BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013L04

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004232315.1|  PREDICTED: cysteine-rich receptor-like prote...    228   3e-66   Solanum lycopersicum
ref|XP_006338584.1|  PREDICTED: cysteine-rich receptor-like prote...    223   2e-64   
ref|XP_009602876.1|  PREDICTED: cysteine-rich receptor-like prote...    219   5e-63   Nicotiana tomentosiformis
ref|XP_009797283.1|  PREDICTED: cysteine-rich receptor-like prote...    219   6e-63   Nicotiana sylvestris
ref|XP_010108803.1|  Cysteine-rich receptor-like protein kinase 42      206   3e-58   Morus notabilis
gb|EYU44774.1|  hypothetical protein MIMGU_mgv1a002463mg                206   6e-58   Erythranthe guttata [common monkey flower]
ref|XP_011098445.1|  PREDICTED: cysteine-rich receptor-like prote...    205   6e-58   Sesamum indicum [beniseed]
emb|CDP02086.1|  unnamed protein product                                202   6e-57   Coffea canephora [robusta coffee]
gb|KHN45751.1|  Cysteine-rich receptor-like protein kinase 42           196   1e-54   Glycine soja [wild soybean]
ref|XP_003555067.1|  PREDICTED: cysteine-rich receptor-like prote...    196   3e-54   Glycine max [soybeans]
ref|XP_002300041.2|  hypothetical protein POPTR_0001s35060g             194   9e-54   
gb|KDP45316.1|  hypothetical protein JCGZ_09565                         193   2e-53   Jatropha curcas
ref|XP_011047329.1|  PREDICTED: cysteine-rich receptor-like prote...    192   3e-53   Populus euphratica
ref|XP_007140970.1|  hypothetical protein PHAVU_008G156400g             192   3e-53   Phaseolus vulgaris [French bean]
ref|XP_002524667.1|  kinase, putative                                   191   4e-53   
ref|XP_007031540.1|  Cysteine-rich RLK 42                               192   5e-53   
ref|XP_002273718.1|  PREDICTED: cysteine-rich receptor-like prote...    191   1e-52   Vitis vinifera
emb|CAN69244.1|  hypothetical protein VITISV_038880                     190   2e-52   Vitis vinifera
gb|KHN27450.1|  Cysteine-rich receptor-like protein kinase 42           188   1e-51   Glycine soja [wild soybean]
gb|KDO55201.1|  hypothetical protein CISIN_1g007248mg                   187   2e-51   Citrus sinensis [apfelsine]
ref|XP_006446554.1|  hypothetical protein CICLE_v10014520mg             187   2e-51   Citrus clementina [clementine]
emb|CBI34889.3|  unnamed protein product                                191   2e-51   Vitis vinifera
ref|XP_006470280.1|  PREDICTED: cysteine-rich receptor-like prote...    187   3e-51   Citrus sinensis [apfelsine]
ref|XP_006579769.1|  PREDICTED: cysteine-rich receptor-like prote...    187   4e-51   Glycine max [soybeans]
ref|XP_006477547.1|  PREDICTED: cysteine-rich receptor-like prote...    186   5e-51   Citrus sinensis [apfelsine]
gb|KDO69587.1|  hypothetical protein CISIN_1g042149mg                   186   5e-51   Citrus sinensis [apfelsine]
emb|CAN61087.1|  hypothetical protein VITISV_034611                     186   5e-51   Vitis vinifera
emb|CBI15002.3|  unnamed protein product                                186   5e-51   Vitis vinifera
ref|XP_010663147.1|  PREDICTED: cysteine-rich receptor-like prote...    186   6e-51   Vitis vinifera
ref|XP_006439855.1|  hypothetical protein CICLE_v10023699mg             184   9e-51   
ref|XP_010101899.1|  Cysteine-rich receptor-like protein kinase 42      186   1e-50   Morus notabilis
gb|KHN23515.1|  Cysteine-rich receptor-like protein kinase 42           184   1e-50   Glycine soja [wild soybean]
gb|KCW52910.1|  hypothetical protein EUGRSUZ_J02225                     185   2e-50   Eucalyptus grandis [rose gum]
gb|KCW83353.1|  hypothetical protein EUGRSUZ_B00288                     184   3e-50   Eucalyptus grandis [rose gum]
ref|XP_010033300.1|  PREDICTED: cysteine-rich receptor-like prote...    184   3e-50   Eucalyptus grandis [rose gum]
ref|XP_006338204.1|  PREDICTED: cysteine-rich receptor-like prote...    184   4e-50   Solanum tuberosum [potatoes]
ref|XP_003554810.1|  PREDICTED: cysteine-rich receptor-like prote...    184   5e-50   Glycine max [soybeans]
gb|KCW83326.1|  hypothetical protein EUGRSUZ_B00254                     183   5e-50   Eucalyptus grandis [rose gum]
ref|XP_010027455.1|  PREDICTED: cysteine-rich receptor-like prote...    183   6e-50   Eucalyptus grandis [rose gum]
gb|KJB70905.1|  hypothetical protein B456_011G095200                    183   6e-50   Gossypium raimondii
ref|XP_010027454.1|  PREDICTED: cysteine-rich receptor-like prote...    183   7e-50   Eucalyptus grandis [rose gum]
ref|XP_007151008.1|  hypothetical protein PHAVU_004G011000g             183   7e-50   Phaseolus vulgaris [French bean]
gb|KDP26626.1|  hypothetical protein JCGZ_17784                         183   9e-50   Jatropha curcas
ref|XP_009759879.1|  PREDICTED: cysteine-rich receptor-like prote...    182   1e-49   Nicotiana sylvestris
gb|KCW83357.1|  hypothetical protein EUGRSUZ_B00292                     182   1e-49   Eucalyptus grandis [rose gum]
ref|NP_001238666.1|  protein kinase family protein                      178   1e-49   
gb|KCW83330.1|  hypothetical protein EUGRSUZ_B00258                     176   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010041377.1|  PREDICTED: cysteine-rich receptor-like prote...    181   2e-49   
ref|XP_010027527.1|  PREDICTED: cysteine-rich receptor-like prote...    182   2e-49   Eucalyptus grandis [rose gum]
ref|XP_006356404.1|  PREDICTED: cysteine-rich receptor-like prote...    181   3e-49   Solanum tuberosum [potatoes]
ref|XP_010100421.1|  Cysteine-rich receptor-like protein kinase 3       181   3e-49   Morus notabilis
gb|KHG04179.1|  Cysteine-rich receptor-like protein kinase 42           180   7e-49   Gossypium arboreum [tree cotton]
ref|XP_010027508.1|  PREDICTED: cysteine-rich receptor-like prote...    180   8e-49   Eucalyptus grandis [rose gum]
gb|KEH22098.1|  cysteine-rich receptor-kinase-like protein              180   8e-49   Medicago truncatula
ref|XP_010249418.1|  PREDICTED: cysteine-rich receptor-like prote...    180   9e-49   
emb|CDP01560.1|  unnamed protein product                                179   1e-48   Coffea canephora [robusta coffee]
gb|KCW83327.1|  hypothetical protein EUGRSUZ_B00255                     179   1e-48   Eucalyptus grandis [rose gum]
ref|XP_010027449.1|  PREDICTED: cysteine-rich receptor-like prote...    179   2e-48   Eucalyptus grandis [rose gum]
gb|KCW45209.1|  hypothetical protein EUGRSUZ_L01156                     171   2e-48   Eucalyptus grandis [rose gum]
ref|XP_002511372.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    179   2e-48   
ref|XP_009616732.1|  PREDICTED: cysteine-rich receptor-like prote...    179   2e-48   Nicotiana tomentosiformis
ref|XP_010027537.1|  PREDICTED: cysteine-rich receptor-like prote...    179   2e-48   Eucalyptus grandis [rose gum]
ref|XP_006584463.1|  PREDICTED: protein kinase family protein iso...    177   3e-48   Glycine max [soybeans]
ref|XP_010042287.1|  PREDICTED: cysteine-rich receptor-like prote...    178   4e-48   Eucalyptus grandis [rose gum]
ref|XP_002318677.2|  hypothetical protein POPTR_0012s08890g             177   5e-48   
ref|XP_004300929.1|  PREDICTED: cysteine-rich receptor-like prote...    178   5e-48   Fragaria vesca subsp. vesca
ref|XP_010045529.1|  PREDICTED: cysteine-rich receptor-like prote...    177   5e-48   Eucalyptus grandis [rose gum]
ref|XP_007153758.1|  hypothetical protein PHAVU_003G062700g             177   7e-48   Phaseolus vulgaris [French bean]
gb|KHN42529.1|  Cysteine-rich receptor-like protein kinase 3            177   8e-48   Glycine soja [wild soybean]
ref|XP_009362983.1|  PREDICTED: cysteine-rich receptor-like prote...    177   8e-48   
gb|KJB11529.1|  hypothetical protein B456_001G263700                    177   9e-48   Gossypium raimondii
ref|XP_006841048.1|  hypothetical protein AMTR_s00085p00155370          177   9e-48   
ref|XP_004141193.1|  PREDICTED: cysteine-rich receptor-like prote...    177   1e-47   
emb|CAN64525.1|  hypothetical protein VITISV_005912                     177   1e-47   Vitis vinifera
ref|XP_006584462.1|  PREDICTED: protein kinase family protein iso...    177   1e-47   Glycine max [soybeans]
ref|XP_010251164.1|  PREDICTED: cysteine-rich receptor-like prote...    176   2e-47   Nelumbo nucifera [Indian lotus]
ref|XP_009377193.1|  PREDICTED: cysteine-rich receptor-like prote...    176   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_010045537.1|  PREDICTED: cysteine-rich receptor-like prote...    176   2e-47   
ref|XP_004238643.1|  PREDICTED: cysteine-rich receptor-like prote...    176   2e-47   Solanum lycopersicum
gb|KCW83338.1|  hypothetical protein EUGRSUZ_B00270                     176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_007211016.1|  hypothetical protein PRUPE_ppa020522mg             176   3e-47   
ref|XP_006841049.1|  hypothetical protein AMTR_s00085p00156760          175   4e-47   Amborella trichopoda
ref|XP_008245018.1|  PREDICTED: cysteine-rich receptor-like prote...    175   5e-47   Prunus mume [ume]
ref|XP_002266015.1|  PREDICTED: cysteine-rich receptor-like prote...    175   5e-47   Vitis vinifera
gb|KHG06976.1|  Cysteine-rich receptor-like protein kinase 42           174   5e-47   Gossypium arboreum [tree cotton]
ref|XP_008390081.1|  PREDICTED: cysteine-rich receptor-like prote...    171   6e-47   
ref|XP_003552033.1|  PREDICTED: cysteine-rich receptor-like prote...    174   8e-47   Glycine max [soybeans]
gb|KCW83328.1|  hypothetical protein EUGRSUZ_B00256                     169   1e-46   Eucalyptus grandis [rose gum]
ref|XP_010045536.1|  PREDICTED: cysteine-rich receptor-like prote...    169   1e-46   Eucalyptus grandis [rose gum]
gb|KCW45358.1|  hypothetical protein EUGRSUZ_L00960                     174   2e-46   Eucalyptus grandis [rose gum]
