMYEWTFT+F 
Sbjct  356  PTINSNHQFPVPAYLGGISVFVCFVAAVVSLGIALSIVPRQVMPWTGLLLMYEWTFTIFF  415

Query  493  LSFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFL  326
            L FG++LHL   WG+    Q G   SR  S  +DS KGH++  S CD+  W YGLGMAFL
Sbjct  416  LLFGAFLHLTHQWGRRTATQLGSFSSRTDSFDFDSTKGHQRQASSCDIVTWYYGLGMAFL  475

Query  325  AILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            AI  PSLPC+FGIT+LF RLGLMV GG++LASFMTYASEHLAIRSF +G+ED+D  RS S
Sbjct  476  AIAAPSLPCIFGITALFVRLGLMVVGGLILASFMTYASEHLAIRSFLKGLEDRDTTRSMS  535



>gb|KEH24575.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=549

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+  C  AA +S+GL++LI+PRQ+MPWTGL+LMYEWTFT+F++ FG YLHLV  WGK
Sbjct  381  GGVSVCFCLTAAVVSLGLALLIVPRQVMPWTGLLLMYEWTFTMFIVLFGGYLHLVYRWGK  440

Query  448  -MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
             +A   A  S P+SL YDS K H++  S CD   W YG+GMA LAI  PSLPCLFGIT+L
Sbjct  441  HVASRAASSSLPESLDYDSGKRHQRQISSCDAATWYYGVGMALLAIGAPSLPCLFGITAL  500

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
            F RLGLMV GGI+LASFMTYASEHLAIRSF +G+++ D   + S+ F
Sbjct  501  FLRLGLMVFGGIILASFMTYASEHLAIRSFLKGLDEWDTAPNRSLCF  547



>gb|ADY38797.1| plant glycogenin-like starch initiation protein [Coffea arabica]
Length=461

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 130/173 (75%), Gaps = 5/173 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GGMSI VCF AA +S+ LS  IIPRQ+ PWTGL+LMYEWTFT+F L FGSYL L+ 
Sbjct  289  AFL-GGMSILVCFMAALVSLALSFAIIPRQVTPWTGLLLMYEWTFTIFSLLFGSYLQLIS  347

Query  460  HWGKMAGNQAG--HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLF  293
            HWGK+  N+A    SR +S  YDS KGH++  S CD+ A  YGLG A LAI  P+LP + 
Sbjct  348  HWGKIVANRAASLSSRAESFDYDSGKGHQRQLSSCDVAACYYGLGAALLAIAVPALPFIL  407

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            GIT+LF RLGLM AGG+VLASFMTYA+EHLAI+SF  G+E ++ QRS++  F 
Sbjct  408  GITALFLRLGLMAAGGLVLASFMTYAAEHLAIKSFLLGLEAREPQRSSNTCFL  460



>gb|KHN31485.1| Glycogenin-1 [Glycine soja]
Length=551

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 137/186 (74%), Gaps = 10/186 (5%)
 Frame = -1

Query  691  VHHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEW  512
            VH  L  A NK      A+L GG+S+ VCF  A +S+GL++LI+P+Q+MPWTGL+LMYEW
Sbjct  367  VHQLLNGAQNK----VPAYL-GGISVCVCFMVAVVSLGLALLIVPQQVMPWTGLLLMYEW  421

Query  511  TFTLFLLSFGSYLHLVQHWGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYG  344
              T F + FG Y+HL+  WGK+ G++A  S  +P S  YDS K H++  S CD   W YG
Sbjct  422  AITTFFILFGGYIHLIYQWGKIVGSRAASSLSQPGS-DYDSEKFHQRQISSCDSATWYYG  480

Query  343  LGMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKD  164
            LGMA LAI  PSLPCLFGIT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G++++D
Sbjct  481  LGMALLAIAAPSLPCLFGITALFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGIDERD  540

Query  163  VQRSTS  146
              R++S
Sbjct  541  NARNSS  546



>ref|XP_010102196.1| hypothetical protein L484_024477 [Morus notabilis]
 gb|EXB93139.1| hypothetical protein L484_024477 [Morus notabilis]
Length=561

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 127/163 (78%), Gaps = 4/163 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+F CF  A +++ L + I+PRQ+MPWTGL+LMYEWTFT+F L FG YLHL+  WGK
Sbjct  374  GGVSVFFCFTVALVALALGLAIVPRQVMPWTGLLLMYEWTFTIFSLLFGGYLHLIYQWGK  433

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q+G   S  +SL YDS KGH++  S CD+ AW YGLGMAFLAI+ PS+PC  GIT+
Sbjct  434  ATVVQSGSLPSHSESLDYDSGKGHQRLASSCDIAAWYYGLGMAFLAIVAPSVPCFLGITA  493

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRS  152
            LF RL L+VAGG++LASFMTYASEHLAIRSF RG+ED+D  RS
Sbjct  494  LFGRLALIVAGGLILASFMTYASEHLAIRSFLRGLEDRDTARS  536



>ref|XP_006437457.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 ref|XP_006437459.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50697.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50699.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=332

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG SI VCF  A ++ G+S  I+PRQ MPWTGL+L+YEWTFT+F L FG +LHL+  WGK
Sbjct  162  GGSSIVVCFMVALVAFGISFSIVPRQAMPWTGLLLVYEWTFTMFFLLFGGFLHLIYKWGK  221

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                QAG   S  +S  YDS KGH++  S CD   W YG+GMA LA++ PSLP +FG+T+
Sbjct  222  ATAFQAGSFSSDVESSDYDSGKGHQRQASACDFVTWYYGMGMALLAVIAPSLPAMFGVTA  281

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            LF RLGLMVAGGIVLA+FMTYASEHLAIRS+ RG+ED+D 
Sbjct  282  LFLRLGLMVAGGIVLAAFMTYASEHLAIRSYLRGLEDRDT  321



>ref|XP_009401946.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ +CF AA LS+GLS +++P Q+MPWTGL+LMYEWTF  F + FGSYL+ +  WGK
Sbjct  380  GAISVVICFVAAALSLGLSFILVPHQVMPWTGLLLMYEWTFVTFFIIFGSYLNFIYQWGK  439

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
              GNQ  H+R  S  YDS KG ++  S CD+  W Y LGMAFLA++ PS+PCL GIT+LF
Sbjct  440  STGNQTNHNRFDSSDYDSGKGSQRSSSSCDIVPWFYWLGMAFLAVIVPSMPCLLGITALF  499

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            ARLGLMV GG++LA+F+T++SEHLAIR+FT+G ED+   R+ ++
Sbjct  500  ARLGLMVGGGLILAAFVTFSSEHLAIRAFTKGCEDRHQPRARNI  543



>gb|KDO49228.1| hypothetical protein CISIN_1g008931mg [Citrus sinensis]
Length=548

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG SI VCF  A ++ G+S  I+PRQ+MPWTGL+L+YEWTFT+F L FG +LHL+  WGK
Sbjct  378  GGSSIVVCFMVALVAFGISFSIVPRQVMPWTGLLLVYEWTFTMFFLLFGGFLHLIYKWGK  437

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                QAG   S  +S  YDS KGH++  S CD   W YG+GMA LA++ PSLP +FG+T+
Sbjct  438  ATAFQAGSFSSDVESSDYDSGKGHQRQASACDFVTWYYGMGMALLAVIAPSLPAMFGVTA  497

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            LF RLGLMVAGGIVLASFMTYASEHLAIRS+ RG+ED+D 
Sbjct  498  LFLRLGLMVAGGIVLASFMTYASEHLAIRSYLRGLEDRDT  537



>ref|XP_006484615.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Citrus 
sinensis]
Length=548

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG SI VCF  A ++ G+S  I+PRQ+MPWTGL+L+YEWTFT+F L FG +LHL+  WGK
Sbjct  378  GGSSIVVCFMVALVAFGISFSIVPRQVMPWTGLLLVYEWTFTMFFLLFGGFLHLIYKWGK  437

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                QAG   S  +S  YDS KGH++  S CD   W YG+GMA LA++ PSLP +FG+T+
Sbjct  438  ATAFQAGSFSSDVESSDYDSGKGHQRQASACDFVTWYYGMGMALLAVIAPSLPAMFGVTA  497

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            LF RLGLMVAGGIVLASFMTYASEHLAIRS+ RG+ED+D 
Sbjct  498  LFLRLGLMVAGGIVLASFMTYASEHLAIRSYLRGLEDRDT  537



>emb|CAN77613.1| hypothetical protein VITISV_036932 [Vitis vinifera]
Length=587

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 126/177 (71%), Gaps = 16/177 (9%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ +CF  A +S+ L++ ++PRQ+MPWTGL+LMYEW FT F L FG YLHL+  WGK
Sbjct  331  GGISVVICFMVAVVSLALALSVVPRQVMPWTGLLLMYEWAFTSFFLLFGGYLHLIYQWGK  390

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            M  +QAG   SRP S  YDS KGH++  S CD   W YGLGMAFLA+  PSLPC+FG+T+
Sbjct  391  MTASQAGSFASRPVSADYDSGKGHQRQVSSCDAATWYYGLGMAFLAVAAPSLPCVFGVTA  450

Query  280  LFA------------RLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            LF             RLGL+  G ++LASFMTYA+EHLAIRSF +G+ED+D  RS S
Sbjct  451  LFLRFIIGKVRGGLYRLGLIAVGALILASFMTYAAEHLAIRSFVKGLEDRDTPRSRS  507



>ref|XP_006437458.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50698.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=392

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG SI VCF  A ++ G+S  I+PRQ MPWTGL+L+YEWTFT+F L FG +LHL+  WGK
Sbjct  222  GGSSIVVCFMVALVAFGISFSIVPRQAMPWTGLLLVYEWTFTMFFLLFGGFLHLIYKWGK  281

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                QAG   S  +S  YDS KGH++  S CD   W YG+GMA LA++ PSLP +FG+T+
Sbjct  282  ATAFQAGSFSSDVESSDYDSGKGHQRQASACDFVTWYYGMGMALLAVIAPSLPAMFGVTA  341

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            LF RLGLMVAGGIVLA+FMTYASEHLAIRS+ RG+ED+D 
Sbjct  342  LFLRLGLMVAGGIVLAAFMTYASEHLAIRSYLRGLEDRDT  381



>ref|XP_011101631.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Sesamum indicum]
Length=785

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 136/198 (69%), Gaps = 9/198 (5%)
 Frame = -1

Query  688  HHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWT  509
            + QL  A NK     GA     MS+ VC  AA  S+ LS  I+PRQ+MPWTGL+L+YEWT
Sbjct  356  NQQLPNAANKVPVFLGA-----MSVVVCIMAALFSLALSFSIVPRQVMPWTGLLLVYEWT  410

Query  508  FTLFLLSFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGH--RQSCCDMDAWNYGL  341
            FT+F L FGSYLH+V HWGK   NQ     + P+SL  DS KGH    S CD+ A  YGL
Sbjct  411  FTVFFLLFGSYLHVVHHWGKYVANQTASFSTNPESLDNDSRKGHLREMSSCDVAACYYGL  470

Query  340  GMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            GMA LA+  P LPCL G+T+LF R+GLMVAGG++LASFMTYAS+HL++R+F RG ED D+
Sbjct  471  GMASLALAVPLLPCLLGVTALFLRVGLMVAGGLILASFMTYASDHLSVRAFVRGYEDGDL  530

Query  160  QRSTSV*FFY*LES*IVV  107
            QR+ +  + + LE  I V
Sbjct  531  QRTRNFCYLWYLEVLIFV  548



>ref|XP_009379742.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Pyrus x bretschneideri]
Length=549

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 131/180 (73%), Gaps = 4/180 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     K     GG+SI VCF AA +++ LS+ I+PRQ+MPWTGL+LMYEWTFT+F +
Sbjct  366  SINPNHQSKVPVYLGGISIVVCFMAALVALALSLAIVPRQVMPWTGLLLMYEWTFTIFFV  425

Query  490  SFGSYLHLVQHWGKMAGNQA--GHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLA  323
             FG YLHL+  WGK    QA    S P+S+ YDS KGH++  S CD     YGLGMAFLA
Sbjct  426  LFGGYLHLIYQWGKTTSVQAETSPSAPESVDYDSGKGHQRQASLCDNARLYYGLGMAFLA  485

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            +  PSLPCLFGIT+LF RLGLMV GG+VLASFMTYASEHLA RSF RG ED+D  RS S+
Sbjct  486  VAAPSLPCLFGITALFLRLGLMVVGGLVLASFMTYASEHLATRSFLRGFEDRDATRSRSL  545



>ref|XP_004494729.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=551

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ VC  AA +S+GL +LI+PRQ+MPWTGL+LMYEWTFT+F++SFG YLHLV  WGK
Sbjct  382  GGISVCVCLVAAVVSLGLGLLIVPRQVMPWTGLLLMYEWTFTMFIISFGGYLHLVYQWGK  441

Query  448  MAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
               ++A  S   P+SL YDS K H++  S CD   W YGLGMA LAI  PSLPCLFGIT+
Sbjct  442  FVASRAAASLSHPESLDYDSGKRHQRQMSSCDTATWYYGLGMALLAIGAPSLPCLFGITA  501

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLMV GGI+LASFMTYASEHLAIRSF +G+E+ D+  + S+ F 
Sbjct  502  LFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGLEEWDIAPNRSLCFL  550



>ref|XP_008366883.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Malus domestica]
Length=549

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 130/179 (73%), Gaps = 4/179 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     K     GG+SI VCF AA +++ LS+ I+PRQ+MPWTGL+LMYEWTFT+F +
Sbjct  366  SINPNHQSKVPVYLGGISIVVCFMAALVALALSLAIVPRQVMPWTGLLLMYEWTFTIFFV  425

Query  490  SFGSYLHLVQHWGKMAGNQA--GHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLA  323
             FG YLHL+  WGK    QA    S P+S+ YDS KGH++  S CD     YGLGMAFLA
Sbjct  426  LFGGYLHLIYQWGKTTAVQAETSPSAPESVDYDSGKGHQRQASLCDNATLYYGLGMAFLA  485

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            +  PSLPCLFGIT+LF RLGLMV GG+VLASFMTYASEHLA RSF RG ED+D  RS S
Sbjct  486  VAAPSLPCLFGITALFLRLGLMVVGGLVLASFMTYASEHLATRSFLRGFEDRDGTRSRS  544



>ref|XP_008807617.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
 ref|XP_008807625.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Phoenix dactylifera]
Length=544

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S   CF AA +SV L+  ++PRQ+MPWTGL+LMYEWTFT F + FGSYL LV HWGK
Sbjct  375  GAVSAVFCFIAAIVSVALAFAVVPRQVMPWTGLLLMYEWTFTAFFMIFGSYLRLVYHWGK  434

Query  448  MAGNQAG--HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
               N AG   +   S  YDS KGH++  S CD+  W YG GMA LA+ TP+LPC  GIT+
Sbjct  435  ATSNHAGTISTYMDSSNYDSGKGHQRHTSNCDIATWFYGTGMALLAVATPALPCALGITA  494

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV  143
            LF RLGLM AGG+VLASFM YASEHLAIR+F RG++D+D  R+ SV
Sbjct  495  LFVRLGLMAAGGLVLASFMAYASEHLAIRAFVRGLDDRDQPRTRSV  540



>ref|XP_007205021.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
 gb|EMJ06220.1| hypothetical protein PRUPE_ppa003817mg [Prunus persica]
Length=546

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 129/179 (72%), Gaps = 4/179 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     +     GG+SI VCF AA +++ L+  I+PRQ+MPWTGL++MYEWTFT+F +
Sbjct  363  SINPNHQTRVPVYLGGISIVVCFMAALVALALAFAIVPRQVMPWTGLLMMYEWTFTIFFI  422

Query  490  SFGSYLHLVQHWGKMAGNQAG--HSRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLA  323
             FG YLHL+  WGK    QAG   S P+S+ YDS KGH+  +S CD     YGLGMAFLA
Sbjct  423  LFGGYLHLIYQWGKGTAVQAGALSSVPESVDYDSGKGHQRQESLCDSATLCYGLGMAFLA  482

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            I  PSLPCLFGIT+LF RLGLMV GG+ LASFMTYASEHLA RSF RG ED+D  RS S
Sbjct  483  IAAPSLPCLFGITALFLRLGLMVVGGLALASFMTYASEHLATRSFLRGFEDRDGSRSRS  541



>gb|KGN61301.1| hypothetical protein Csa_2G078050 [Cucumis sativus]
Length=463

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            AVN     K     GG+SIFVCF AA +S+ L+  I+PRQ+MPWTGL+LMYEW FT+F+L
Sbjct  281  AVNLNHQSKIPVFLGGISIFVCFLAAVISLALAFAIVPRQVMPWTGLLLMYEWIFTIFIL  340

Query  490  SFGSYLHLVQHWGKMAGNQAGH-SRPKSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAIL  317
             FGSYLH +  WGK    QAG  S  +S  Y S     Q S  D+ AW YGLGMAFLA++
Sbjct  341  LFGSYLHFIFKWGKSMATQAGSFSDSESFDYSSKDHQWQASSSDVTAWFYGLGMAFLAVI  400

Query  316  TPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
             P+LPC+ G+++LF RLGLMV GG++LASFMTYA+EHLAIRSF RG+E+KD  R +
Sbjct  401  APTLPCILGVSALFLRLGLMVVGGLILASFMTYAAEHLAIRSFLRGLENKDGARGS  456



>ref|XP_009606765.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Nicotiana 
tomentosiformis]
Length=535

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 6/174 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GG+S+ VCFAA  +S+GLS++IIPRQ+MPWTGL+LMYEWTFTLF L FGSYLHL+ 
Sbjct  362  AFL-GGISVCVCFAAVLVSLGLSLVIIPRQVMPWTGLLLMYEWTFTLFFLFFGSYLHLIY  420

Query  460  HWGKMAGNQAG--HSRPKSLAYDSAKGH--RQSCCDMDAWNYGLGMAFLAILTPSLPCLF  293
             WGK   N+AG   + P SL ++S KGH  +QSCCD+ A  YGLGMA LAIL P+LP +F
Sbjct  421  QWGKAVANRAGQFQAHPASLDHESGKGHQWQQSCCDIAACYYGLGMASLAILAPALPSIF  480

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
            GIT+LF RLGLMV GG+VLASFMTYASEHL++RSF RG E+    QR+ S+ F 
Sbjct  481  GITALFLRLGLMVVGGLVLASFMTYASEHLSVRSFMRGFEEGGGTQRNRSICFL  534



>emb|CDO99980.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 129/173 (75%), Gaps = 5/173 (3%)
 Frame = -1

Query  640  AFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQ  461
            AFL GGMSI VCF AA +S+ LS  IIPRQ+ PWTGL+LMYEWTFT+F L FGSYL L+ 
Sbjct  374  AFL-GGMSILVCFMAALVSLALSFAIIPRQVTPWTGLLLMYEWTFTIFSLLFGSYLQLIS  432

Query  460  HWGKMAGNQAG--HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLF  293
            HWGK+  N+A    SR +S  YDS KGH++  S CD+ A  YGLG A LAI  P+LP + 
Sbjct  433  HWGKIVANRAASLSSRAESFDYDSGKGHQRQLSSCDVAACYYGLGAALLAIAVPALPFIL  492

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            GIT+LF RLGLM AGG+VLASF TYA+EHLAI+SF  G+E ++ QRS++  F 
Sbjct  493  GITALFLRLGLMAAGGLVLASFTTYAAEHLAIKSFLLGLEAREPQRSSNTCFL  545



>gb|KHG20951.1| Glycogenin-1 [Gossypium arboreum]
Length=403

 Score =   202 bits (514),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 122/162 (75%), Gaps = 3/162 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+FVCF A  +S+G+SI I+P+Q+MPWT L LMYEWTFT+F L FG++LHL+   G+
Sbjct  236  GGISVFVCFMAVVVSLGISITIVPQQVMPWTSLFLMYEWTFTIFFLLFGAFLHLIYQQGR  295

Query  448  MAGNQAGHSRPKSLAY--DSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                Q       +  +  DS K HRQ S CD+ +W YGLGMAFLAI+ PSLPC+FGIT+L
Sbjct  296  RIVTQLTPVSADTDLFNSDSKKDHRQASSCDIVSWYYGLGMAFLAIVAPSLPCIFGITTL  355

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRS  152
            F RLGLMV GGI+LASFMTYASEHLA RSF +G ED+D  +S
Sbjct  356  FLRLGLMVVGGIILASFMTYASEHLASRSFLKGCEDRDTTQS  397



>ref|XP_003590989.1| Glycogenin-1 [Medicago truncatula]
 gb|AES61240.1| glucuronosyltransferase PGSIP8 [Medicago truncatula]
Length=541

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 4/163 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ V F AA +S+GL+++I+PRQ+ PWTGL+LMYEW FT+F + FG YL+L+ HWGK
Sbjct  372  GGVSVCVSFMAAMVSLGLTLVIVPRQVTPWTGLLLMYEWAFTIFFILFGGYLNLIYHWGK  431

Query  448  MAGNQA--GHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +  ++A    S+ K    DS KGH++  S CD   W YGLGMAFLAI+ PSLPCLFGIT+
Sbjct  432  IKASRAVSSLSQSKPSDDDSGKGHQRQISSCDTATWFYGLGMAFLAIVAPSLPCLFGITA  491

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRS  152
            LF RLGLM+ GGI+L SFMTYASEHLA++SF +G++D+D+ R+
Sbjct  492  LFLRLGLMIVGGIILTSFMTYASEHLAMKSFLKGLDDRDIARN  534



>gb|ABZ89190.1| hypothetical protein 46C02.16 [Coffea canephora]
Length=546

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GGMSI VCF AA +S+ LS  IIPRQ+ PWTGL+LMYEWTFT+F L FGSYL L+ HWGK
Sbjct  377  GGMSILVCFMAALVSLALSFAIIPRQVTPWTGLLLMYEWTFTIFSLLFGSYLQLISHWGK  436

Query  448  MAGNQAG--HSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +  N+A    SR +S  YDS KGH++  S CD+ A  YGLG A LAI  P+LP + GIT+
Sbjct  437  IVANRAASLSSRAESFDYDSGKGHQRQLSSCDVAACYYGLGAALLAIAVPALPFILGITA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM AGG+VLASF TYA+EHLAI+SF  G+E ++ QRS++  F 
Sbjct  497  LFLRLGLMAAGGLVLASFTTYAAEHLAIKSFLLGLEAREPQRSSNTCFL  545



>ref|XP_006437460.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
 gb|ESR50700.1| hypothetical protein CICLE_v10031149mg [Citrus clementina]
Length=548

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG SI VCF  A ++ G+S  I+PRQ MPWTGL+L+YEWTFT+F L FG +LHL+  WGK
Sbjct  378  GGSSIVVCFMVALVAFGISFSIVPRQAMPWTGLLLVYEWTFTMFFLLFGGFLHLIYKWGK  437

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                QAG   S  +S  YDS KGH++  S CD   W YG+GMA LA++ PSLP +FG+T+
Sbjct  438  ATAFQAGSFSSDVESSDYDSGKGHQRQASACDFVTWYYGMGMALLAVIAPSLPAMFGVTA  497

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            LF RLGLMVAGGIVLA+FMTYASEHLAIRS+ RG+ED+D 
Sbjct  498  LFLRLGLMVAGGIVLAAFMTYASEHLAIRSYLRGLEDRDT  537



>ref|XP_008218517.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Prunus mume]
Length=510

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 128/179 (72%), Gaps = 4/179 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            ++N     K     GG+SI VCF AA +++ L+  I+PRQ+MPWTGL++MYEWTFT+F +
Sbjct  327  SINPNHQTKVPVYLGGISIVVCFMAALVALALAFAIVPRQVMPWTGLLMMYEWTFTIFFI  386