ref|XP_010040445.1|  PREDICTED: cysteine-rich receptor-like prote...    173   2e-46   
gb|KCW45208.1|  hypothetical protein EUGRSUZ_L01155                     173   2e-46   Eucalyptus grandis [rose gum]
gb|KCW83341.1|  hypothetical protein EUGRSUZ_B00274                     173   2e-46   Eucalyptus grandis [rose gum]
ref|XP_007036266.1|  Cysteine-rich RLK 42, putative                     173   3e-46   
ref|XP_002527897.1|  kinase, putative                                   172   3e-46   Ricinus communis
gb|KJB37078.1|  hypothetical protein B456_006G188600                    172   4e-46   Gossypium raimondii
ref|XP_010251163.1|  PREDICTED: cysteine-rich receptor-like prote...    172   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010045527.1|  PREDICTED: cysteine-rich receptor-like prote...    172   5e-46   Eucalyptus grandis [rose gum]
ref|XP_008341436.1|  PREDICTED: cysteine-rich receptor-like prote...    172   5e-46   
ref|XP_010040447.1|  PREDICTED: cysteine-rich receptor-like prote...    165   5e-46   
ref|XP_008443549.1|  PREDICTED: cysteine-rich receptor-like prote...    172   6e-46   Cucumis melo [Oriental melon]
ref|XP_010045539.1|  PREDICTED: cysteine-rich receptor-like prote...    167   6e-46   Eucalyptus grandis [rose gum]
ref|XP_011040494.1|  PREDICTED: cysteine-rich receptor-like prote...    171   1e-45   Populus euphratica
gb|KCW83337.1|  hypothetical protein EUGRSUZ_B00269                     170   1e-45   Eucalyptus grandis [rose gum]
gb|KJB39164.1|  hypothetical protein B456_007G001400                    166   1e-45   Gossypium raimondii
ref|XP_010045541.1|  PREDICTED: cysteine-rich receptor-like prote...    171   2e-45   
emb|CDY47146.1|  BnaA08g05370D                                          171   2e-45   Brassica napus [oilseed rape]
ref|XP_008393012.1|  PREDICTED: cysteine-rich receptor-like prote...    171   2e-45   
ref|XP_008230569.1|  PREDICTED: cysteine-rich receptor-like prote...    171   2e-45   Prunus mume [ume]
ref|XP_008389699.1|  PREDICTED: cysteine-rich receptor-like prote...    171   2e-45   
gb|KCW83344.1|  hypothetical protein EUGRSUZ_B00278                     170   2e-45   Eucalyptus grandis [rose gum]
ref|XP_009105722.1|  PREDICTED: cysteine-rich receptor-like prote...    170   2e-45   Brassica rapa
ref|NP_198854.3|  cysteine-rich receptor-like protein kinase 42         170   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31073.1|  hypothetical protein JCGZ_11449                         170   3e-45   Jatropha curcas
ref|XP_010045540.1|  PREDICTED: cysteine-rich receptor-like prote...    170   3e-45   
ref|XP_009392180.1|  PREDICTED: cysteine-rich receptor-like prote...    170   4e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215016.1|  hypothetical protein PRUPE_ppa002530mg             170   4e-45   Prunus persica
gb|KCW83332.1|  hypothetical protein EUGRSUZ_B00260                     169   5e-45   Eucalyptus grandis [rose gum]
gb|KCW83334.1|  hypothetical protein EUGRSUZ_B00264                     169   5e-45   Eucalyptus grandis [rose gum]
ref|XP_008221860.1|  PREDICTED: cysteine-rich receptor-like prote...    169   7e-45   Prunus mume [ume]
gb|KCW83333.1|  hypothetical protein EUGRSUZ_B00261                     169   7e-45   Eucalyptus grandis [rose gum]
gb|KJB39165.1|  hypothetical protein B456_007G001400                    166   8e-45   Gossypium raimondii
ref|XP_007222003.1|  hypothetical protein PRUPE_ppa002895mg             169   8e-45   
ref|XP_008221861.1|  PREDICTED: cysteine-rich receptor-like prote...    169   8e-45   Prunus mume [ume]
ref|XP_010045542.1|  PREDICTED: cysteine-rich receptor-like prote...    169   9e-45   
ref|XP_010044592.1|  PREDICTED: cysteine-rich receptor-like prote...    169   1e-44   Eucalyptus grandis [rose gum]
ref|XP_010471049.1|  PREDICTED: cysteine-rich receptor-like prote...    169   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010045441.1|  PREDICTED: cysteine-rich receptor-like prote...    168   2e-44   
ref|XP_010040446.1|  PREDICTED: cysteine-rich receptor-like prote...    169   2e-44   Eucalyptus grandis [rose gum]
gb|KCW83335.1|  hypothetical protein EUGRSUZ_B00265                     167   2e-44   Eucalyptus grandis [rose gum]
ref|XP_011045283.1|  PREDICTED: cysteine-rich receptor-like prote...    167   3e-44   Populus euphratica
ref|XP_010041375.1|  PREDICTED: cysteine-rich receptor-like prote...    157   3e-44   Eucalyptus grandis [rose gum]
ref|XP_011045282.1|  PREDICTED: cysteine-rich receptor-like prote...    167   4e-44   Populus euphratica
gb|KHG30441.1|  Cysteine-rich receptor-like protein kinase 1            167   4e-44   Gossypium arboreum [tree cotton]
ref|XP_002870713.1|  predicted protein                                  167   5e-44   Arabidopsis lyrata subsp. lyrata
gb|KCW83342.1|  hypothetical protein EUGRSUZ_B00275                     166   5e-44   Eucalyptus grandis [rose gum]
ref|XP_010552664.1|  PREDICTED: cysteine-rich receptor-like prote...    166   6e-44   Tarenaya hassleriana [spider flower]
gb|KJB39166.1|  hypothetical protein B456_007G001400                    166   6e-44   Gossypium raimondii
ref|XP_010427831.1|  PREDICTED: cysteine-rich receptor-like prote...    166   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011468279.1|  PREDICTED: cysteine-rich receptor-like prote...    166   1e-43   Fragaria vesca subsp. vesca
ref|XP_011086609.1|  PREDICTED: cysteine-rich receptor-like prote...    165   1e-43   
gb|KCW45360.1|  hypothetical protein EUGRSUZ_L00962                     165   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010044591.1|  PREDICTED: cysteine-rich receptor-like prote...    165   2e-43   Eucalyptus grandis [rose gum]
ref|NP_177210.1|  cysteine-rich receptor-like protein kinase 3          165   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888786.1|  kinase family protein                              165   2e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_006405500.1|  hypothetical protein EUTSA_v10027683mg             165   2e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010415737.1|  PREDICTED: cysteine-rich receptor-like prote...    165   2e-43   Camelina sativa [gold-of-pleasure]
gb|KFK41463.1|  hypothetical protein AALP_AA2G134200                    164   3e-43   Arabis alpina [alpine rockcress]
ref|NP_001269003.1|  uncharacterized protein LOC101255872               164   4e-43   Solanum lycopersicum
ref|XP_008446185.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    164   5e-43   Cucumis melo [Oriental melon]
ref|XP_006283294.1|  hypothetical protein CARUB_v10004332mg             164   5e-43   Capsella rubella
ref|XP_006374531.1|  hypothetical protein POPTR_0015s09050g             153   5e-43   
emb|CDX67454.1|  BnaA07g14940D                                          164   5e-43   
emb|CDY11571.1|  BnaC06g31680D                                          167   6e-43   Brassica napus [oilseed rape]
ref|XP_009125135.1|  PREDICTED: cysteine-rich receptor-like prote...    164   6e-43   Brassica rapa
ref|XP_006390874.1|  hypothetical protein EUTSA_v10018240mg             163   7e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010450675.1|  PREDICTED: cysteine-rich receptor-like prote...    163   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_004509569.1|  PREDICTED: cysteine-rich receptor-like prote...    163   7e-43   
emb|CDY47147.1|  BnaA08g05360D                                          160   7e-43   Brassica napus [oilseed rape]
ref|XP_004135260.1|  PREDICTED: cysteine-rich receptor-like prote...    163   7e-43   Cucumis sativus [cucumbers]
ref|XP_004509568.1|  PREDICTED: cysteine-rich receptor-like prote...    163   8e-43   Cicer arietinum [garbanzo]
emb|CDY11684.1|  BnaC06g12920D                                          163   9e-43   Brassica napus [oilseed rape]
ref|XP_010029936.1|  PREDICTED: cysteine-rich receptor-like prote...    162   1e-42   
ref|XP_009105721.1|  PREDICTED: cysteine-rich receptor-like prote...    159   1e-42   Brassica rapa
ref|XP_006301715.1|  hypothetical protein CARUB_v10022175mg             162   1e-42   Capsella rubella
gb|KCW83350.1|  hypothetical protein EUGRSUZ_B00284                     161   2e-42   Eucalyptus grandis [rose gum]
ref|XP_007044719.1|  Cysteine-rich RLK 3 isoform 2                      160   2e-42   
ref|XP_010045533.1|  PREDICTED: cysteine-rich receptor-like prote...    162   3e-42   Eucalyptus grandis [rose gum]
ref|XP_007044718.1|  Cysteine-rich RLK 3 isoform 1                      161   4e-42   
ref|XP_010435908.1|  PREDICTED: cysteine-rich receptor-like prote...    161   4e-42   Camelina sativa [gold-of-pleasure]
gb|KCW84027.1|  hypothetical protein EUGRSUZ_B00900                     161   4e-42   Eucalyptus grandis [rose gum]
ref|XP_010532281.1|  PREDICTED: cysteine-rich receptor-like prote...    161   5e-42   Tarenaya hassleriana [spider flower]
ref|XP_009772712.1|  PREDICTED: cysteine-rich receptor-like prote...    161   5e-42   Nicotiana sylvestris
ref|XP_003519826.1|  PREDICTED: cysteine-rich receptor-like prote...    160   7e-42   Glycine max [soybeans]
gb|KCW45210.1|  hypothetical protein EUGRSUZ_L01157                     150   7e-42   Eucalyptus grandis [rose gum]
ref|XP_006307016.1|  hypothetical protein CARUB_v10008603mg             160   1e-41   Capsella rubella
ref|XP_006483912.1|  PREDICTED: cysteine-rich receptor-like prote...    160   1e-41   Citrus sinensis [apfelsine]
ref|XP_006438314.1|  hypothetical protein CICLE_v10030965mg             160   1e-41   
ref|XP_009618146.1|  PREDICTED: cysteine-rich receptor-like prote...    160   1e-41   Nicotiana tomentosiformis
emb|CDP13195.1|  unnamed protein product                                160   1e-41   Coffea canephora [robusta coffee]
emb|CDY61395.1|  BnaA08g30660D                                          159   1e-41   Brassica napus [oilseed rape]