Query  490  SFGSYLHLVQHWGKMAGNQAG--HSRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLA  323
             FG YLHL+  WGK    QAG   S P+S+ YDS KGH+  +S C      YGLGMAFLA
Sbjct  387  LFGGYLHLIYQWGKGTAVQAGALSSVPESVDYDSGKGHQRQESLCASATLCYGLGMAFLA  446

Query  322  ILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            I  PSLPCLFGIT+LF RLGLMV GG+ LASFMTYASEHLA RSF RG ED+D  RS S
Sbjct  447  IAAPSLPCLFGITALFLRLGLMVVGGLALASFMTYASEHLATRSFLRGFEDRDGTRSRS  505



>ref|XP_004152810.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cucumis 
sativus]
 ref|XP_004155109.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cucumis 
sativus]
Length=545

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 130/177 (73%), Gaps = 4/177 (2%)
 Frame = -1

Query  670  AVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLL  491
            AVN     K     GG+SIFVCF AA +S+ L+  I+PRQ+MPWTGL+LMYEW FT+F+L
Sbjct  363  AVNLNHQSKIPVFLGGISIFVCFLAAVISLALAFAIVPRQVMPWTGLLLMYEWIFTIFIL  422

Query  490  SFGSYLHLVQHWGKMAGNQAGH-SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAI  320
             FGSYLH +  WGK    QAG  S  +S  Y S+K H+   S  D+ AW YGLGMAFLA+
Sbjct  423  LFGSYLHFIFKWGKSMATQAGSFSDSESFDY-SSKDHQWQASSSDVTAWFYGLGMAFLAV  481

Query  319  LTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            + P+LPC+ G+++LF RLGLMV GG++LASFMTYA+EHLAIRSF RG+E+KD  R +
Sbjct  482  IAPTLPCILGVSALFLRLGLMVVGGLILASFMTYAAEHLAIRSFLRGLENKDGARGS  538



>ref|XP_010675056.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Beta vulgaris subsp. vulgaris]
Length=546

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 127/180 (71%), Gaps = 10/180 (6%)
 Frame = -1

Query  670  AVNKRCAIKGAFLS------GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWT  509
            A N    +   FLS      GGMSI VC  A  +S+GL++LI+PRQ++PW GL+LMYEWT
Sbjct  363  ATNSSQQLYSGFLSKVPWFLGGMSISVCLLAFVISLGLALLIVPRQVLPWIGLLLMYEWT  422

Query  508  FTLFLLSFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGHRQSCCDMDA--WNYGL  341
            FT+F L FG YL L+Q WGK+   QA    S P+SL YDS KGH++     DA    YGL
Sbjct  423  FTIFFLLFGGYLRLLQQWGKVKAIQARSYSSDPESLDYDSGKGHQRQVSSFDAAVLYYGL  482

Query  340  GMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            GM  LAI  PSLP L GIT+LF RLGLMV GGIVLA+FMTYASEHLAI+SF +G++D+DV
Sbjct  483  GMVLLAIAAPSLPFLLGITALFVRLGLMVVGGIVLAAFMTYASEHLAIQSFLKGLDDRDV  542



>ref|XP_006604859.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=551

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 10/185 (5%)
 Frame = -1

Query  691  VHHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEW  512
            VH  L  A NK      A+L GG+S+ VCF  A +S+GL++LI+PRQ+MPWTGL+LMYEW
Sbjct  367  VHQLLNGAQNK----APAYL-GGISVCVCFVVAVVSLGLALLIVPRQVMPWTGLLLMYEW  421

Query  511  TFTLFLLSFGSYLHLVQHWGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYG  344
            TFT+F + FG Y+HL+  WGK+ G++   S  +P S  YDS K H++  S CD+  W YG
Sbjct  422  TFTIFFILFGGYIHLIYQWGKIVGSRVASSLSQPGS-DYDSEKRHQRQISSCDVATWYYG  480

Query  343  LGMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKD  164
            LGMA LAI  PSLPCLFGIT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G ++++
Sbjct  481  LGMALLAIAAPSLPCLFGITALFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGFDERE  540

Query  163  VQRST  149
              R++
Sbjct  541  NARNS  545



>gb|EYU19884.1| hypothetical protein MIMGU_mgv1a004141mg [Erythranthe guttata]
Length=542

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 128/185 (69%), Gaps = 8/185 (4%)
 Frame = -1

Query  688  HHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWT  509
            + QL  A   +     AFL G +S  V F AA +S+ LS  I+PRQIMPWTG  L+YEWT
Sbjct  357  NQQLPNAAQSKVP---AFL-GPVSAAVSFIAALVSLALSFSIVPRQIMPWTGFFLVYEWT  412

Query  508  FTLFLLSFGSYLHLVQHWGKMAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGL  341
            FT+F L FGSYLH++  WGK    Q+    SRP+S  YDS KGH +  S CD+    YGL
Sbjct  413  FTIFFLLFGSYLHVIYQWGKHLAQQSASFSSRPESSDYDSGKGHLRHMSSCDVAGCYYGL  472

Query  340  GMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDV  161
            GMA LA+  P LPCL GIT+LF RLGLMVAGG++L SFMTYASEHL+IR+F RG ED+D 
Sbjct  473  GMASLALAVPLLPCLLGITALFLRLGLMVAGGLILTSFMTYASEHLSIRAFMRGYEDRDS  532

Query  160  QRSTS  146
            QR+ S
Sbjct  533  QRTRS  537



>ref|XP_004302108.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Fragaria vesca subsp. vesca]
Length=539

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 124/164 (76%), Gaps = 3/164 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GGMSI  CF AA +++ + + ++PRQ+MPWTGL+LMYEWTFT+F L FG Y+HLV  WG+
Sbjct  374  GGMSIVACFMAAMVALVVGLAVVPRQVMPWTGLLLMYEWTFTIFFLLFGGYIHLVYQWGR  433

Query  448  MAGNQAGHSR-PKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                QA  S   +S+  DS K H++  S CD  + +YGLGMAFLA+  PSLPCLFG+T+L
Sbjct  434  TTAVQATFSSGSESVDDDSGKRHQRQVSLCDSASLHYGLGMAFLAVAAPSLPCLFGVTAL  493

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            F RLGLMV GG++LASFMTYASEHLA RSF RG+ED+D  RS S
Sbjct  494  FLRLGLMVVGGLILASFMTYASEHLATRSFLRGLEDRDATRSRS  537



>ref|XP_008441775.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Cucumis melo]
Length=546

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 4/163 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SIFVCF +A +S+ L+  I+PRQ+MPWTGL+LMYEW FT+F+L FGSYLH +  WGK
Sbjct  378  GGISIFVCFLSAAISLALAFAIVPRQVMPWTGLLLMYEWIFTIFILLFGSYLHFIFKWGK  437

Query  448  MAGNQAGH-SRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                QAG  S  +S  Y SAK H+   S  D+  W YGLGMAFL ++ P+LPC+ G+T+L
Sbjct  438  SMATQAGSFSDSESFDY-SAKDHQWQASSSDVTTWFYGLGMAFLVVIAPTLPCILGVTAL  496

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            F RLGLMV GG++L SFMTYASEHLAIRSF RG+E++D  R +
Sbjct  497  FLRLGLMVVGGLILVSFMTYASEHLAIRSFLRGLENRDGARGS  539



>ref|XP_006604858.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
Length=552

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%), Gaps = 9/185 (5%)
 Frame = -1

Query  691  VHHQLQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEW  512
            VH QL      +     A+L GG+S+ VCF  A +S+GL++LI+PRQ+MPWTGL+LMYEW
Sbjct  367  VHQQLLNGAQNKAP---AYL-GGISVCVCFVVAVVSLGLALLIVPRQVMPWTGLLLMYEW  422

Query  511  TFTLFLLSFGSYLHLVQHWGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYG  344
            TFT+F + FG Y+HL+  WGK+ G++   S  +P S  YDS K H++  S CD+  W YG
Sbjct  423  TFTIFFILFGGYIHLIYQWGKIVGSRVASSLSQPGS-DYDSEKRHQRQISSCDVATWYYG  481

Query  343  LGMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKD  164
            LGMA LAI  PSLPCLFGIT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G ++++
Sbjct  482  LGMALLAIAAPSLPCLFGITALFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGFDERE  541

Query  163  VQRST  149
              R++
Sbjct  542  NARNS  546



>ref|XP_007030331.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
 gb|EOY10833.1| Plant glycogenin-like starch initiation protein 6 isoform 2 [Theobroma 
cacao]
Length=525

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = -1

Query  673  PAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFL  494
            P +N           GG+S+FVCF AA +S+G+++ I+PRQ+MPWTGL+LMYEWTFT+F 
Sbjct  356  PTINSNHQFPVPAYLGGISVFVCFVAAVVSLGIALSIVPRQVMPWTGLLLMYEWTFTIFF  415

Query  493  LSFGSYLHLVQHWGKMAGNQAGHSRPKSLAYDSAKGHRQSCCDMDAWNYGLGMAFLAILT  314
            L FG++LHL   WG+    Q G       ++ S    + S CD+  W YGLGMAFLAI  
Sbjct  416  LLFGAFLHLTHQWGRRTATQLG-------SFSSRHQRQASSCDIVTWYYGLGMAFLAIAA  468

Query  313  PSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            PSLPC+FGIT+LF RLGLMV GG++LASFMTYASEHLAIRSF +G+ED+D  RS S
Sbjct  469  PSLPCIFGITALFVRLGLMVVGGLILASFMTYASEHLAIRSFLKGLEDRDTTRSMS  524



>ref|XP_009384656.1| PREDICTED: LOW QUALITY PROTEIN: putative glucuronosyltransferase 
PGSIP6 [Musa acuminata subsp. malaccensis]
Length=544

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 5/167 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G MS+FVCF AA +S+GLS +++PRQ+MPWTGL+LMYEW+F  F L F  YL+ +  WG 
Sbjct  380  GAMSVFVCFMAAAVSLGLSFVLVPRQVMPWTGLLLMYEWSFLTFFLIFRCYLNFIHQWGN  439

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSC--CDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
               NQ  ++R   L  DS KG ++S   CD+ AW Y LGMA LAI+ PSLPCL GIT+LF
Sbjct  440  WTANQTNYNR---LDSDSGKGSQRSASGCDVVAWFYWLGMAVLAIVAPSLPCLLGITALF  496

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
             RLGLM+ GG VLA+F+T+ASEHLA+R+F +G ED+   RS S  F 
Sbjct  497  TRLGLMIGGGFVLAAFVTFASEHLAVRAFLKGYEDRPQPRSRSTCFL  543



>ref|XP_004495592.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Cicer 
arietinum]
Length=546

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 120/163 (74%), Gaps = 4/163 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ VCF AA +S+GL+++I+PRQ+ PWTGL+L YEW F +F + FG YL+L+ HWG+
Sbjct  377  GGVSVCVCFMAAVVSLGLTLVIVPRQVTPWTGLLLFYEWAFIIFFILFGGYLNLIYHWGR  436

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ----SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +  ++   S  +  + D   G R     S CD   W YGLGMAFLAI+ PSLPCLFGIT+
Sbjct  437  ITASRTSSSLSQPESSDDDSGKRHQRQISSCDAATWFYGLGMAFLAIIAPSLPCLFGITA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRS  152
            LF RLGLM+ G I+L SFMTYASEHLA+RSF +G+ ++DV R+
Sbjct  497  LFLRLGLMIVGSIILTSFMTYASEHLAMRSFLKGLGERDVARN  539



>gb|AIL52751.1| putative glucuronosyltransferase PGSIP6-like protein [Dendrobium 
catenatum]
Length=549

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S F CF AA LS+ LS +IIPRQ+ P TGL+L YEWTF  F + FGSYL LV +WG+
Sbjct  380  GPVSTFFCFTAALLSLALSFIIIPRQVTPRTGLLLTYEWTFVTFFVVFGSYLRLVYNWGR  439

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQSCCDMDAWN--YGLGMAFLAILTPSLPCLFGITS  281
            +  +QAG   S+  S  YDS KGH++   +  +    YG GMAFLA++ PSLP LFGI++
Sbjct  440  LVASQAGKAFSQMDSSNYDSGKGHQRPSSNWGSVTCFYGTGMAFLAVIVPSLPFLFGISA  499

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LFARLG+M+AGGI+L+ FMTYASEHLA+ +F +G ED+D+ R+ ++ FF
Sbjct  500  LFARLGVMIAGGILLSIFMTYASEHLALTAFVKGTEDRDLPRTRTICFF  548



>ref|XP_006833264.1| hypothetical protein AMTR_s01134p00004530 [Amborella trichopoda]
 gb|ERM98542.1| hypothetical protein AMTR_s01134p00004530 [Amborella trichopoda]
Length=484

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 115/156 (74%), Gaps = 8/156 (5%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ VCF AA  S+  +  IIPRQ+MPWTGL L+YEWTF LF++ FGSYLH++   G+
Sbjct  323  GGISVLVCFGAAIASLVAAFAIIPRQVMPWTGLSLLYEWTFALFIIIFGSYLHIIYECGR  382

Query  448  MAGNQ----AGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGI  287
             + NQ    +G   P    Y+S KGH++  SCCD   W YGLGM FLAI  PSLPCLFGI
Sbjct  383  SSSNQGTFSSGTESPSR--YNSGKGHQRQASCCDAVTWYYGLGMGFLAIAAPSLPCLFGI  440

Query  286  TSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRG  179
            T+LF+RLGLMV GG+VL +FMTYASE+L IR++ RG
Sbjct  441  TALFSRLGLMVGGGMVLVAFMTYASENLVIRAYMRG  476



>ref|XP_007143949.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
 gb|ESW15943.1| hypothetical protein PHAVU_007G116100g [Phaseolus vulgaris]
Length=551

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 126/182 (69%), Gaps = 5/182 (3%)
 Frame = -1

Query  679  LQPAVNKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTL  500
            + P +N   +    +L G +S+ VC  A+ +S+GL+ LI+PRQ+ PWTG +LMYEW FT+
Sbjct  368  IHPLINGAQSKVPPYL-GMISVCVCLLASVVSLGLAFLIVPRQVAPWTGFLLMYEWIFTI  426

Query  499  FLLSFGSYLHLVQHWGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMA  332
            F + FG YL+L+ HWGK+  +    S   P+S   DS KGH++  S CD   W YGLGMA
Sbjct  427  FFILFGGYLNLMYHWGKIRISHTPSSLTHPESSDEDSGKGHQRQMSSCDAATWFYGLGMA  486

Query  331  FLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRS  152
            FLAI  P LP +FGIT+LF RLGL V GG++L +FMTY+SEHLAIRSF +G E++DV  +
Sbjct  487  FLAIAAPCLPFIFGITALFLRLGLAVVGGVILVAFMTYSSEHLAIRSFLKGFEERDVALN  546

Query  151  TS  146
             S
Sbjct  547  AS  548



>ref|XP_003556480.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X1 [Glycine max]
 gb|KHN14713.1| Glycogenin-1 [Glycine soja]
Length=541

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 124/169 (73%), Gaps = 12/169 (7%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VC  AA +S+GL++LI+PRQ+ PWTGL+LMYEWTFT+F + FG YL+L+ H G+
Sbjct  374  GSISVCVCLLAAVVSLGLALLIVPRQVAPWTGLLLMYEWTFTIFFILFGGYLNLIYHRGR  433

Query  448  MAGNQAGHSRPKSLAY------DSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLF  293
            +  +Q     P SL++      DS K H++  S C+   W YGLGMAFLAI TPSLP LF
Sbjct  434  IMTSQT----PSSLSHHEYSDDDSGKVHQRQMSSCNAATWFYGLGMAFLAIATPSLPFLF  489

Query  292  GITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            GIT+LF RL LMV GG++L  F+TY+SEHLAIRSF +G+E++D  R+ +
Sbjct  490  GITALFLRLALMVVGGLILTCFLTYSSEHLAIRSFLKGLEERDASRNAN  538



>gb|KHN14829.1| Glycogenin-1 [Glycine soja]
Length=519

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 120/165 (73%), Gaps = 4/165 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+  C   A +S+GLSI I+PRQ+ PW GL+LMYEWTFT+F + FG YL+L+ H G+
Sbjct  352  GSISVCGCLLVAVVSLGLSIFIVPRQVAPWIGLLLMYEWTFTIFFILFGGYLNLIYHRGR  411

Query  448  MAGNQ--AGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
            +  +Q  +  S P+S   DS K H++  S CD   W YGLGMAFLAI TPSLP LFGIT+
Sbjct  412  IIASQMPSSLSHPESSDDDSEKVHQRQMSSCDAATWFYGLGMAFLAIATPSLPFLFGITA  471

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            LF RL LMV GG +LA F+TY+SE LAIRSF +G+E++DV R+ +
Sbjct  472  LFLRLALMVVGGAILACFLTYSSERLAIRSFLKGLEERDVARNAN  516



>ref|XP_006297372.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
 gb|EOA30270.1| hypothetical protein CARUB_v10013391mg [Capsella rubella]
Length=548

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 119/169 (70%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A   S+G+S +I+PRQIMPWTGL+L+YEWTFT+F L +G +L LV  +GK
Sbjct  379  GAVSVAVCFVAVLTSIGVSFMIVPRQIMPWTGLVLIYEWTFTIFFLLYGVFLLLVYQYGK  438

Query  448  MAGNQAGHSRPKSLAY--DSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   PK+ +   DS KGH++  + CD     YGLGMAFLA+   SLP L G+T+
Sbjct  439  KIAVQTGSLSPKTESSLDDSGKGHQREDASCDFTTCYYGLGMAFLAVAAISLPYLLGVTA  498

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASEHLAIR F +G+E++D  R+ S+ F 
Sbjct  499  LFLRLGLMIAVAMVLVSFMTYASEHLAIRWFLKGLENRDTTRTKSICFL  547



>gb|EEC77645.1| hypothetical protein OsI_16652 [Oryza sativa Indica Group]
 gb|EEE61342.1| hypothetical protein OsJ_15472 [Oryza sativa Japonica Group]
Length=544

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++  CF +A +S   +  IIP+QIMPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  377  GALTVLACFMSAGVSFAFAFAIIPKQIMPWTGLLLMFEWTFVSFFLLFGSYLRFVYRWGS  436

Query  448  MAGNQAGHSRPKSLAYDSAKG--HRQSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            +  N  GHSR  S       G  H  S CD+DA  Y  GMA +AI+T  LP L G+T+LF
Sbjct  437  LDANHVGHSRFDSSENHMVTGRHHNMSDCDIDATFYWTGMAIIAIVTVLLPTLLGVTALF  496

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FFY  131
            A+LGLMVAGG+VLASFMTYASEH+AI +F +G  D++V RS S+ F +
Sbjct  497  AKLGLMVAGGVVLASFMTYASEHIAISAFYKGQRDRNVSRSRSICFLF  544



>gb|ABR16625.1| unknown [Picea sitchensis]
Length=567

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +SIFV F +  +SVG++  ++PRQ+MPWTG++L YEW+F LF++ FG YL +V  WGK
Sbjct  399  GVLSIFVSFLSVAVSVGVAAFLVPRQVMPWTGIMLAYEWSFFLFMIIFGKYLDVVNAWGK  458

Query  448  --MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
               +G  AG S   S  YDS KGH++  S CD   +  G+GMA LAIL PSLP +FG+T+
Sbjct  459  SSASGTYAGGSSDSS-EYDSGKGHQRHTSSCDAATFYSGVGMAVLAILIPSLPFIFGVTA  517

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            LF RL LM+ GG+VL SFMTYASEHLAIRSF +G ED+++  ST
Sbjct  518  LFLRLALMIGGGLVLVSFMTYASEHLAIRSFLKGREDRNLLNST  561



>ref|XP_010485804.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF AA +S+G+S + +PRQIMPWTGLIL+YEWTFT+F L +GS+L LV  +GK
Sbjct  379  GAVSVAVCFVAALISIGVSFMFVPRQIMPWTGLILLYEWTFTIFFLLYGSFLLLVYQYGK  438

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH++  +  D     YGLGMAFLA+   SLP + G+T+
Sbjct  439  NIAVQTGSLASQTESSLDDSGKGHQRGDASFDFTTCYYGLGMAFLAVAAISLPYVLGVTA  498

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASEHLAIR F +G+E++D  R+ S+ F 
Sbjct  499  LFLRLGLMIAVAMVLVSFMTYASEHLAIRWFLKGLENRDTTRTKSICFL  547



>ref|XP_010463911.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 119/168 (71%), Gaps = 4/168 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF AA  S+G+S + +PRQIMPWTGLIL+YEWTFT+F L +GS+L LV  +GK
Sbjct  379  GAVSVAVCFVAALTSIGVSFMFVPRQIMPWTGLILIYEWTFTIFFLLYGSFLLLVYQYGK  438

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH++  +  D     YGLGMAFLA+   SLP + G+T+
Sbjct  439  NIAVQTGSLSSQTESSLDDSGKGHQRGDASFDFTTCYYGLGMAFLAVAAISLPYILGVTA  498

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
            LF RLGLM+A  +VL SFMTYASEHLAIR F +G+E++D  R+ S+ F
Sbjct  499  LFLRLGLMIAVAMVLVSFMTYASEHLAIRWFLKGLENRDTTRTKSICF  546



>ref|XP_010104622.1| hypothetical protein L484_021999 [Morus notabilis]
 gb|EXC01428.1| hypothetical protein L484_021999 [Morus notabilis]
Length=683

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 116/175 (66%), Gaps = 5/175 (3%)
 Frame = -1

Query  664  NKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSF  485
            N     K  F  GG+S+   F AA  ++ L++ I+PRQ+ PWTGL+LM+EW FT+F L F
Sbjct  359  NPNHQAKVPFYIGGVSVIFSFMAALAALSLALAIVPRQVTPWTGLLLMFEWAFTIFFLLF  418

Query  484  GSYLHLVQHWGKMAGNQAGHS---RPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAI  320
            G YLHL+  WGK    Q+G       +SL YDS KGH++  S CD+  W Y LGMAFLA+
Sbjct  419  GGYLHLIYKWGKATSVQSGSPASRNSESLEYDSGKGHQRLASSCDISPWYYWLGMAFLAL  478

Query  319  LTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQR  155
              P LPC  G  +L +R GLM+ G I+ ASFMT+AS+HLAIRSF RG+ED+D  R
Sbjct  479  AAPILPCFLGFNTLLSRFGLMITGVIIFASFMTFASDHLAIRSFLRGLEDRDHTR  533



>ref|XP_010104620.1| hypothetical protein L484_021997 [Morus notabilis]
 gb|EXC01426.1| hypothetical protein L484_021997 [Morus notabilis]
Length=541

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 118/182 (65%), Gaps = 5/182 (3%)
 Frame = -1

Query  664  NKRCAIKGAFLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSF  485
            N     K  F  GG+S+   F AA  ++ L++ I+PRQ+ PWTGL+LM+EW FT+F L F
Sbjct  359  NPNHQAKVPFYIGGVSVIFSFMAALAALSLALAIVPRQVTPWTGLLLMFEWAFTIFFLLF  418

Query  484  GSYLHLVQHWGKMAGNQAGHS---RPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAI  320
            G YLHL+  WGK    Q+G       +SL YDS KGH++  S CD+  W Y LGMAFLA+
Sbjct  419  GGYLHLIYKWGKATSVQSGSPASRNSESLEYDSGKGHQRLASSCDISPWYYWLGMAFLAL  478

Query  319  LTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*  140
              P LPC  G  +L +R   M+ G I+ ASFMT+AS+HLAIRSF RG+ED+D  RS +  
Sbjct  479  AAPILPCFLGFNTLLSRFASMITGVIIFASFMTFASDHLAIRSFLRGLEDRDHTRSKNRC  538