ref|XP_006344422.1|  PREDICTED: cysteine-rich receptor-like prote...    159   1e-41   Solanum tuberosum [potatoes]
emb|CDY67166.1|  BnaCnng53810D                                          159   2e-41   Brassica napus [oilseed rape]
ref|NP_564071.3|  receptor-like serine/threonine kinase 2               159   2e-41   
sp|Q9LMB9.2|CRK1_ARATH  RecName: Full=Cysteine-rich receptor-like...    159   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KDO82322.1|  hypothetical protein CISIN_1g008239mg                   159   2e-41   Citrus sinensis [apfelsine]
gb|AAF79292.1|AC068602_15  F14D16.24                                    159   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890316.1|  hypothetical protein ARALYDRAFT_472129             158   4e-41   
ref|XP_010441173.1|  PREDICTED: cysteine-rich receptor-like prote...    158   4e-41   Camelina sativa [gold-of-pleasure]
emb|CDY41017.1|  BnaC05g14750D                                          157   8e-41   Brassica napus [oilseed rape]
ref|XP_006654958.1|  PREDICTED: cysteine-rich receptor-like prote...    157   9e-41   
ref|XP_010040242.1|  PREDICTED: cysteine-rich receptor-like prote...    157   1e-40   
gb|KCW83347.1|  hypothetical protein EUGRSUZ_B00281                     157   1e-40   Eucalyptus grandis [rose gum]
emb|CDY26700.1|  BnaA06g13220D                                          157   1e-40   Brassica napus [oilseed rape]
ref|XP_009149385.1|  PREDICTED: cysteine-rich receptor-like prote...    157   1e-40   Brassica rapa
gb|ACN39857.1|  unknown                                                 157   2e-40   Picea sitchensis
gb|EMT04496.1|  Cysteine-rich receptor-like protein kinase 42           154   2e-40   
gb|KHN18443.1|  Cysteine-rich receptor-like protein kinase 1            155   4e-40   Glycine soja [wild soybean]
gb|EMS52195.1|  Cysteine-rich receptor-like protein kinase 42           152   6e-40   Triticum urartu
ref|XP_002439751.1|  hypothetical protein SORBIDRAFT_09g019455          147   7e-40   
ref|XP_003550730.2|  PREDICTED: cysteine-rich receptor-like prote...    154   7e-40   
gb|KJB50240.1|  hypothetical protein B456_008G160100                    154   1e-39   Gossypium raimondii
gb|AAC50044.1|  receptor-like serine/threonine kinase                   154   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50242.1|  hypothetical protein B456_008G160100                    154   1e-39   Gossypium raimondii
ref|XP_010921575.1|  PREDICTED: cysteine-rich receptor-like prote...    153   2e-39   Elaeis guineensis
ref|XP_011465646.1|  PREDICTED: cysteine-rich receptor-like prote...    152   2e-39   Fragaria vesca subsp. vesca
ref|XP_006840433.1|  hypothetical protein AMTR_s00045p00163010          153   3e-39   Amborella trichopoda
dbj|BAJ92547.1|  predicted protein                                      153   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW45361.1|  hypothetical protein EUGRSUZ_L009632                    148   6e-39   Eucalyptus grandis [rose gum]
ref|XP_010498315.1|  PREDICTED: cysteine-rich receptor-like prote...    152   7e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010462782.1|  PREDICTED: cysteine-rich receptor-like prote...    151   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002439224.1|  hypothetical protein SORBIDRAFT_09g002550          151   1e-38   Sorghum bicolor [broomcorn]
gb|EEE62217.1|  hypothetical protein OsJ_17004                          150   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477109.1|  PREDICTED: cysteine-rich receptor-like prote...    150   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010528239.1|  PREDICTED: cysteine-rich receptor-like prote...    150   3e-38   Tarenaya hassleriana [spider flower]
ref|XP_008655309.1|  PREDICTED: uncharacterized protein LOC100384...    148   3e-38   
ref|NP_001170087.1|  uncharacterized protein LOC100384005               148   3e-38   Zea mays [maize]
ref|XP_008655308.1|  PREDICTED: uncharacterized protein LOC100384...    148   3e-38   
ref|XP_007155445.1|  hypothetical protein PHAVU_003G202000g             150   4e-38   Phaseolus vulgaris [French bean]
gb|AAU44217.1|  hypothetical protein                                    150   5e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78453.1|  hypothetical protein OsI_18315                          150   6e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_010040238.1|  PREDICTED: cysteine-rich receptor-like prote...    149   7e-38   
ref|XP_004508879.1|  PREDICTED: cysteine-rich receptor-like prote...    149   9e-38   Cicer arietinum [garbanzo]
ref|XP_008781331.1|  PREDICTED: cysteine-rich receptor-like prote...    149   1e-37   
ref|XP_006348514.1|  PREDICTED: cysteine-rich receptor-like prote...    149   1e-37   Solanum tuberosum [potatoes]
gb|KHG18697.1|  Cysteine-rich receptor-like protein kinase 3            148   2e-37   Gossypium arboreum [tree cotton]
gb|KCW45359.1|  hypothetical protein EUGRSUZ_L00961                     147   2e-37   Eucalyptus grandis [rose gum]
ref|XP_006357154.1|  PREDICTED: putative cysteine-rich receptor-l...    147   3e-37   Solanum tuberosum [potatoes]
gb|KJB50236.1|  hypothetical protein B456_008G160000                    146   7e-37   Gossypium raimondii
gb|AFW77897.1|  putative DUF26-domain receptor-like protein kinas...    145   9e-37   
ref|XP_006841050.1|  hypothetical protein AMTR_s00085p00158310          146   1e-36   Amborella trichopoda
ref|XP_004960388.1|  PREDICTED: cysteine-rich receptor-like prote...    146   1e-36   
ref|XP_010026658.1|  PREDICTED: cysteine-rich receptor-like prote...    145   1e-36   Eucalyptus grandis [rose gum]
ref|XP_007044714.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    145   1e-36   
ref|XP_010317091.1|  PREDICTED: putative cysteine-rich receptor-l...    142   1e-36   
ref|XP_008649611.1|  PREDICTED: cysteine-rich receptor-like prote...    145   1e-36   Zea mays [maize]
ref|XP_008649610.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-36   Zea mays [maize]
ref|XP_006416539.1|  hypothetical protein EUTSA_v10007076mg             145   2e-36   
gb|KHG05033.1|  Cysteine-rich receptor-like protein kinase 2            145   2e-36   Gossypium arboreum [tree cotton]
ref|XP_009616730.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-36   Nicotiana tomentosiformis
ref|XP_008785014.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-36   Phoenix dactylifera
ref|XP_009768897.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-36   Nicotiana sylvestris
ref|XP_009768898.1|  PREDICTED: cysteine-rich receptor-like prote...    145   2e-36   Nicotiana sylvestris
ref|XP_010023497.1|  PREDICTED: cysteine-rich receptor-like prote...    145   3e-36   Eucalyptus grandis [rose gum]
ref|XP_002265910.1|  PREDICTED: cysteine-rich receptor-like prote...    144   4e-36   Vitis vinifera
ref|XP_004233329.1|  PREDICTED: putative cysteine-rich receptor-l...    142   4e-36   
emb|CAN64526.1|  hypothetical protein VITISV_005913                     144   5e-36   Vitis vinifera
ref|XP_006446553.1|  hypothetical protein CICLE_v10018177mg             143   5e-36   
gb|KDO55205.1|  hypothetical protein CISIN_1g037160mg                   143   6e-36   Citrus sinensis [apfelsine]
ref|XP_006470476.1|  PREDICTED: putative cysteine-rich receptor-l...    143   1e-35   
ref|XP_006356405.1|  PREDICTED: cysteine-rich receptor-like prote...    143   1e-35   
ref|XP_010251363.1|  PREDICTED: putative cysteine-rich receptor-l...    142   1e-35   
ref|XP_010251167.1|  PREDICTED: cysteine-rich receptor-like prote...    142   2e-35   Nelumbo nucifera [Indian lotus]
gb|KCW83354.1|  hypothetical protein EUGRSUZ_B00289                     142   2e-35   Eucalyptus grandis [rose gum]
gb|ABR16548.1|  unknown                                                 136   3e-35   Picea sitchensis
gb|KEH31823.1|  cysteine-rich receptor-kinase-like protein              142   4e-35   Medicago truncatula
gb|EYU22513.1|  hypothetical protein MIMGU_mgv1a002715mg                141   4e-35   Erythranthe guttata [common monkey flower]
emb|CDP13194.1|  unnamed protein product                                141   5e-35   Coffea canephora [robusta coffee]
ref|XP_007153757.1|  hypothetical protein PHAVU_003G062600g             140   8e-35   Phaseolus vulgaris [French bean]
gb|KHN14554.1|  Cysteine-rich receptor-like protein kinase 2            140   8e-35   Glycine soja [wild soybean]
ref|XP_006412925.1|  hypothetical protein EUTSA_v10024680mg             140   9e-35   
emb|CAN72173.1|  hypothetical protein VITISV_020702                     140   9e-35   Vitis vinifera
gb|KDP26625.1|  hypothetical protein JCGZ_17783                         140   1e-34   Jatropha curcas
ref|XP_007031539.1|  Kinase family protein with domain of Unchara...    140   1e-34   
ref|XP_003517719.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-34   Glycine max [soybeans]
ref|XP_010649524.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-34   Vitis vinifera
ref|XP_010649523.1|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-34   Vitis vinifera
ref|XP_002272353.2|  PREDICTED: cysteine-rich receptor-like prote...    140   1e-34   Vitis vinifera
emb|CBI22893.3|  unnamed protein product                                140   2e-34   Vitis vinifera
ref|XP_009614895.1|  PREDICTED: putative cysteine-rich receptor-l...    140   2e-34   Nicotiana tomentosiformis
ref|XP_004960146.1|  PREDICTED: probable LRR receptor-like serine...    138   2e-34   Setaria italica
ref|XP_004299001.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-34   Fragaria vesca subsp. vesca
ref|XP_004228897.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-34   
ref|XP_009614896.1|  PREDICTED: putative cysteine-rich receptor-l...    140   2e-34   Nicotiana tomentosiformis