Query  139  FF  134
            FF
Sbjct  539  FF  540



>ref|XP_010413938.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=548

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = -1

Query  625  GMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKM  446
             +S+ VCF AA  S+G+S + +PRQIMPWTGLIL+YEWTFT+F L +GS+L LV  +GK 
Sbjct  380  AVSVAVCFVAALTSIGVSFMFVPRQIMPWTGLILIYEWTFTIFFLFYGSFLLLVYQYGKN  439

Query  445  AGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
               Q G   S+ +S   DS KGH++  +  D     YGLGMAFLA+   SLP + G+T+L
Sbjct  440  IAVQTGSFSSQTESSLDDSGKGHQRGDASFDFTTCYYGLGMAFLAVAAISLPYILGVTAL  499

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            F RLGLM+A  +VL SFMTYASEHLAIR F +G+E++D  R+ S+ F 
Sbjct  500  FLRLGLMIAVAMVLVSFMTYASEHLAIRWFLKGLENRDTTRTKSICFL  547



>ref|XP_006408197.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
 gb|ESQ49650.1| hypothetical protein EUTSA_v10020458mg [Eutrema salsugineum]
Length=545

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 116/165 (70%), Gaps = 4/165 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A   S+G+S +I+PRQIMPWTGLIL+YEWTFT+F+L +G +L LV  +GK
Sbjct  376  GAVSVVVCFVAILTSIGVSFVIVPRQIMPWTGLILIYEWTFTIFILLYGGFLLLVYQYGK  435

Query  448  MAGNQAG--HSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH+++   CD      GLGMAFLA    SLP + G+T+
Sbjct  436  KIAFQTGSLSSQTESSLDDSGKGHQRTDASCDFTTCYCGLGMAFLAFAAISLPYVLGVTA  495

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
            LF RLGLM+A  IV+ SFMTYASEHLAIR F +G+ED++  R+ S
Sbjct  496  LFLRLGLMIAVAIVIVSFMTYASEHLAIRWFLKGLEDRETTRTKS  540



>ref|XP_002446789.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
 gb|EES11117.1| hypothetical protein SORBIDRAFT_06g022680 [Sorghum bicolor]
Length=536

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 2/166 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A  S+  + +IIPRQ+MPWTGL+LM EWTF  F L FGSYL  V  WG 
Sbjct  371  GVIAVLVCFMSAGFSLAFAFIIIPRQVMPWTGLLLMLEWTFVAFFLLFGSYLRFVYRWGS  430

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            ++ N  G S   +       GH++  S CDMDA  Y +GMA +A +T  LP + GIT+LF
Sbjct  431  ISANHVGFSNSDASENHMGPGHQRNMSDCDMDATFYWIGMATIATITVLLPTILGITALF  490

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
             +LGLMVAGGIVLASFMTYA+EHLAI +F +G +D++  R+ S  F
Sbjct  491  TKLGLMVAGGIVLASFMTYAAEHLAISAFNKGQKDRNASRTRSFCF  536



>emb|CDY21129.1| BnaA01g33600D [Brassica napus]
Length=546

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCFAA   S+G+S++I+PRQIMPWTGLIL+YEWTFT+F L +G +L LV  +GK
Sbjct  377  GAVSVVVCFAAVLTSIGVSVMIVPRQIMPWTGLILIYEWTFTIFFLLYGGFLLLVYQYGK  436

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH+++   CD  A  YGLGM FLA    SLP + G+T+
Sbjct  437  KVAVQTGSPSSQTESSLDDSGKGHQRADASCDFTALYYGLGMVFLAFAAISLPYMLGVTA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASEHLA+R F +G+ED+D  R+ S+ F 
Sbjct  497  LFLRLGLMIAVAMVLVSFMTYASEHLAVRWFLKGLEDRDTTRTKSICFL  545



>ref|XP_006400396.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
 gb|ESQ41849.1| hypothetical protein EUTSA_v10013196mg [Eutrema salsugineum]
Length=540

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 109/156 (70%), Gaps = 6/156 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +SVG+S +I+PRQIMPWTGLIL+YEWTFT+F   FG +L LV   GK
Sbjct  378  GAVSVVVCFTAVLISVGISFVIVPRQIMPWTGLILVYEWTFTIFFSLFGCFLLLVHQHGK  437

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q   S       DS+KGH++    CD+    YGLGMAFLAI   SLP + GIT+LF
Sbjct  438  KVAIQTESSSLD----DSSKGHQRGGVSCDVTTLYYGLGMAFLAIAAVSLPYILGITALF  493

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDK  167
             RLGLMV   I+LA+FMTYASEHLAIR F +G+ED+
Sbjct  494  LRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDR  529



>gb|EEC73629.1| hypothetical protein OsI_08135 [Oryza sativa Indica Group]
Length=547

 Score =   171 bits (432),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 111/162 (69%), Gaps = 2/162 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A +S+  + +IIPRQ+MPWTGL+LMYEWT   F L FGSYL +V +WG 
Sbjct  381  GAITVLVCFISALISLAFAFIIIPRQVMPWTGLLLMYEWTSVTFFLLFGSYLRVVYNWGS  440

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
             + N  GH+   S    +  GH++  S CD DA  Y  GMA L+ +    P + GIT+LF
Sbjct  441  SSANHVGHNNLDSSENHAGAGHQRNTSDCDTDAAFYWSGMAILSSIALLSPTVLGITALF  500

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            A+LGLMVAGG+VLASFMTYASEHLAI +F +G  D++  R +
Sbjct  501  AKLGLMVAGGVVLASFMTYASEHLAISAFVKGQRDRNASRGS  542



>ref|XP_009125000.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=546

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 119/169 (70%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCFAA   S+G+S +I+PRQIMPWTGLIL+YEWTFT+F L +G +L LV  +GK
Sbjct  377  GAVSVVVCFAAVLTSIGVSFMIVPRQIMPWTGLILIYEWTFTIFFLLYGGFLLLVYQYGK  436

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH+++   CD  A  YGLGM FLA    SLP + G+T+
Sbjct  437  KVAVQTGSPSSQTESSLDDSGKGHQRADASCDFTALYYGLGMVFLAFAAISLPYMLGVTA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASEHLA+R F +G+ED+D  R+ S+ F 
Sbjct  497  LFLRLGLMIAVAMVLVSFMTYASEHLAVRWFLKGLEDRDTTRTKSICFL  545



>ref|XP_004976232.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Setaria 
italica]
Length=637

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 111/163 (68%), Gaps = 2/163 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A  S+  +  IIPRQ+MPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  472  GAIAVLVCFVSAGFSLAFAFAIIPRQVMPWTGLLLMFEWTFVSFFLLFGSYLRFVYRWGS  531

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            ++ N  G S   S       GH++  S CDMDA  Y +GMA +A +   LP + GIT+LF
Sbjct  532  ISANHVGFSNSDSSENHMGSGHQRNMSDCDMDATFYWIGMAAIATVAVLLPTILGITALF  591

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
             +LGLMVAGG+VLASFMTYA+EHLAI +F +G +D++  R+ S
Sbjct  592  TKLGLMVAGGVVLASFMTYAAEHLAISAFNKGQKDRNGSRTRS  634



>ref|XP_002873897.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50156.1| hypothetical protein ARALYDRAFT_488728 [Arabidopsis lyrata subsp. 
lyrata]
Length=538

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF A  LS+G+S  I+PRQIMPWTGL+L+YEWTFT+F L FG +L  V   GK
Sbjct  374  GAVAVVVCFTALLLSLGISFAIVPRQIMPWTGLVLVYEWTFTIFSLLFGCFLLFVHLHGK  433

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q+  S       DSAK H+++   CD+    YGLGMAFLAI   SLP + GIT+LF
Sbjct  434  KIAIQSESSSLD----DSAKVHQRAGVSCDVTTLYYGLGMAFLAIAAVSLPYILGITALF  489

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
             RLGLMV  GI+LA+FMTYASEHLA+R F +G+ED +D  RS S+ F 
Sbjct  490  TRLGLMVGVGIILAAFMTYASEHLAVRWFLKGLEDRRDTTRSNSLCFL  537



>ref|XP_010454088.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +S+G+S  I+PRQIMPWTGL+L+YEWTFT+F L FG +L  V   GK
Sbjct  371  GAISVVVCFTAVLISLGISFAIVPRQIMPWTGLVLVYEWTFTIFSLLFGCFLLFVHQHGK  430

Query  448  MAGNQAGHSRPKSLAYD-SAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                Q+     +SL+ D S KGH+++   CD+    YGLGMAFLAI   SLP + GIT+L
Sbjct  431  KIAIQS-----ESLSLDDSGKGHQRAGVSCDVTTLYYGLGMAFLAIAAVSLPYILGITAL  485

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
            F RLGLMV   I+LA+FMTYASEHLAIR F +G+ED +D  RS  + F 
Sbjct  486  FTRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDRRDTTRSNPLCFL  534



>ref|XP_006648850.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=524

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 2/161 (1%)
 Frame = -1

Query  625  GMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKM  446
             ++I  CF +A +S+  + +IIPRQ+MPWTGL+LMYEWTF +F L FGSYL +V +WG  
Sbjct  359  AITILTCFISALISLAFAFIIIPRQVMPWTGLLLMYEWTFVMFFLLFGSYLRVVYNWGSY  418

Query  445  AGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFA  272
              N  G++   S    ++ GH++  S CD DA  Y  GMA ++++    P + GIT+LFA
Sbjct  419  IANHVGYNNMDSSENHASAGHQRNTSDCDTDAAFYWSGMAIISVIALLSPTVLGITALFA  478

Query  271  RLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            +LG MVAGG+VLASFMTYASEHLAI +F +G  D++  R +
Sbjct  479  KLGFMVAGGVVLASFMTYASEHLAISAFVKGQRDRNASRGS  519



>ref|XP_010420611.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Camelina sativa]
Length=535

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 116/169 (69%), Gaps = 9/169 (5%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +S+G+S  I+PRQIMPWTGL+L+YEWTFT+F + FG +L  V   GK
Sbjct  371  GAISVVVCFTAVLISLGISFAIVPRQIMPWTGLVLLYEWTFTIFSVLFGCFLLFVHQHGK  430

Query  448  MAGNQAGHSRPKSLAYD-SAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                Q+     +SL  D S KGH+++   CD+    YGLGMAFLAI   SLP + GIT+L
Sbjct  431  KIAIQS-----ESLTLDDSGKGHQRAGVSCDVTTLYYGLGMAFLAIAAVSLPYILGITAL  485

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
            F RLGLMV   I+LA+FMTYASEHLAIR F +G+ED +D  RS  + F 
Sbjct  486  FTRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDRRDTTRSNPLCFL  534



>ref|XP_008661816.1| PREDICTED: uncharacterized protein LOC100279618 isoform X1 [Zea 
mays]
Length=523

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 110/166 (66%), Gaps = 2/166 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A  S+  +  IIPRQ+MPWTGL+LM EWTF  F L FGSYL  V  WG 
Sbjct  358  GAIAVLVCFVSAGFSLAFAFAIIPRQVMPWTGLLLMLEWTFVAFFLLFGSYLRFVYRWGS  417

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            ++ N  G S   S       GH++  S CDMDA  Y +GMA +A +T  LP + GIT+LF
Sbjct  418  ISANHVGFSNSDSSENHMGPGHQRNMSDCDMDATFYWIGMASIATITVLLPTILGITALF  477

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
             +LGLMVAGGIVLASFMTYA+EHLAI  F +G + ++  R+ S  F
Sbjct  478  TKLGLMVAGGIVLASFMTYAAEHLAISVFNKGQKYRNASRTRSFCF  523



>ref|NP_001146086.1| uncharacterized protein LOC100279618 precursor [Zea mays]
 gb|ACL53184.1| unknown [Zea mays]
 gb|ACN34651.1| unknown [Zea mays]
 gb|AFW58864.1| hypothetical protein ZEAMMB73_149865 [Zea mays]
Length=536

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 110/166 (66%), Gaps = 2/166 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A  S+  +  IIPRQ+MPWTGL+LM EWTF  F L FGSYL  V  WG 
Sbjct  371  GAIAVLVCFVSAGFSLAFAFAIIPRQVMPWTGLLLMLEWTFVAFFLLFGSYLRFVYRWGS  430