ref|XP_006348510.1|  PREDICTED: cysteine-rich receptor-like prote...    140   2e-34   Solanum tuberosum [potatoes]
ref|XP_004228552.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-34   Solanum lycopersicum
ref|XP_006348513.1|  PREDICTED: cysteine-rich receptor-like prote...    139   2e-34   
ref|XP_006348519.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-34   Solanum tuberosum [potatoes]
ref|XP_010100422.1|  Cysteine-rich receptor-like protein kinase 2       139   3e-34   
ref|XP_010433180.1|  PREDICTED: putative cysteine-rich receptor-l...    137   3e-34   
ref|XP_006348512.1|  PREDICTED: cysteine-rich receptor-like prote...    139   3e-34   
ref|XP_010249417.1|  PREDICTED: putative cysteine-rich receptor-l...    139   3e-34   
ref|XP_010433188.1|  PREDICTED: putative cysteine-rich receptor-l...    138   3e-34   
emb|CDY38371.1|  BnaC01g09800D                                          139   3e-34   
ref|XP_009129435.1|  PREDICTED: putative cysteine-rich receptor-l...    139   4e-34   
ref|XP_009129440.1|  PREDICTED: putative cysteine-rich receptor-l...    138   4e-34   
emb|CDY35206.1|  BnaA01g08250D                                          138   4e-34   
ref|XP_009129448.1|  PREDICTED: putative cysteine-rich receptor-l...    139   4e-34   
ref|XP_004238642.1|  PREDICTED: cysteine-rich receptor-like prote...    138   6e-34   
ref|XP_010433187.1|  PREDICTED: putative cysteine-rich receptor-l...    137   7e-34   
ref|XP_007157363.1|  hypothetical protein PHAVU_002G063900g             137   1e-33   
ref|XP_006390875.1|  hypothetical protein EUTSA_v10018252mg             137   1e-33   
ref|XP_009763662.1|  PREDICTED: putative cysteine-rich receptor-l...    137   1e-33   
ref|XP_006285167.1|  hypothetical protein CARUB_v10006511mg             137   1e-33   
ref|XP_002265829.1|  PREDICTED: cysteine-rich receptor-like prote...    137   1e-33   
ref|XP_007157359.1|  hypothetical protein PHAVU_002G063700g             137   1e-33   
gb|KFK41462.1|  hypothetical protein AALP_AA2G134000                    137   1e-33   
emb|CAN71641.1|  hypothetical protein VITISV_031461                     137   1e-33   
ref|XP_009763660.1|  PREDICTED: putative cysteine-rich receptor-l...    137   2e-33   
ref|XP_009759216.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-33   
ref|XP_009763661.1|  PREDICTED: putative cysteine-rich receptor-l...    137   2e-33   
ref|XP_003551216.2|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-33   
ref|XP_009600945.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-33   
ref|XP_008340076.1|  PREDICTED: cysteine-rich receptor-like prote...    137   2e-33   
ref|XP_010551593.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-33   
ref|NP_001183012.1|  uncharacterized LOC100501332                       135   3e-33   
ref|XP_008668540.1|  PREDICTED: uncharacterized LOC100501332 isof...    135   3e-33   
gb|KJB61034.1|  hypothetical protein B456_009G336500                    137   3e-33   
ref|XP_008444358.1|  PREDICTED: cysteine-rich receptor-like prote...    136   3e-33   
gb|KJB61036.1|  hypothetical protein B456_009G336700                    136   3e-33   
gb|AES70848.2|  cysteine-rich RLK (receptor-like kinase) protein        136   3e-33   
ref|XP_002527895.1|  kinase, putative                                   135   3e-33   
gb|KHG29367.1|  Cysteine-rich receptor-like protein kinase 2            136   3e-33   
ref|XP_011004868.1|  PREDICTED: putative serine/threonine-protein...    134   4e-33   
ref|NP_001235136.1|  protein kinase family protein                      135   4e-33   
gb|KHN00376.1|  Cysteine-rich receptor-like protein kinase 2            135   4e-33   
ref|XP_002888785.1|  kinase family protein                              136   4e-33   
gb|EYU28432.1|  hypothetical protein MIMGU_mgv1a002644mg                136   4e-33   
ref|XP_008793626.1|  PREDICTED: cysteine-rich receptor-like prote...    133   4e-33   
ref|XP_006574321.1|  PREDICTED: protein kinase family protein iso...    135   5e-33   
ref|XP_003600597.1|  Cysteine-rich receptor-like protein kinase         136   6e-33   
gb|KFK29408.1|  hypothetical protein AALP_AA7G130100                    135   7e-33   
ref|XP_004161086.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    137   7e-33   
ref|XP_006370464.1|  kinase family protein                              133   7e-33   
ref|XP_006300838.1|  hypothetical protein CARUB_v10019929mg             135   8e-33   
ref|XP_008389698.1|  PREDICTED: cysteine-rich receptor-like prote...    135   8e-33   
ref|XP_008389695.1|  PREDICTED: cysteine-rich receptor-like prote...    135   8e-33   
ref|XP_002273750.2|  PREDICTED: putative cysteine-rich receptor-l...    135   9e-33   
gb|KHN08615.1|  Cysteine-rich receptor-like protein kinase 2            135   9e-33   
ref|XP_008221859.1|  PREDICTED: cysteine-rich receptor-like prote...    135   1e-32   
ref|XP_003613180.1|  Cysteine-rich receptor-like protein kinase         135   1e-32   
ref|XP_004143063.1|  PREDICTED: uncharacterized protein LOC101210276    137   1e-32   
ref|XP_009105717.1|  PREDICTED: cysteine-rich receptor-like prote...    135   1e-32   
gb|ABB47798.1|  expressed protein                                       130   1e-32   
ref|NP_194596.1|  putative cysteine-rich receptor-like protein ki...    134   1e-32   
ref|XP_007225117.1|  hypothetical protein PRUPE_ppa002639mg             134   1e-32   
ref|XP_010471047.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-32   
ref|XP_002314609.2|  kinase family protein                              134   2e-32   
ref|XP_006483911.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-32   
ref|XP_009766561.1|  PREDICTED: putative serine/threonine-protein...    132   2e-32   
gb|KDO82327.1|  hypothetical protein CISIN_1g006514mg                   134   2e-32   
ref|XP_011086608.1|  PREDICTED: cysteine-rich receptor-like prote...    134   2e-32   
ref|XP_011086606.1|  PREDICTED: cysteine-rich receptor-like prote...    134   3e-32   
ref|XP_011098240.1|  PREDICTED: probable leucine-rich repeat rece...    130   4e-32   
emb|CAN69245.1|  hypothetical protein VITISV_038881                     134   4e-32   
ref|XP_011016348.1|  PREDICTED: putative cysteine-rich receptor-l...    134   4e-32   
ref|XP_006378229.1|  kinase family protein                              133   4e-32   
ref|XP_010427830.1|  PREDICTED: cysteine-rich receptor-like prote...    133   4e-32   
gb|EPS61742.1|  hypothetical protein M569_13052                         131   4e-32   
ref|XP_006380607.1|  hypothetical protein POPTR_0007s09760g             132   4e-32   
ref|XP_011015500.1|  PREDICTED: putative cysteine-rich receptor-l...    134   4e-32   
ref|XP_010537769.1|  PREDICTED: putative serine/threonine-protein...    131   5e-32   
ref|XP_008372846.1|  PREDICTED: putative serine/threonine-protein...    131   5e-32   
ref|XP_008372847.1|  PREDICTED: putative serine/threonine-protein...    131   5e-32   
emb|CAH67794.1|  OSIGBa0132E09-OSIGBa0108L24.8                          131   6e-32   
gb|AAM91884.1|  putative receptor-like protein kinase                   130   6e-32   
ref|XP_011097666.1|  PREDICTED: putative serine/threonine-protein...    129   6e-32   
ref|XP_008383026.1|  PREDICTED: putative serine/threonine-protein...    131   6e-32   
ref|XP_008383025.1|  PREDICTED: putative serine/threonine-protein...    131   6e-32   
ref|XP_010233385.1|  PREDICTED: cysteine-rich receptor-like prote...    125   6e-32   
emb|CAE04238.2|  OSJNBa0011F23.11                                       131   6e-32   
ref|XP_011045281.1|  PREDICTED: cysteine-rich receptor-like prote...    133   6e-32   
ref|NP_177209.1|  cysteine-rich receptor-like protein kinase 2          133   7e-32   
tpg|DAA55118.1|  TPA: putative protein kinase superfamily protein       126   7e-32   
emb|CAN61486.1|  hypothetical protein VITISV_038127                     125   8e-32   
gb|KDP32521.1|  hypothetical protein JCGZ_14724                         131   8e-32   
ref|XP_006348580.1|  PREDICTED: cysteine-rich receptor-like prote...    131   8e-32   
ref|XP_010315345.1|  PREDICTED: cysteine-rich receptor-like prote...    132   8e-32   
ref|NP_001054130.2|  Os04g0658700                                       131   8e-32   
ref|XP_011071116.1|  PREDICTED: cysteine-rich receptor-like prote...    132   8e-32   
ref|NP_001064885.1|  Os10g0483400                                       130   9e-32   
gb|KDP46966.1|  hypothetical protein JCGZ_07983                         132   1e-31   
ref|XP_010415736.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-31   
ref|XP_006591760.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-31   
gb|KHN45756.1|  Cysteine-rich receptor-like protein kinase 2            132   1e-31   
ref|XP_008226283.1|  PREDICTED: putative serine/threonine-protein...    130   1e-31   
ref|XP_007021692.1|  Kinase superfamily protein isoform 4               130   1e-31   
ref|XP_010907462.1|  PREDICTED: putative serine/threonine-protein...    130   1e-31   
ref|XP_006377277.1|  hypothetical protein POPTR_0011s036602g            125   1e-31   
gb|KCW83336.1|  hypothetical protein EUGRSUZ_B00268                     131   1e-31   
ref|XP_007021689.1|  Kinase superfamily protein isoform 1               130   1e-31   
ref|XP_004228898.1|  PREDICTED: cysteine-rich receptor-like prote...    132   1e-31   
ref|XP_002447257.1|  hypothetical protein SORBIDRAFT_06g031420          130   1e-31   
ref|XP_008804702.1|  PREDICTED: putative serine/threonine-protein...    129   1e-31   
gb|KGN62309.1|  hypothetical protein Csa_2G348950                       125   1e-31   
ref|XP_004134965.1|  PREDICTED: cysteine-rich receptor-like prote...    131   2e-31   
ref|XP_002869487.1|  predicted protein                                  131   2e-31   
gb|KGN53521.1|  hypothetical protein Csa_4G064040                       128   2e-31   
gb|KDP43401.1|  hypothetical protein JCGZ_26556                         129   2e-31   
ref|XP_011097664.1|  PREDICTED: putative serine/threonine-protein...    129   2e-31   
ref|XP_008451823.1|  PREDICTED: putative serine/threonine-protein...    129   3e-31   
ref|XP_010108802.1|  Putative cysteine-rich receptor-like protein...    130   3e-31   
gb|KEH19488.1|  receptor-like kinase                                    129   3e-31   
gb|AGH68277.1|  RPK                                                     129   3e-31   
ref|XP_004170048.1|  PREDICTED: probable LRR receptor-like serine...    129   3e-31   
ref|XP_004147755.1|  PREDICTED: probable LRR receptor-like serine...    129   3e-31   
ref|XP_011078341.1|  PREDICTED: putative receptor-like protein ki...    129   3e-31   
gb|KHN42528.1|  Cysteine-rich receptor-like protein kinase 2            129   3e-31   
ref|XP_002529950.1|  ATP binding protein, putative                      129   3e-31   
ref|XP_006648976.1|  PREDICTED: G-type lectin S-receptor-like ser...    129   3e-31   
ref|XP_009619738.1|  PREDICTED: probable LRR receptor-like serine...    129   3e-31   
gb|EMT26820.1|  Putative LRR receptor-like serine/threonine-prote...    129   4e-31   
ref|XP_010528243.1|  PREDICTED: putative cysteine-rich receptor-l...    130   4e-31   
ref|XP_004956783.1|  PREDICTED: cysteine-rich receptor-like prote...    129   4e-31   
ref|XP_003631201.1|  PREDICTED: cysteine-rich receptor-like prote...    129   4e-31   
ref|XP_010931885.1|  PREDICTED: G-type lectin S-receptor-like ser...    128   4e-31   
ref|XP_010931883.1|  PREDICTED: G-type lectin S-receptor-like ser...    128   4e-31   
emb|CBI27330.3|  unnamed protein product                                129   4e-31   
emb|CDP00812.1|  unnamed protein product                                128   4e-31   
emb|CDY09449.1|  BnaC02g19910D                                          130   5e-31   
ref|XP_010931884.1|  PREDICTED: G-type lectin S-receptor-like ser...    128   5e-31   
ref|XP_002316361.1|  hypothetical protein POPTR_0010s22820g             127   5e-31   
ref|XP_009127806.1|  PREDICTED: cysteine-rich receptor-like prote...    130   5e-31   
gb|AGH68281.1|  receptor-like protein kinase                            129   5e-31   
gb|KFK43871.1|  hypothetical protein AALP_AA1G184900                    128   5e-31   
emb|CDP13621.1|  unnamed protein product                                128   5e-31   
ref|XP_010539590.1|  PREDICTED: putative serine/threonine-protein...    128   5e-31   
ref|NP_001055037.1|  Os05g0256100                                       127   5e-31   
gb|EYU27526.1|  hypothetical protein MIMGU_mgv1a008049mg                128   5e-31   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                   130   6e-31   
emb|CDY03741.1|  BnaA02g14960D                                          130   6e-31   
tpg|DAA61392.1|  TPA: putative protein kinase superfamily protein       124   6e-31   
ref|XP_009117750.1|  PREDICTED: putative serine/threonine-protein...    128   6e-31   
ref|XP_002890180.1|  hypothetical protein ARALYDRAFT_471863             128   6e-31   
gb|ACN93885.1|  putative protein kinase                                 127   6e-31   
gb|KDP20850.1|  hypothetical protein JCGZ_21321                         129   6e-31   
ref|XP_003579409.1|  PREDICTED: putative receptor-like protein ki...    128   6e-31   
ref|XP_009614929.1|  PREDICTED: putative serine/threonine-protein...    127   7e-31   
emb|CDX81773.1|  BnaC08g38280D                                          128   7e-31   
gb|KDO53434.1|  hypothetical protein CISIN_1g016347mg                   127   8e-31   
gb|KDP20848.1|  hypothetical protein JCGZ_21319                         130   8e-31   
ref|XP_006348290.1|  PREDICTED: probable LRR receptor-like serine...    127   8e-31   
ref|XP_006478006.1|  PREDICTED: probable LRR receptor-like serine...    127   8e-31   
gb|EMS50430.1|  Cysteine-rich receptor-like protein kinase 10           126   9e-31   
emb|CDP05995.1|  unnamed protein product                                127   1e-30   
ref|XP_004489796.1|  PREDICTED: cysteine-rich receptor-like prote...    129   1e-30   
gb|AGH68278.1|  receptor-like protein kinase                            127   1e-30   
ref|XP_010648890.1|  PREDICTED: cysteine-rich receptor-like prote...    129   1e-30   
ref|NP_564003.1|  putative serine/threonine kinase                      127   1e-30   
ref|XP_004294202.1|  PREDICTED: putative serine/threonine-protein...    127   1e-30   
gb|AGH68280.1|  receptor-like protein kinase                            127   1e-30   
ref|XP_002460194.1|  hypothetical protein SORBIDRAFT_02g024390          127   1e-30   
ref|XP_006441015.1|  hypothetical protein CICLE_v10020517mg             127   1e-30   
ref|XP_006841023.1|  hypothetical protein AMTR_s00085p00115570          128   1e-30   
gb|AAG10816.1|AC011808_4  Unknown protein                               127   1e-30   
gb|AGH68279.1|  receptor-like protein kinase                            127   1e-30   
ref|XP_008670177.1|  PREDICTED: putative receptor-like protein ki...    127   1e-30   
ref|XP_006585734.1|  PREDICTED: probable LRR receptor-like serine...    126   1e-30   
ref|NP_001235591.1|  receptor-like protein kinase                       125   1e-30   
ref|XP_011069336.1|  PREDICTED: probable LRR receptor-like serine...    130   1e-30   
ref|XP_006377282.1|  hypothetical protein POPTR_0011s03710g             125   1e-30   
ref|XP_009403360.1|  PREDICTED: cysteine-rich receptor-like prote...    127   2e-30   
ref|NP_001052392.1|  Os04g0291900                                       130   2e-30   
ref|XP_004155665.1|  PREDICTED: cysteine-rich receptor-like prote...    130   2e-30   
ref|XP_010694850.1|  PREDICTED: putative serine/threonine-protein...    127   2e-30   
ref|XP_010275933.1|  PREDICTED: putative serine/threonine-protein...    127   2e-30   
ref|XP_009403359.1|  PREDICTED: putative cysteine-rich receptor-l...    127   2e-30   
ref|XP_009403358.1|  PREDICTED: putative cysteine-rich receptor-l...    127   2e-30   
gb|EEC68880.1|  hypothetical protein OsI_37506                          128   2e-30   
ref|XP_009361746.1|  PREDICTED: putative serine/threonine-protein...    127   2e-30   
ref|XP_009361745.1|  PREDICTED: putative serine/threonine-protein...    127   2e-30   
gb|AAL69392.1|AF462229_1  receptor-like protein kinase                  121   2e-30   
gb|EMT20175.1|  Cysteine-rich receptor-like protein kinase 10           126   2e-30   
ref|XP_010530410.1|  PREDICTED: cysteine-rich receptor-like prote...    122   2e-30   
ref|XP_011030753.1|  PREDICTED: putative serine/threonine-protein...    126   2e-30   
dbj|BAF95169.1|  putative protein kinase                                129   2e-30   
ref|XP_004236550.1|  PREDICTED: putative receptor-like protein ki...    129   2e-30   
ref|XP_010258651.1|  PREDICTED: putative serine/threonine-protein...    126   2e-30   
gb|EAZ09066.1|  hypothetical protein OsI_31327                          125   2e-30   
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    130   2e-30   
ref|NP_001047895.1|  Os02g0710500                                       127   2e-30   
gb|EAY87251.1|  hypothetical protein OsI_08653                          127   2e-30   
ref|XP_010497985.1|  PREDICTED: putative serine/threonine-protein...    126   2e-30   
ref|XP_006304968.1|  hypothetical protein CARUB_v10012041mg             126   2e-30   
ref|XP_006836383.1|  hypothetical protein AMTR_s00092p00128890          126   2e-30   
ref|XP_002443536.1|  hypothetical protein SORBIDRAFT_08g021170          126   2e-30   
gb|EMS68799.1|  Cysteine-rich receptor-like protein kinase 2            126   2e-30   
ref|XP_006438315.1|  hypothetical protein CICLE_v10030934mg             128   2e-30   
ref|NP_192885.1|  putative cysteine-rich receptor-like protein ki...    129   3e-30   
ref|XP_007023702.1|  Serine-threonine protein kinase, plant-type,...    128   3e-30   
ref|XP_006355074.1|  PREDICTED: cysteine-rich receptor-like prote...    126   3e-30   
ref|XP_006597981.1|  PREDICTED: probable LRR receptor-like serine...    126   3e-30   
gb|KHN11531.1|  Putative LRR receptor-like serine/threonine-prote...    126   3e-30   
gb|KHN45762.1|  Cysteine-rich receptor-like protein kinase 2            128   3e-30   
ref|XP_006591754.1|  PREDICTED: cysteine-rich receptor-like prote...    128   3e-30   
gb|AAM13439.1|AF474072_1  similar to putative receptor protein ki...    126   3e-30   
ref|XP_010540935.1|  PREDICTED: putative cysteine-rich receptor-l...    127   3e-30   
ref|XP_003578098.1|  PREDICTED: cysteine-rich receptor-like prote...    126   3e-30   
ref|XP_002526197.1|  serine-threonine protein kinase, plant-type,...    128   3e-30   
ref|XP_010459206.1|  PREDICTED: putative serine/threonine-protein...    126   3e-30   
ref|XP_010459208.1|  PREDICTED: putative serine/threonine-protein...    125   3e-30   
ref|XP_010476779.1|  PREDICTED: putative serine/threonine-protein...    126   3e-30   
gb|KHN25165.1|  Cysteine-rich receptor-like protein kinase 3            127   3e-30   
ref|XP_011008156.1|  PREDICTED: G-type lectin S-receptor-like ser...    129   3e-30   
ref|XP_002265819.1|  PREDICTED: cysteine-rich receptor-like prote...    128   4e-30   
ref|XP_002524272.1|  ATP binding protein, putative                      125   4e-30   
ref|XP_011008157.1|  PREDICTED: G-type lectin S-receptor-like ser...    129   4e-30   
ref|XP_010540909.1|  PREDICTED: cysteine-rich receptor-like prote...    128   4e-30   
ref|XP_010540918.1|  PREDICTED: cysteine-rich receptor-like prote...    127   4e-30   
tpg|DAA59015.1|  TPA: putative receptor-like protein kinase             125   4e-30   