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            ++ N  G S   S       GH++  S CDMDA  Y +GMA +A +T  LP + GIT+LF
Sbjct  431  ISANHVGFSNSDSSENHMGPGHQRNMSDCDMDATFYWIGMASIATITVLLPTILGITALF  490

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
             +LGLMVAGGIVLASFMTYA+EHLAI  F +G + ++  R+ S  F
Sbjct  491  TKLGLMVAGGIVLASFMTYAAEHLAISVFNKGQKYRNASRTRSFCF  536



>ref|XP_010492852.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Camelina sativa]
Length=535

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 117/169 (69%), Gaps = 9/169 (5%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ V F A  +S+G+S  I+PRQIMPWTGL+L+YEWTFT+F L FG +L  V   GK
Sbjct  371  GAISVVVSFTAVLVSLGISFAIVPRQIMPWTGLVLVYEWTFTIFSLLFGCFLLFVHQHGK  430

Query  448  MAGNQAGHSRPKSLAYD-SAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
                Q+     +SL+ D SAKGH+++   CD+    YGLGMAFLA+   SLP + GIT+L
Sbjct  431  KIAVQS-----ESLSLDDSAKGHQRAGVSCDVTTLYYGLGMAFLAVAAVSLPYILGITAL  485

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
            F RLGLMV   I+LA+FMTYASEHLAIR F +G+ED +D  RS  + F 
Sbjct  486  FTRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDRRDTTRSNPLCFL  534



>gb|KFK26089.1| hypothetical protein AALP_AA8G201300 [Arabis alpina]
Length=539

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +S+G+S +I+PRQIMPWTGLIL+YEWTFT+FLL FG +L LV   GK
Sbjct  375  GAISVLVCFTAVLISIGISFMIVPRQIMPWTGLILVYEWTFTIFLLLFGFFLLLVHQHGK  434

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
              G Q   S   SL  DS+KGH++    CD+    YGLGM FLA+   SLP +FGIT+LF
Sbjct  435  KVGIQTESS---SLD-DSSKGHQRGGVSCDVTTLYYGLGMVFLAVAAVSLPYIFGITALF  490

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
             RLGLMV   I+LA+FMTYASEHLAIR F +G+ED +D  RS S+ F 
Sbjct  491  TRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDRRDTSRSKSMCFL  538



>ref|XP_010024933.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Eucalyptus 
grandis]
Length=538

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 8/161 (5%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+SI VCFAAA +S+ L++ ++PRQ+MPWTGL+LMYEWTF +F + F  YLHLV   G+
Sbjct  383  GGISIIVCFAAAAVSLLLALAVVPRQVMPWTGLLLMYEWTFAIFFVLFRGYLHLVYKLGR  442

Query  448  MAGNQA-GHSRPKSLAYDSAKG-HRQS-CCDMDAWNYGLGMAFLAILTPSLPCLFGITSL  278
             A  Q  GH     + Y+S KG  RQ+  CD+    Y  GMA LA++ P+LPC+FGIT+L
Sbjct  443  AAAVQTVGH-----VDYESGKGRQRQTPSCDIATCCYWSGMASLAMVAPALPCIFGITAL  497

Query  277  FARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQR  155
            FARLGLMV GG++LASFMTY+SEHLAI SF RG E++D+ R
Sbjct  498  FARLGLMVGGGLILASFMTYSSEHLAIISFMRGFEERDLSR  538



>ref|NP_001047475.1| Os02g0624400 [Oryza sativa Japonica Group]
 dbj|BAD23777.1| putative glycogenin 1 [Oryza sativa Japonica Group]
 dbj|BAF09389.1| Os02g0624400 [Oryza sativa Japonica Group]
 gb|EEE57402.1| hypothetical protein OsJ_07584 [Oryza sativa Japonica Group]
Length=547

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 108/162 (67%), Gaps = 2/162 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF +A +S+  + +IIPRQ+MPWTGL+LMYEWT   F L FGSYL +V +WG 
Sbjct  381  GAITVLVCFISALISLAFAFIIIPRQVMPWTGLLLMYEWTSVTFFLLFGSYLRVVYNWGS  440

Query  448  MAGNQAGHSRPKSLAYDSAKG--HRQSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
             + N  GH+   S    +  G     S CD DA  Y  GMA L+ +    P + GIT+LF
Sbjct  441  SSANHVGHNNLDSSENHAGAGLQRNTSDCDTDAAFYWSGMAILSSIALLSPTVLGITALF  500

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
            A+LGLMVAGG+VLASFMTYASEHLAI +F +G  D++  R +
Sbjct  501  AKLGLMVAGGVVLASFMTYASEHLAISAFVKGQRDRNASRGS  542



>ref|XP_006287478.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
 gb|EOA20376.1| hypothetical protein CARUB_v10000689mg [Capsella rubella]
Length=531

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 113/168 (67%), Gaps = 7/168 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VC  +  +S+G+S  I+PRQIMP TGLIL+YEWTFT+F L FG +L  V   GK
Sbjct  367  GAVSVVVCLTSVLISLGISFAIVPRQIMPGTGLILVYEWTFTIFCLLFGGFLVFVHQHGK  426

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q   S       DSAKGH+++   CD+  + YGLGMAFLAI   SLP + GIT+LF
Sbjct  427  KIAIQIESSSLD----DSAKGHQRAGVSCDVTTFYYGLGMAFLAIAAVSLPYILGITALF  482

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
             RLGLMV   I+LA+FMTYASEHLAIR F +G+ED +D  RS S  F 
Sbjct  483  TRLGLMVGVAIILAAFMTYASEHLAIRWFLKGLEDRRDTMRSNSFCFL  530



>ref|XP_006653601.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like [Oryza 
brachyantha]
Length=539

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 114/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++   F +A +S+  +  IIP+QIMPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  372  GAIAVLASFVSAGVSLAFAFTIIPQQIMPWTGLLLMFEWTFVSFFLLFGSYLRFVYRWGI  431

Query  448  MAGNQAGHSRPKSLAYD--SAKGHRQSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            +  N  G+SR  S      + + H  S CD+DA  Y + MA +AI+T   P L G+T+LF
Sbjct  432  LCANHVGYSRLDSSENHMITGRHHNTSECDIDATFYWIVMAIIAIVTVLSPTLLGVTALF  491

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FFY  131
            A+LGLMVAGG+VLASFMTY+SEHLAI +F +G  +++V R+ S+ F +
Sbjct  492  AKLGLMVAGGVVLASFMTYSSEHLAISAFYKGQRERNVSRTRSICFLF  539



>ref|XP_009126256.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=533

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 114/167 (68%), Gaps = 7/167 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +SVG S +I+PRQIMPWTGLIL+YEWTFT+F + FG +L LV   GK
Sbjct  369  GAVSVLVCFIALLISVGTSFVIVPRQIMPWTGLILVYEWTFTIFFVLFGCFLLLVHQHGK  428

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                 + H+   SL  DS KGH++    CD+    YGLGM FLAI   SLP + GIT+LF
Sbjct  429  ---KLSVHTESSSLD-DSRKGHQRGGVSCDITTLYYGLGMVFLAIAAVSLPYILGITALF  484

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDK-DVQRSTSV*F  137
             RLGLMV   I+LA+FMT+ASE LA R F RG+ED+ +  RS S+ F
Sbjct  485  LRLGLMVGVAIILAAFMTHASEQLAFRWFMRGLEDRGEASRSKSLCF  531



>emb|CDY29996.1| BnaC01g40120D [Brassica napus]
Length=546

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 117/169 (69%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A   S+G+S +I+PRQIMPWTGLIL+YEWTFT+F L +G +L LV  +GK
Sbjct  377  GAVSVVVCFMAVLTSIGVSFMIVPRQIMPWTGLILIYEWTFTIFFLLYGGFLLLVYQYGK  436

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q G   S+ +S   DS KGH+++   CD  A  YGLGM FLA    SLP + G+T+
Sbjct  437  KIAVQTGSPSSQTESSLDDSGKGHQRADASCDFTALYYGLGMVFLAFAAISLPYMLGVTA  496

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASE LA+R F +G+ED+D  R+ S+ F 
Sbjct  497  LFLRLGLMIAVAMVLVSFMTYASERLAVRWFLKGLEDRDTTRTKSICFL  545



>ref|XP_009131669.1| PREDICTED: putative glucuronosyltransferase PGSIP6 [Brassica 
rapa]
Length=539

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 118/167 (71%), Gaps = 7/167 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +SVG+S +I+PRQIMPWTGLIL+YEWTFT+F L FG +L LV   GK
Sbjct  375  GAVSVVVCFTAVLISVGVSFMIVPRQIMPWTGLILVYEWTFTIFFLLFGCFLLLVHQHGK  434

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                 A H+   SL  DS KGH++    CD+    YGLGM FLAI T SLP + GIT+LF
Sbjct  435  KI---AVHTESSSLD-DSGKGHQRGGVSCDVTTLYYGLGMVFLAIATVSLPYILGITALF  490

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*F  137
             RLGLMV   IVLA++MTYASEHLAIR F +G+ED ++  RS S+ F
Sbjct  491  VRLGLMVGVAIVLAAYMTYASEHLAIRWFLKGLEDRRETSRSKSICF  537



>ref|XP_003580141.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=544

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 111/164 (68%), Gaps = 2/164 (1%)
 Frame = -1

Query  619  SIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKMAG  440
            ++ V F +A +SV  +  IIPRQ+MPWTGL+LM+EWTF  F L FGSYL  V  WG ++ 
Sbjct  379  AVLVSFMSAGVSVAFAFTIIPRQVMPWTGLLLMFEWTFVAFFLLFGSYLRFVYRWGSISA  438

Query  439  NQAGHSRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFARL  266
            N AG++   S       GH+   S C+MD   Y  GMA +A +T   P + GIT+LFA+L
Sbjct  439  NHAGYNSSGSSENRMGTGHQLSMSDCNMDVTFYWTGMAVIATVTVFSPTVLGITALFAKL  498

Query  265  GLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            GLMVAGG+VLASFMTYASEHLA+ +F +G +D++  R+  + F+
Sbjct  499  GLMVAGGVVLASFMTYASEHLAVSAFYKGQKDRNTLRTRRICFW  542



>emb|CDX88935.1| BnaA03g07140D [Brassica napus]
Length=534

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +SVG+S LI+PRQIMPWTGLIL+YEWTFT+F L FG +L LV   GK
Sbjct  370  GAVSVVVCFTAVLISVGVSFLIVPRQIMPWTGLILVYEWTFTIFFLLFGCFLLLVHQHGK  429

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                 A H+   SL  DS KGH++    CD+    YGLGM FL+I   SLP + GIT+LF
Sbjct  430  KI---AVHTESSSLD-DSGKGHQRGGVSCDVTTLYYGLGMVFLSIAAVSLPYILGITALF  485

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*F  137
             RLGLMV   IVLA++MTYASEHLAIR F +G+ED ++  RS S+ F
Sbjct  486  VRLGLMVGVAIVLAAYMTYASEHLAIRWFLKGLEDRRETSRSKSICF  532



>gb|EMS55946.1| Glycogenin-1 [Triticum urartu]
Length=480

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF  A +S+  + L+IPRQ+MPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  319  GAIAVAVCFMCALISLAFAFLVIPRQVMPWTGLLLMFEWTFVTFFLLFGSYLRFVYKWGS  378

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSCCDMDAWN--YGLGMAFLAILTPSLPCLFGITSLF  275
             + NQAG+         +  GH+Q+  D D  +  Y +GMA ++ + P  P + GIT++F
Sbjct  379  FSANQAGYGSLDLSENHTGTGHQQNTSDCDTTSAFYWMGMATISTIAPLSPTVLGITAIF  438

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRG  179
            A+LGL+VAGG+VLASFMTYASEHLA+ +F +G
Sbjct  439  AKLGLIVAGGVVLASFMTYASEHLAMSAFVKG  470



>ref|XP_010235727.1| PREDICTED: LOW QUALITY PROTEIN: inositol phosphorylceramide glucuronosyltransferase 
1-like [Brachypodium distachyon]
Length=567

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 112/168 (67%), Gaps = 4/168 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF  A +++G + L+IPRQ+MPWTGL+LM+EWTF +F L FGS+L  V   G 
Sbjct  373  GPITVLVCFICALMALGSAFLVIPRQVMPWTGLLLMFEWTFVVFFLLFGSFLRFVYKRGN  432

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
             + N  GHS   S    +  GH++  S CD DA  Y  GMA ++ +    P + GIT++F
Sbjct  433  CSANHVGHSSLDSSENHAVTGHQRNTSDCDKDAAFYWTGMAVISTIALLSPTVLGITAIF  492

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVE--DKDVQRSTSV*F  137
            A+LGLMVAGG+VLASFMTYASEHLA+ +F RG    D++  R  S+ F
Sbjct  493  AKLGLMVAGGVVLASFMTYASEHLAMSAFVRGQRMVDRNAPRGRSIFF  540



>dbj|BAJ88570.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 112/167 (67%), Gaps = 2/167 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ +CF +A  S+  +  IIPRQI PWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  374  GAIAVLICFMSAGFSLAFAFAIIPRQIRPWTGLLLMFEWTFVAFFLLFGSYLRFVYRWGS  433

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSCC--DMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            ++    G+S   S     A GH+++    DM+A  Y  GMA +A++T   P + GIT+LF
Sbjct  434  ISATHVGYSNSDSSENRVATGHQRNISDFDMEATFYWTGMAVIAVVTVFSPTILGITALF  493

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            A+LGLMVAGG++LASFMTYAS HLAI +F +G +D++  R+  + F+
Sbjct  494  AKLGLMVAGGVLLASFMTYASVHLAISAFHKGQKDRNGSRTRRICFW  540



>gb|KFK37856.1| hypothetical protein AALP_AA3G038100 [Arabis alpina]
Length=545

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 4/169 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ +CF A   SVG+S +I+PRQI PWTGLIL++EWTFT+F L +G +L LV  +GK
Sbjct  376  GAISVVICFVAVLTSVGVSFMIVPRQITPWTGLILIFEWTFTIFFLLYGGFLLLVYQYGK  435

Query  448  MAGNQAGHSRPKSLAY--DSAKGHRQSCC--DMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                Q+G    ++ +   DS KGH+++    D     YGLGMAFLA+   SLP + G+T+
Sbjct  436  KIAVQSGSLSSQTESSSDDSGKGHQRADASYDFTTLYYGLGMAFLAVAAISLPYMLGVTA  495

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*FF  134
            LF RLGLM+A  +VL SFMTYASEHLA+R F +G+ED+D  R+ S+ F 
Sbjct  496  LFLRLGLMIAVALVLVSFMTYASEHLAVRWFLKGLEDRDTSRTKSICFL  544



>ref|NP_197349.2| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 sp|Q8GWB7.1|GUX6_ARATH RecName: Full=Inositol phosphorylceramide glucuronosyltransferase 
1; AltName: Full=Glycogenin-like protein 6; AltName: Full=Plant 
glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 dbj|BAC43531.1| unknown protein [Arabidopsis thaliana]
 gb|AED92569.1| plant glycogenin-like starch initiation protein 6 [Arabidopsis 
thaliana]
 gb|AHL38620.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=537

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  LS+G+S  I+PRQIMPWTGL+L+YEWTFT+F L FG +L  V   GK
Sbjct  373  GAVSVVVCFTAVLLSLGISFAIVPRQIMPWTGLVLVYEWTFTIFFLLFGVFLLFVHQHGK  432

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q   S   SL  DSAK H+++   CD+    YGLGMAFLAI   SLP + GIT+LF
Sbjct  433  RIAIQ---SESSSLD-DSAKVHQRAGGSCDVTTLYYGLGMAFLAIAAVSLPYILGITALF  488

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
             RLGLMV   I+LA+FMTYASEHLA+R F +G+ED +D  RS S+ F 
Sbjct  489  TRLGLMVGLAIILAAFMTYASEHLAVRWFLKGLEDRRDTTRSNSLCFL  536



>gb|EMT33175.1| hypothetical protein F775_16539 [Aegilops tauschii]
Length=713

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF  A +S+  + L+IPRQ+MPWTGL+LM+EWTF  F L FG YL  V  WG 
Sbjct  371  GAIAVVVCFICALISLAFAFLVIPRQVMPWTGLLLMFEWTFVTFFLLFGGYLRFVYKWGS  430

Query  448  MAGNQAGHSRPKSLAYDSAKGHR--QSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
             + N AG+    S    +  GH+   S CD  +  Y +GMA ++ + P  P + GIT++F
Sbjct  431  FSANHAGYGSLDSSENHTGTGHQGNTSDCDTASAFYWMGMATISTIAPLSPTVLGITAIF  490

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRG  179
            A+LGLMVAGG+VLASFMTYASEHLA+ +F +G
Sbjct  491  AKLGLMVAGGVVLASFMTYASEHLAVSAFVKG  522



>gb|AAL58891.1|AF462795_1 AT5g18480/F20L16_200 [Arabidopsis thaliana]
 gb|AAN28860.1| At5g18480/F20L16_200 [Arabidopsis thaliana]
Length=537

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  LS+ +S  I+PRQIMPWTGL+L+YEWTFT+F L FG +L  V   GK
Sbjct  373  GAVSVVVCFTAVLLSLEISFAIVPRQIMPWTGLVLVYEWTFTIFFLLFGVFLLFVHQHGK  432

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q+  S   SL  DSAK H+++   CD+    YGLGMAFLAI   SLP + GIT+LF
Sbjct  433  RIAIQSESS---SLD-DSAKVHQRAGGSCDVTTLYYGLGMAFLAIAAVSLPYILGITALF  488

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRSTSV*FF  134
             RLGLMV   I+LA+FMTYASEHLA+R F +G+ED +D  RS S+ F 
Sbjct  489  TRLGLMVGLAIILAAFMTYASEHLAVRWFLKGLEDRRDTTRSNSLCFL  536



>emb|CDY02625.1| BnaC02g08100D [Brassica napus]
Length=533

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 115/167 (69%), Gaps = 7/167 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF A  +SVG S +I+PRQIMPWTGLIL+YEWTFT+F L FG +L LV   GK
Sbjct  369  GAVAVLVCFIALLISVGTSFVIVPRQIMPWTGLILVYEWTFTIFFLLFGCFLLLVHQHGK  428

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                 + H+   SL  DS KGH++    CD+    YGLGM FLAI   SLP + GIT+LF
Sbjct  429  ---KLSVHTESSSLD-DSRKGHQRGGVSCDVTILYYGLGMVFLAIAAVSLPYILGITALF  484

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDK-DVQRSTSV*F  137
             RLGLMV   I+LA+FMTYASE LA+R F RG+ED+ +  RS S+ F
Sbjct  485  LRLGLMVGVAIILAAFMTYASEQLAVRWFMRGLEDRGEASRSKSLCF  531



>emb|CDX70822.1| BnaC03g09060D [Brassica napus]
Length=532

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 114/167 (68%), Gaps = 7/167 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VCF A  +SVG+S LI+PRQIMPWTGLIL+YEWTFT+F L FG +L LV   GK
Sbjct  368  GAVSVVVCFTALLISVGVSFLIVPRQIMPWTGLILVYEWTFTIFFLLFGCFLLLVHQHGK  427

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSCCDMDAWN--YGLGMAFLAILTPSLPCLFGITSLF  275
                 A ++   +L   S KGH++     D     YGLGM FLAI   SLP + GIT+LF
Sbjct  428  ---KMAVYTESSTLD-GSGKGHQRGGVSRDVTTLYYGLGMVFLAIAAVSLPYILGITALF  483

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDK-DVQRSTSV*F  137
             RLGLMV   IVLA++MTYASEHLAIR F +G+ED+ +  RS S+ F
Sbjct  484  VRLGLMVGVAIVLAAYMTYASEHLAIRWFLKGLEDRLETSRSKSICF  530



>dbj|BAK04525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=534

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++ VCF  A  S+  + L+IPRQ+MPWTGL+LM+EWTF  F L FG YL  V +WG 
Sbjct  380  GAIAVVVCFICALTSLAFAFLVIPRQVMPWTGLLLMFEWTFVTFFLLFGGYLRFVYNWGS  439

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
             + N AG+    S    +  GH++  S CD  +  Y  GMA ++ +    P + GIT++F
Sbjct  440  FSANHAGYGSLDSSENHTGTGHQRNMSDCDTASAFYWTGMAAISTIALLSPTVLGITAIF  499

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRG  179
            A+LGLMVAGG+VLASFMTYASEHLA+ +F +G
Sbjct  500  AKLGLMVAGGVVLASFMTYASEHLAMSAFVKG  531



>ref|XP_010558734.1| PREDICTED: inositol phosphorylceramide glucuronosyltransferase 
1 [Tarenaya hassleriana]
Length=549

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 4/154 (3%)
 Frame = -1

Query  586  SVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKMAGNQAGH--SRPK  413
            S+G S  I+PRQIMP TGL+L+YEWTFTLF L FG +L LV  +GK    Q G   S+ +
Sbjct  394  SIGFSFAIVPRQIMPLTGLVLLYEWTFTLFFLLFGGFLLLVHQYGKRIATQTGSLSSQTE  453

Query  412  SLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFARLGLMVAGGIV  239
            S   DS KGH+++   CD+  W YGLGM FLAI   SLP + GI++LF RLGLMVAG +V
Sbjct  454  SSLDDSGKGHQRAGQSCDVTTWYYGLGMVFLAIAAVSLPYILGISALFLRLGLMVAGAMV  513

Query  238  LASFMTYASEHLAIRSFTRGVEDKDVQRSTSV*F  137
            LASFMTY SEHLAIR F +G+ED+D  R+ ++ F
Sbjct  514  LASFMTYGSEHLAIRWFMKGLEDRDTTRTRAICF  547



>emb|CDY58112.1| BnaA02g35140D [Brassica napus]
Length=530

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 107/156 (69%), Gaps = 6/156 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+  CF +  +SVG S +I+PRQIMPWTGLIL+YEWTFT+F L FG +L LV   GK
Sbjct  366  GAVSVLFCFISLLISVGTSFVIVPRQIMPWTGLILVYEWTFTIFFLLFGCFLLLVHQHGK  425

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQS--CCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                Q   S   SL  DS KGH++    CD+    YGLGM FLAI   SLP + GIT+LF
Sbjct  426  KLSVQTESS---SLD-DSRKGHQRRGVSCDVTTLYYGLGMVFLAIAAVSLPYILGITALF  481

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDK  167
             RLGLMV   I+LA+FMT+ASE LA+R F RG+ED+
Sbjct  482  LRLGLMVGVAIILAAFMTHASEQLAVRWFMRGLEDR  517



>gb|EPS68223.1| hypothetical protein M569_06549, partial [Genlisea aurea]
Length=515

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ +  AAA +S+ +S  I+PRQ+MPWTGL+L+YEWTF +F L FG+YL  V+ WG 
Sbjct  354  GAVSVVISLAAALISLSVSFFIVPRQVMPWTGLLLVYEWTFFVFFLLFGTYLQSVRQWGG  413

Query  448  M---AGNQAGHSRPKSLAYDSAKGHRQ-SCCDMDAWNYGLGMAFLAILTPSLPCLFGITS  281
                +   +  SR +S  YDS KG RQ S CD     YG G+A LA   P LPC+ GIT+
Sbjct  414  TFVASPVSSSSSRSESSDYDSGKGSRQTSSCDASTCYYGFGLAILAFSIPILPCVLGITA  473

Query  280  LFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQR  155
            LFAR+G MV  G +  SF+TYA+E L+IR+F +G E+++ Q+
Sbjct  474  LFARVGSMVGLGFIFVSFLTYAAERLSIRAFVKGYEERESQQ  515