>ref|XP_004232315.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Solanum 
lycopersicum]
Length=668

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 133/151 (88%), Gaps = 1/151 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYS+GVLVLE+VSGRKS AFA+DSGSLLQTVW+L
Sbjct  480  STGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVSGRKSIAFAEDSGSLLQTVWKL  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T++  E +DP L+GDF   EASKV++VGLLC QA  ALRPSMSEVV+MLT E  +IPE
Sbjct  540  YTTNQVTEALDPLLKGDFPREEASKVLKVGLLCTQASVALRPSMSEVVQMLTCEGYQIPE  599

Query  353  PTQPPFINSSVLAGGSM-SSIKSLVSNALNK  264
            P QPPF+NS++LAGGS+ SSI+SLVSNAL K
Sbjct  600  PCQPPFLNSNLLAGGSIKSSIRSLVSNALYK  630



>ref|XP_006338584.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=664

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYS+GVLVLE+VSGRKS AFA+DSGSLLQTVW+L
Sbjct  476  STGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVSGRKSIAFAEDSGSLLQTVWKL  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T++  E +DP L+GDF   EASKV++VGLLC QA  ALRPSMSEVV+MLT E  +IPE
Sbjct  536  YTTNQVTEALDPLLKGDFPPEEASKVLKVGLLCTQASVALRPSMSEVVQMLTCEGYQIPE  595

Query  353  PTQPPFINSSVLAGGSM-SSIKSLVSNALNK  264
            P QPPF+NS++L GGS+ SSI+SLVS+AL K
Sbjct  596  PCQPPFLNSNLLVGGSVKSSIRSLVSSALYK  626



>ref|XP_009602876.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
tomentosiformis]
Length=664

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYS+GVLVLE+V GRK+ AFADDSGSLLQTVW+L
Sbjct  476  STGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVCGRKNIAFADDSGSLLQTVWKL  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T++  E +DP L+GDF   EASKV++VGLLC QA  ALRPSM+EVV+MLT ED +IPE
Sbjct  536  YTTNQVTEALDPLLKGDFPPEEASKVLKVGLLCTQASVALRPSMTEVVQMLTHEDYQIPE  595

Query  353  PTQPPFINSSVLAGGSMS-SIKSLVSNALNK  264
            P QPPF+NSS+LAG S+  S +SLV+N+L K
Sbjct  596  PRQPPFLNSSLLAGVSLKPSTRSLVTNSLFK  626



>ref|XP_009797283.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=663

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYS+GVLVLE+V GRK+ AFA+DSGSLLQTVW+L
Sbjct  476  STGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVCGRKNIAFAEDSGSLLQTVWKL  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T++  E +DP L+G+F   EASKV++VGLLC QA  ALRPSM+EVV+MLT ED +IPE
Sbjct  536  YTTNQVTEALDPLLKGNFPPEEASKVLKVGLLCTQASVALRPSMTEVVQMLTCEDCQIPE  595

Query  353  PTQPPFINSSVLAGGSM-SSIKSLV-SNALNK  264
            P QPPF+NSS+LAGGS+ SSI+SLV SN L K
Sbjct  596  PCQPPFLNSSLLAGGSLKSSIRSLVSSNTLFK  627



>ref|XP_010108803.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
 gb|EXC20318.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
Length=664

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVYSFGVLVLE+V GR++ AF  DSGSLLQTVW+L
Sbjct  489  STGIAGTLGYMAPEYLVRGQLTDKADVYSFGVLVLEIVCGRRNCAFTQDSGSLLQTVWKL  548

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++D+  E VDP L GDF +NE   ++Q+GLLC QA  ALRPSM+EVV MLT  ++EIP 
Sbjct  549  YKSDKLVEAVDPCLNGDFPSNEVYNMLQIGLLCTQASVALRPSMAEVVSMLTNNEKEIPT  608

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P QPPF+N+SVL   + S   S +S+VSN L +
Sbjct  609  PNQPPFLNASVLGPTTSSKSYSTQSMVSNPLTR  641



>gb|EYU44774.1| hypothetical protein MIMGU_mgv1a002463mg [Erythranthe guttata]
Length=671

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE+V+GRKSNAF +DSGSLLQTVW+L
Sbjct  485  STGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEIVTGRKSNAFVEDSGSLLQTVWKL  544

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ D+  E VDP L+GDF A E +KV+++GLLC QA  ALRPSM+EVV ML  E+ EIPE
Sbjct  545  FKRDKLTESVDPCLKGDFPATETTKVLRIGLLCAQASVALRPSMAEVVRMLRDENYEIPE  604

Query  353  PTQPPFINSSVL  318
            P QPPFIN++ L
Sbjct  605  PRQPPFINTTAL  616



>ref|XP_011098445.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Sesamum 
indicum]
Length=661

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYS+GVLVLE+V GRK+NAF +DSGSLLQTVW+L
Sbjct  481  STGIAGTLGYMAPEYLVKGQLTEKADVYSYGVLVLEIVCGRKNNAFVEDSGSLLQTVWKL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+TDR  E VDP L GDF A EA KV++VGLLC QA  A RPSM+E V MLT E+ E+PE
Sbjct  541  YKTDRLTESVDPCLNGDFPATEAVKVLKVGLLCAQASVAQRPSMAEAVRMLTDENYEVPE  600

Query  353  PTQPPFINSSVL---AGGSMSSIKSLVSNALNK  264
            P+QPPF+N+  L   +  S  SI SL SN + +
Sbjct  601  PSQPPFLNTGALSASSTRSSYSINSLASNMVTR  633



>emb|CDP02086.1| unnamed protein product [Coffea canephora]
Length=657

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE+V GRK+NAF ++S SLLQTVW+ 
Sbjct  482  STGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEIVCGRKNNAFVEESVSLLQTVWQF  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++D+  E VDPSLEG+F A EAS V+++GLLC QA  + RPSM EVVEMLT  + ++PE
Sbjct  542  YKSDKLAEKVDPSLEGEFPAIEASNVLKIGLLCTQASASSRPSMDEVVEMLTDSNGQVPE  601

Query  353  PTQPPFINSSVLA---GGSMSSIKSLVSNALNK  264
            P QPPFINSSVLA    GS SS  SL+ NA NK
Sbjct  602  PNQPPFINSSVLAPSSTGSYSSTSSLLRNAFNK  634



>gb|KHN45751.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=607

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 7/155 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLT+KADVYS+GVLVLE+VSGR++N F +DSGSLLQT W+L
Sbjct  428  STGIAGTLGYMAPEYLIRGQLTDKADVYSYGVLVLEIVSGRRNNVFREDSGSLLQTAWKL  487

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E VDPSL  DF  +EAS+V+Q+GLLC QA  +LRPSMS+VV ML+  + ++P 
Sbjct  488  YRSNTLTEAVDPSLGDDFPPSEASRVLQIGLLCTQASASLRPSMSQVVYMLSNTNLDVPT  547

Query  353  PTQPPFINSSVLAGGSMSSIK-----SLVSNALNK  264
            P QPPF+N+ +L   S SSIK     S +SNAL K
Sbjct  548  PNQPPFLNTGMLD--SDSSIKSYSTNSFISNALKK  580



>ref|XP_003555067.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=673

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 7/155 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLT+KADVYS+GVLVLE+VSGR++N F +DSGSLLQT W+L
Sbjct  494  STGIAGTLGYMAPEYLIRGQLTDKADVYSYGVLVLEIVSGRRNNVFREDSGSLLQTAWKL  553

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E VDPSL  DF  +EAS+V+Q+GLLC QA  +LRPSMS+VV ML+  + ++P 
Sbjct  554  YRSNTLTEAVDPSLGDDFPPSEASRVLQIGLLCTQASASLRPSMSQVVYMLSNTNLDVPT  613

Query  353  PTQPPFINSSVLAGGSMSSIK-----SLVSNALNK  264
            P QPPF+N+ +L   S SSIK     S +SNAL K
Sbjct  614  PNQPPFLNTGMLD--SDSSIKSYSTNSFISNALKK  646



>ref|XP_002300041.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa]
 gb|EEE84846.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa]
Length=667

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL+RGQLT+KADVYSFGVLVLE++ G++ NAF ++SGSLLQTVWRL
Sbjct  488  STGIAGTIGYMAPEYLIRGQLTDKADVYSFGVLVLEILGGKRCNAFVENSGSLLQTVWRL  547

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++R  + VDP L  +F   EAS V+Q+GLLC QA  ALRPSM++VV  LT  D EIP 
Sbjct  548  YRSNRLVDAVDPCLRDEFPTREASCVLQIGLLCTQASAALRPSMAQVVHFLTNNDCEIPP  607

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNA  273
            P QPP++N+S+L   +     SI SLVSN 
Sbjct  608  PNQPPYMNTSLLETENSRWSYSINSLVSNG  637



>gb|KDP45316.1| hypothetical protein JCGZ_09565 [Jatropha curcas]
Length=669

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYLVRGQLTEKADVYSFGVLVLE+V G++ NAF +DS SLLQTVW+L
Sbjct  485  STGIAGTIGYMAPEYLVRGQLTEKADVYSFGVLVLEIVMGKRCNAFIEDSKSLLQTVWQL  544