>gb|KJB44790.1| hypothetical protein B456_007G273500 [Gossypium raimondii]
Length=419

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 88/124 (71%), Gaps = 3/124 (2%)
 Frame = -1

Query  514  WTFTLFLLSFGSYLHLVQHWGKMAGNQAGHSRPKSLAY--DSAKGHRQ-SCCDMDAWNYG  344
            WTFT+F L FG++LHL+   G+    Q       +  +  D  K H Q S CD+ +W YG
Sbjct  290  WTFTIFFLLFGAFLHLIYQRGRRIVTQLTPVSADTDLFNSDPKKDHLQASSCDIVSWYYG  349

Query  343  LGMAFLAILTPSLPCLFGITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKD  164
            LGMAFL I+ PSLPC+FGIT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G ED+D
Sbjct  350  LGMAFLVIVAPSLPCIFGITALFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGCEDRD  409

Query  163  VQRS  152
              +S
Sbjct  410  TTQS  413



>ref|XP_006606473.1| PREDICTED: putative glucuronosyltransferase PGSIP6-like isoform 
X2 [Glycine max]
Length=517

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 102/163 (63%), Gaps = 24/163 (15%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +S+ VC  AA +S+GL++LI+PRQ+ PWTGL+LM   + T   LS   Y         
Sbjct  374  GSISVCVCLLAAVVSLGLALLIVPRQVAPWTGLLLMIMTSQTPSSLSHHEYSD-------  426

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                            DS K H++  S C+   W YGLGMAFLAI TPSLP LFGIT+LF
Sbjct  427  ---------------DDSGKVHQRQMSSCNAATWFYGLGMAFLAIATPSLPFLFGITALF  471

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRSTS  146
             RL LMV GG++L  F+TY+SEHLAIRSF +G+E++D  R+ +
Sbjct  472  LRLALMVVGGLILTCFLTYSSEHLAIRSFLKGLEERDASRNAN  514



>ref|XP_002971046.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
 gb|EFJ27644.1| hypothetical protein SELMODRAFT_62885, partial [Selaginella moellendorffii]
Length=473

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 11/153 (7%)
 Frame = -1

Query  622  MSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKMA  443
            +SI VCF  A LS G +  +IPRQ+MPWTG++L+YEWT  LF LSFG++L L+  WGK  
Sbjct  330  ISIVVCFVLALLSAGEAFHLIPRQVMPWTGMLLLYEWTIFLFSLSFGTFLGLLYDWGKST  389

Query  442  GNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFAR  269
                      S +    KGH +  S  DM+  +YG GMA L +L P LP L GIT++FAR
Sbjct  390  ---------SSSSSPPYKGHSKQASIWDMETTSYGFGMAALTLLVPCLPFLLGITAMFAR  440

Query  268  LGLMVAGGIVLASFMTYASEHLAIRSFTRGVED  170
            +G  V  G+VLA FMTY++++L +R F  G ED
Sbjct  441  VGTFVGAGMVLAVFMTYSAQNLGVRWFLLGRED  473



>ref|XP_002962043.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
 gb|EFJ37303.1| hypothetical protein SELMODRAFT_62883, partial [Selaginella moellendorffii]
Length=473

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 11/153 (7%)
 Frame = -1

Query  622  MSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGKMA  443
            +SI VCF  A LS G +  +IPRQ+MPWTG++L+YEWT  LF LSFG++L L+  WGK  
Sbjct  330  ISIVVCFVLALLSAGAAFHLIPRQVMPWTGMLLLYEWTIFLFSLSFGTFLGLLYDWGKST  389

Query  442  GNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLFAR  269
                      S +    KGH +  S  DM+  +YG GMA L +L P LP L GIT++FAR
Sbjct  390  ---------SSSSSPPYKGHSKQASIWDMETTSYGFGMAALTLLVPCLPFLLGITAMFAR  440

Query  268  LGLMVAGGIVLASFMTYASEHLAIRSFTRGVED  170
            +G  V  G+VLA FMTY++++L +R F  G ED
Sbjct  441  VGTFVGAGMVLAVFMTYSAQNLGVRWFLLGRED  473



>ref|XP_001759731.1| predicted protein [Physcomitrella patens]
 gb|EDQ75643.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 101/163 (62%), Gaps = 3/163 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G M+I  CF A F S+GL+  ++PRQ+MPWTGL+L YEWTF  FLL FG +L  +   G+
Sbjct  406  GMMAIVACFFALFASLGLAAFLVPRQVMPWTGLLLTYEWTFFTFLLLFGKFLDYIYSLGR  465

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSCC--DMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                ++     +   Y + K H ++    D +   YG+  A  A+L P+LP +FG T++F
Sbjct  466  NTAIKSLSIAEEISFYSAEKLHSKNSTYWDAETSTYGIVAALTALLIPTLPWIFGTTAIF  525

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED-KDVQRST  149
            AR GLMV+GG VLA   TY++E LA+  F RG +D   ++RS+
Sbjct  526  ARAGLMVSGGFVLAVVGTYSAEQLAVHWFLRGHDDCSHMERSS  568



>ref|XP_001784830.1| predicted protein [Physcomitrella patens]
 gb|EDQ50340.1| predicted protein [Physcomitrella patens]
Length=560

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 93/155 (60%), Gaps = 2/155 (1%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G  +I VCF   F S+GL+  +IPRQ+MPWTG +L YEWTF  FL+ F  YL  V  WG+
Sbjct  400  GISAIAVCFFTLFGSLGLAAFLIPRQVMPWTGFLLTYEWTFFTFLVVFAKYLDYVYSWGR  459

Query  448  MAGNQAGHSRPKSLAYDSAKGHRQSCC--DMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
                ++     +   Y + K H ++    D +   YG+  A +A+L P+LP +FG T++F
Sbjct  460  GTATKSLSVAEEISLYSTDKLHSKNSVSWDTETSTYGIVTALVALLIPALPRIFGTTAIF  519

Query  274  ARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVED  170
            AR GLMV+G  +LA   TY++E LA+  F +G  D
Sbjct  520  ARAGLMVSGVFLLAVVATYSAEKLAVHWFLKGQND  554



>gb|KHN43170.1| Glycogenin-1 [Glycine soja]
Length=1248

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 81/107 (76%), Gaps = 5/107 (5%)
 Frame = -1

Query  457   WGKMAGNQAGHS--RPKSLAYDSAKGHRQ--SCCDMDAWNYGLGMAFLAILTPSLPCLFG  290
             WGK+ G++   S  +P S  YDS K H++  S CD+  W YGLGMA LAI  PSLPCLFG
Sbjct  1137  WGKIVGSRVASSLSQPGS-DYDSEKRHQRQISSCDVATWYYGLGMALLAIAAPSLPCLFG  1195

Query  289   ITSLFARLGLMVAGGIVLASFMTYASEHLAIRSFTRGVEDKDVQRST  149
             IT+LF RLGLMV GGI+LASFMTYASEHLAIRSF +G ++++  R++
Sbjct  1196  ITALFLRLGLMVVGGIILASFMTYASEHLAIRSFLKGFDERENARNS  1242



>ref|NP_001053320.2| Os04g0517400 [Oryza sativa Japonica Group]
 dbj|BAF15234.2| Os04g0517400, partial [Oryza sativa Japonica Group]
Length=279

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 76/122 (62%), Gaps = 2/122 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++  CF +A +S   +  IIP+QIMPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  144  GALTVLACFMSAGVSFAFAFAIIPKQIMPWTGLLLMFEWTFVSFFLLFGSYLRFVYRWGS  203

Query  448  MAGNQAGHSRPKSLAYDSAKG--HRQSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            +  N  GHSR  S       G  H  S CD+DA  Y  GMA +AI+T  LP L G+T+LF
Sbjct  204  LDANHVGHSRFDSSENHMVTGRHHNMSDCDIDATFYWTGMAIIAIVTVLLPTLLGVTALF  263

Query  274  AR  269
            A+
Sbjct  264  AK  265



>emb|CAE05448.4| OSJNBa0073E02.8 [Oryza sativa Japonica Group]
Length=479

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 75/122 (61%), Gaps = 2/122 (2%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            G +++  CF +A +S   +  IIP+QIMPWTGL+LM+EWTF  F L FGSYL  V  WG 
Sbjct  356  GALTVLACFMSAGVSFAFAFAIIPKQIMPWTGLLLMFEWTFVSFFLLFGSYLRFVYRWGS  415

Query  448  MAGNQAGHSRPKSLAYDSAKG--HRQSCCDMDAWNYGLGMAFLAILTPSLPCLFGITSLF  275
            +  N  GHSR  S       G  H  S CD+DA  Y  GMA +AI+T  LP L G+T+LF
Sbjct  416  LDANHVGHSRFDSSENHMVTGRHHNMSDCDIDATFYWTGMAIIAIVTVLLPTLLGVTALF  475

Query  274  AR  269
            A 
Sbjct  476  AN  477



>gb|AFK39755.1| unknown [Lotus japonicus]
Length=535

 Score =   114 bits (286),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 75/101 (74%), Gaps = 4/101 (4%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+ VCF +A +S+GL++ I+PRQ+MPWTGL+LMYEWTFT+F++ FG YLHL+ HWG+
Sbjct  384  GGISVGVCFISAAVSLGLALSIVPRQVMPWTGLLLMYEWTFTIFVILFGGYLHLIYHWGR  443

Query  448  MAGNQAGH--SRPKSLAYDSAKGHRQ--SCCDMDAWNYGLG  338
            +  ++A    S P+S  YDS K H++  S CD+    YG G
Sbjct  444  VVASRAASSLSDPESSDYDSGKRHQRQMSSCDVTTLYYGFG  484


 Score = 33.9 bits (76),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = -3

Query  344  FRDGVSCHFNPVTSLSIWDHITICKVRVDGSGRHCSGIFHDV  219
            F DG+  +   + +LS W++  + KVR DG   H  GIFHD+
Sbjct  483  FGDGLVGYCCSIFALSFWNNCLVSKVRFDGCWGHDIGIFHDI  524



>gb|AAZ31066.1| putative glycogenin glucosyltransferase [Medicago sativa]
Length=151

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 69/95 (73%), Gaps = 3/95 (3%)
 Frame = -1

Query  628  GGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQHWGK  449
            GG+S+  C  AA +S+GL++LI+PRQ+MPWTGL+LMYEWTFT+F++  G YLHLV  WGK
Sbjct  56   GGISVCFCLTAAVVSLGLALLIVPRQVMPWTGLLLMYEWTFTMFIVLSGGYLHLVYRWGK  115

Query  448  -MAGNQAGHSRPKSLAYDSAKGHRQ--SCCDMDAW  353
             +A   A  S P+SL YDS K H++  S CD   W
Sbjct  116  HVASRAASSSLPESLDYDSGKRHQRQISSCDAATW  150



>ref|XP_002954821.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
 gb|EFJ44020.1| hypothetical protein VOLCADRAFT_106550 [Volvox carteri f. nagariensis]
Length=599

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 63/141 (45%), Gaps = 23/141 (16%)
 Frame = -1

Query  637  FLSGGMSIFVCFAAAFLSVGLSILIIPRQIMPWTGLILMYEWTFTLFLLSFGSYLHLVQH  458
            F++G  S+   +    ++V  +ILI+P ++ P  G IL YEW F L  L++GSYL     
Sbjct  446  FMAG--SLAAGYGCVLVAVITTILIVPSEVEPVYGWILSYEWGFMLLGLTYGSYLRTCYR  503

Query  457  WGKMAGNQAGHSRPKSLAYDSAKGHRQSCCDMDAWNYGLGMAFLAI---LTPSLPCLFGI  287
            WG+ AG+ A    PK            S   +         AFL +   L P L  L GI
Sbjct  504  WGRRAGHIAALQVPK----------LHSAPPLPLLETAASAAFLVVSLLLAPWLGELLGI  553

Query  286  TSLFARLGLMVAGGIVLASFM  224
            TS         AG IV   F+
Sbjct  554  TSF--------AGTIVATVFI  566



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160