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++R  E VD  L  +F   EAS+V+Q+GLLC QA  +LRPSM +VVEMLT  D EIP 
Sbjct  545  YRSNRLVEAVDSCLREEFPVQEASRVLQIGLLCTQASVSLRPSMEQVVEMLTNTDCEIPL  604

Query  353  PTQPPFINSSVLAGGS---MSSIKSLVSNALNK  264
            P QPPF+N+++L   S     S  S VSN   K
Sbjct  605  PNQPPFMNATLLETESSKGYCSTNSFVSNVTTK  637



>ref|XP_011047329.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Populus 
euphratica]
Length=665

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 3/150 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL+RGQLT+KADVYSFGVLVLE++ G++ NAF ++SGSLLQTVWRL
Sbjct  486  STGIAGTIGYMAPEYLIRGQLTDKADVYSFGVLVLEILGGKRCNAFVENSGSLLQTVWRL  545

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++R  + VDP L  +F   EAS V+Q+GLLC QA  ALRPSM++VV  LT  D EIP 
Sbjct  546  YRSNRLVDAVDPCLRDEFPTREASCVLQIGLLCTQASAALRPSMAQVVHFLTNNDCEIPP  605

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNA  273
            P QPP++N+S+L   +     S+ SLVSN 
Sbjct  606  PNQPPYMNTSLLETENSRWSYSMNSLVSNG  635



>ref|XP_007140970.1| hypothetical protein PHAVU_008G156400g [Phaseolus vulgaris]
 gb|ESW12964.1| hypothetical protein PHAVU_008G156400g [Phaseolus vulgaris]
Length=664

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLT+KADVYSFGVLVLE+V GR++N F +DSGSLLQTVW+L
Sbjct  484  STGIAGTLGYMAPEYLIRGQLTDKADVYSFGVLVLEVVCGRRNNVFREDSGSLLQTVWKL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E VDP L  D+ A EAS+V ++GLLC QA  +LRPS+S+VV MLT  + ++P 
Sbjct  544  YRSNTLTEAVDPCLGDDYPATEASRVFRIGLLCTQASASLRPSISQVVYMLTNSNEDVPT  603

Query  353  PTQPPFINSSVL-AGGSMS-SIKSLVSNALNK  264
            P QPPF+++ +L + GS S +  S +SNAL K
Sbjct  604  PNQPPFLSTGMLDSDGSKSYTTNSFISNALKK  635



>ref|XP_002524667.1| kinase, putative [Ricinus communis]
 gb|EEF37686.1| kinase, putative [Ricinus communis]
Length=605

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL+RGQLTEKADVYSFGVLVLE+V G++ NAF +DS SLLQTVW+L
Sbjct  424  STGIAGTMGYMAPEYLIRGQLTEKADVYSFGVLVLEIVMGKRCNAFTEDSKSLLQTVWQL  483

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR +R  E  DPSL  DF+A E S+V+Q GLLC QA  ALRPSM+EVV MLT    EIP 
Sbjct  484  YRLNRLVEAADPSLRDDFSAEEVSRVLQTGLLCTQASVALRPSMAEVVVMLTNSGGEIPL  543

Query  353  PTQPPFINSSVL  318
            P+QPPF+N++ L
Sbjct  544  PSQPPFMNATSL  555



>ref|XP_007031540.1| Cysteine-rich RLK 42 [Theobroma cacao]
 gb|EOY02466.1| Cysteine-rich RLK 42 [Theobroma cacao]
Length=665

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGYMAPEYLVRGQLTEKADVYSFGVL LE+V G+++  F  DSGSLLQTVW L
Sbjct  490  STGVAGTLGYMAPEYLVRGQLTEKADVYSFGVLALEIVCGKRNTTFTKDSGSLLQTVWAL  549

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++R  E VD S++ D +A EA  V+Q+GLLC QA  +LRPSM++VV+MLT +D EIP 
Sbjct  550  YRSNRLAEAVDYSIKDDTSAKEAPDVLQIGLLCTQASVSLRPSMAQVVQMLTDKDCEIPS  609

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P QPPF+N+SVL   S +   S  S  +NA+ K
Sbjct  610  PNQPPFLNASVLDPTSSTRSNSTDSFTTNAVRK  642



>ref|XP_002273718.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Vitis 
vinifera]
Length=659

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE+V GRK++ F  DSGSLLQ VW+L
Sbjct  481  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDSGSLLQRVWKL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++++  E +D  L+ DF   EAS V+++GLLC QA  ALRPSM+EVV MLT +D EIP 
Sbjct  541  YKSNKLVEAIDDCLKDDFPEKEASDVLRIGLLCTQASVALRPSMTEVVWMLTHKDWEIPP  600

Query  353  PTQPPFINSSVL  318
            P QPPF+N+ VL
Sbjct  601  PNQPPFLNAHVL  612



>emb|CAN69244.1| hypothetical protein VITISV_038880 [Vitis vinifera]
Length=653

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE+V GRK++ F  DSGSLLQ VW+L
Sbjct  427  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDSGSLLQRVWKL  486

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++++  E +D  L+ DF   EAS V+++GLLC QA  ALRPSM+EVV MLT +D EIP 
Sbjct  487  YKSNKLVEAIDDCLKDDFPEKEASDVLRIGLLCTQASVALRPSMTEVVWMLTHKDWEIPP  546

Query  353  PTQPPFINSSVL  318
            P QPPF+N+ VL
Sbjct  547  PNQPPFLNAHVL  558



>gb|KHN27450.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=673

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL++GQLT+KADVYSFGVLVLE+ SGRK+N F +DSGSLLQTVW+L
Sbjct  493  STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKL  552

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E VDP L  DF A EAS+V Q+GLLC QA  +LRPSM++VV +L+  + ++P 
Sbjct  553  YQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPSMTQVVSILSNSNLDVPI  612

Query  353  PTQPPFINSSVLAGGS--MSSIKSLVSNALNK  264
            P QPPF+NS +L   S    SI S  SN   K
Sbjct  613  PKQPPFLNSRLLDQASPLGFSIGSSSSNTFKK  644



>gb|KDO55201.1| hypothetical protein CISIN_1g007248mg [Citrus sinensis]
Length=611

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEYLVRGQLTEKADVYSFG+L++E+V GR+SNAF+ DS S LQ VW L
Sbjct  431  STAVAGTLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSQDSASPLQRVWTL  490

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR+++  E VDP+L+ DF A +   V+Q+GLLC QA  ALRPSM++ + +LT +  EIP 
Sbjct  491  YRSNKLVEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIMLLTNKVCEIPT  550

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P+QPPF+NSSV+  G+ S   S  S +SN   +
Sbjct  551  PSQPPFLNSSVMEPGNSSRSCSANSFISNVAKR  583



>ref|XP_006446554.1| hypothetical protein CICLE_v10014520mg [Citrus clementina]
 gb|ESR59794.1| hypothetical protein CICLE_v10014520mg [Citrus clementina]
Length=664

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEYLVRGQLTEKADVYSFG+L++E+V GR+SNAF+ DS S LQ VW L
Sbjct  484  STAVAGTLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSHDSASPLQRVWTL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR+++  E VDP+L+ DF A +   V+Q+GLLC QA  ALRPSM++ + +LT +  EIP 
Sbjct  544  YRSNKLVEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIMLLTNKVCEIPT  603

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P+QPPF+NSSV+  G+ S   S  S +SN   +
Sbjct  604  PSQPPFLNSSVMEPGNSSRSCSANSFISNVAKR  636



>emb|CBI34889.3| unnamed protein product [Vitis vinifera]
Length=1245

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713   STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
             STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE+V GRK++ F  DSGSLLQ VW+L
Sbjct  1051  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDSGSLLQRVWKL  1110

Query  533   YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
             Y++++  E +D  L+ DF   EAS V+++GLLC QA  ALRPSM+EVV MLT +D EIP 
Sbjct  1111  YKSNKLVEAIDDCLKDDFPEKEASDVLRIGLLCTQASVALRPSMTEVVWMLTHKDWEIPP  1170

Query  353   PTQPPFINSSVL  318
             P QPPF+N+ VL
Sbjct  1171  PNQPPFLNAHVL  1182


 Score =   135 bits (340),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 95/127 (75%), Gaps = 3/127 (2%)
 Frame = -3

Query  710  TGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFA-DDSGSLLQT-VWR  537
            T IAGTLGYMAPEYL +G+LT+K DVYS+GVL+LE+VSG ++N F  DDS + L T  W+
Sbjct  515  TAIAGTLGYMAPEYLAQGRLTDKVDVYSYGVLILEIVSGVQNNKFQLDDSLNTLATATWK  574

Query  536  LYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
             ++++   EI+D  +E + +  E ++V+QVGLLC Q  P LRP+M+E+++ML  +D  +P
Sbjct  575  HFQSNTMTEIIDKGMEIE-DMEEVTRVIQVGLLCTQESPTLRPAMTEIIQMLKQKDVSLP  633

Query  356  EPTQPPF  336
             P++PPF
Sbjct  634  IPSKPPF  640



>ref|XP_006470280.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Citrus sinensis]
Length=664

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 116/153 (76%), Gaps = 3/153 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEYLVRGQLTEKADVYSFG+L++E+V GR+SNAF+ DS S LQ VW L
Sbjct  484  STAVAGTLGYMAPEYLVRGQLTEKADVYSFGILIIEIVCGRRSNAFSQDSASPLQRVWTL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR+++  E VDP+L+ DF A +   V+Q+GLLC QA  ALRPSM++ + +LT +  EIP 
Sbjct  544  YRSNKLVEAVDPNLKDDFPAEQVCNVLQIGLLCTQAAAALRPSMAQAIMLLTNKVCEIPT  603

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P+QPPF+NSSV+  G+ S   S  S +SN   +
Sbjct  604  PSQPPFLNSSVMEPGNSSRSCSANSFISNVAKR  636



>ref|XP_006579769.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=667

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL++GQLT+KADVYSFGVLVLE+ SGRK+N F +DSGSLLQTVW+L
Sbjct  487  STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKL  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E VDP L  DF A EAS+V Q+GLLC QA  +LRPSM++VV +L+  + + P 
Sbjct  547  YQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPSMTQVVSILSNSNLDAPI  606

Query  353  PTQPPFINSSVLAGGS--MSSIKSLVSNALNK  264
            P QPPF+NS +L   S    SI S  SN   K
Sbjct  607  PKQPPFLNSRLLDQASPLGFSIGSSSSNTFKK  638



>ref|XP_006477547.1| PREDICTED: cysteine-rich receptor-like protein kinase 1-like 
[Citrus sinensis]
Length=629

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLV+E+ SGR+++ F++ S S+L TVW+ 
Sbjct  462  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKH  521

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +R  + +DP L G F  NEAS+V+Q+GLLC QA  ALRPSM+EVV ML   D EIP 
Sbjct  522  YKANRITQSMDPGLTGRFPENEASRVLQIGLLCTQAPVALRPSMAEVVHMLNNIDYEIPP  581

Query  353  PTQPPFINSSVLAGGS------MSSIKSLVSNA  273
            P QPPF+N+SV++         MSS KS V+ +
Sbjct  582  PKQPPFLNASVISPSDNSKDSMMSSFKSFVAES  614



>gb|KDO69587.1| hypothetical protein CISIN_1g042149mg [Citrus sinensis]
Length=625

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLV+E+ SGR+++ F++ S S+L TVW+ 
Sbjct  458  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKH  517

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +R  + +DP L G F  NEAS+V+Q+GLLC QA  ALRPSM+EVV ML   D EIP 
Sbjct  518  YKANRITQSMDPGLTGRFPENEASRVLQIGLLCTQAPVALRPSMAEVVHMLNNIDYEIPP  577

Query  353  PTQPPFINSSVLA------GGSMSSIKSLVSNA  273
            P QPPF+N+SV++         MSS KS V+ +
Sbjct  578  PKQPPFLNASVISPSDNSKDSMMSSFKSFVAES  610



>emb|CAN61087.1| hypothetical protein VITISV_034611 [Vitis vinifera]
Length=668

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL+EKADVY++GVL+LE+V GRK+  F   S S+LQTVW+ 
Sbjct  471  STGIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQTVWKH  530

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     VDPSL+GDF  NEA  VVQ+GLLC QA  ALRPSMS+VV+MLT ++  IPE
Sbjct  531  YKSNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLTDQNSVIPE  590

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  591  PMQPPFLNASVL  602



>emb|CBI15002.3| unnamed protein product [Vitis vinifera]
Length=696

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL+EKADVY++GVL+LE+V GRK+  F   S S+LQTVW+ 
Sbjct  465  STGIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQTVWKH  524

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     VDPSL+GDF  NEA  VVQ+GLLC QA  ALRPSMS+VV+MLT ++  IPE
Sbjct  525  YKSNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLTDQNSVIPE  584

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  585  PMQPPFLNASVL  596



>ref|XP_010663147.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Vitis 
vinifera]
Length=667

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL+EKADVY++GVL+LE+V GRK+  F   S S+LQTVW+ 
Sbjct  484  STGIAGTLGYMAPEYLVRGQLSEKADVYAYGVLILEIVCGRKNCIFVQGSDSVLQTVWKH  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     VDPSL+GDF  NEA  VVQ+GLLC QA  ALRPSMS+VV+MLT ++  IPE
Sbjct  544  YKSNSVVRSVDPSLKGDFPLNEARNVVQIGLLCTQASFALRPSMSQVVQMLTDQNSVIPE  603

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  604  PMQPPFLNASVL  615



>ref|XP_006439855.1| hypothetical protein CICLE_v10023699mg, partial [Citrus clementina]
 gb|ESR53095.1| hypothetical protein CICLE_v10023699mg, partial [Citrus clementina]
Length=560

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 113/149 (76%), Gaps = 6/149 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLV+E+ SGR+++ F++ S S+L TVW+ 
Sbjct  412  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVIEVASGRRNSVFSEGSSSVLHTVWKH  471

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +R  + +DP L G F  NEAS+V+Q+GLLC QA  ALRPSM+EVV ML   D EIP 
Sbjct  472  YKANRITQSMDPGLTGRFPENEASRVLQIGLLCTQAPVALRPSMTEVVHMLNNIDYEIPP  531

Query  353  PTQPPFINSSVLA------GGSMSSIKSL  285
            P QPPF+N+SV++         MSS KS 
Sbjct  532  PKQPPFLNASVISPSDNSKDSMMSSFKSF  560



>ref|XP_010101899.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
 gb|EXB90356.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis]
Length=652

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY++GVL+LE+VS RK++AF   S S+L +VW+L
Sbjct  484  STGIAGTLGYMAPEYLVRGQLTDKADVYAYGVLILEIVSSRKNSAFTLGSSSVLHSVWKL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ ++  E VDP+L+ DF A EAS V+Q+GLLC QA  ALRPSMSEVV+ML+  + EIP 
Sbjct  544  YKANKVVESVDPALKDDFPAEEASNVLQIGLLCTQASVALRPSMSEVVQMLSDREHEIPL  603

Query  353  PTQPPFINSSVL  318
            P QPPF+N+S+L
Sbjct  604  PMQPPFLNASIL  615



>gb|KHN23515.1| Cysteine-rich receptor-like protein kinase 42 [Glycine soja]
Length=605

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL++GQLT+KADVYSFGVLVLE+ SGRK+N F +DSGSLLQTVW+L
Sbjct  425  STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKL  484

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E VDP L  DF A EAS+V Q+GLLC QA  +LRP M++V  ML+  + ++P 
Sbjct  485  YQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPFMAQVASMLSNSNLDLPI  544

Query  353  PTQPPFINSSVLAGGS--MSSIKSLVSNALNK  264
            P QPPF+NS  L   S    SI S  SN   K
Sbjct  545  PKQPPFLNSRFLDQTSPLGFSIDSSSSNTFKK  576



>gb|KCW52910.1| hypothetical protein EUGRSUZ_J02225 [Eucalyptus grandis]
Length=732

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE++ GRKS++F +++ SLLQ VW  
Sbjct  543  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIICGRKSSSFREETVSLLQMVWNF  602

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++D   E VD  L+G+F A EAS V+++GLLC QA  A RP M+EVV+MLT ED  IP+
Sbjct  603  YKSDNLVEAVDSCLKGEFPAQEASNVLRIGLLCTQASAAARPFMAEVVQMLTREDFAIPQ  662

Query  353  PTQPPFINSSV  321
            PTQPPF+N++ 
Sbjct  663  PTQPPFLNANA  673



>gb|KCW83353.1| hypothetical protein EUGRSUZ_B00288 [Eucalyptus grandis]
Length=629

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 115/144 (80%), Gaps = 0/144 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  462  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEILSGRKNSVFGQVSGSVLQSVWKQ  521

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++   E +DP L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++R +P 
Sbjct  522  YKSNGLAECIDPVLKGTFPVSEALNVLQIALLCTQASPDLRPSMSEVVEMLNNQERMVPV  581

Query  353  PTQPPFINSSVLAGGSMSSIKSLV  282
            PTQPPF+N++++   S  S+++ +
Sbjct  582  PTQPPFLNNNLIPDDSSRSLRTTI  605



>ref|XP_010033300.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=692

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 107/131 (82%), Gaps = 0/131 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE++ GRKS++F +++ SLLQ VW  
Sbjct  503  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIICGRKSSSFREETVSLLQMVWNF  562

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++D   E VD  L+G+F A EAS V+++GLLC QA  A RP M+EVV+MLT ED  IP+
Sbjct  563  YKSDNLVEAVDSCLKGEFPAQEASNVLRIGLLCTQASAAARPFMAEVVQMLTREDFAIPQ  622

Query  353  PTQPPFINSSV  321
            PTQPPF+N++ 
Sbjct  623  PTQPPFLNANA  633



>ref|XP_006338204.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=641

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 8/151 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFA-DDSGSLLQTVWR  537
            STGIAGTLGYMAPEYLV+GQLTE ADVYS+GVLVLE+V GRK+ + A DDSG LLQTVW+
Sbjct  478  STGIAGTLGYMAPEYLVKGQLTEMADVYSYGVLVLEIVCGRKNISLAEDDSGYLLQTVWK  537

Query  536  LYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
            LY T++  + +DP L+ DF+  E SKV++VGLLC QA   LRPSMS+VV+MLT   + IP
Sbjct  538  LYTTNQVTKALDPILKDDFSPEEVSKVLKVGLLCTQASVTLRPSMSDVVQMLTTFGQPIP  597

Query  356  EPTQPPFINSSVLAGGSMSSIKSLVSNALNK  264
            EP QPPF+ SS       SSIK  VS+ L+K
Sbjct  598  EPCQPPFLRSS-------SSIKRFVSDTLSK  621



>ref|XP_003554810.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=666

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL++GQLT+KADVYSFGVLVLE+ SGRK+N F +DSGSLLQTVW+L
Sbjct  486  STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLEIASGRKNNVFREDSGSLLQTVWKL  545

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E VDP L  DF A EAS+V Q+GLLC QA  +LRP M +V  ML+  + ++P 
Sbjct  546  YQSNRLGEAVDPGLGEDFPAREASRVFQIGLLCTQASASLRPFMVQVASMLSNSNLDVPI  605

Query  353  PTQPPFINSSVLAGGS--MSSIKSLVSNALNK  264
            P QPPF+NS  L   S    SI S  SN   K
Sbjct  606  PKQPPFLNSRFLDQTSPLGFSIDSSSSNTFKK  637



>gb|KCW83326.1| hypothetical protein EUGRSUZ_B00254 [Eucalyptus grandis]
Length=657

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRKS+ FA  SGS+LQ+VW  
Sbjct  480  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQSVWNH  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++      VDP+L G F   EAS V+Q+ LLC QA   LRP+MS VVEML   D  +PE
Sbjct  540  YKSSNLAACVDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRDHAVPE  599

Query  353  PTQPPFINSSVLAGGS---MSSIKSLVSNAL  270
            P QPPF+N+SVL+  S    S   S +SN L
Sbjct  600  PKQPPFLNASVLSDESSTRSSYTHSWLSNQL  630



>ref|XP_010027455.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X2 [Eucalyptus grandis]
Length=666

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRKS+ FA  SGS+LQ+VW  
Sbjct  489  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQSVWNH  548

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++      VDP+L G F   EAS V+Q+ LLC QA   LRP+MS VVEML   D  +PE
Sbjct  549  YKSSNLAACVDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRDHAVPE  608

Query  353  PTQPPFINSSVLAGGS---MSSIKSLVSNAL  270
            P QPPF+N+SVL+  S    S   S +SN L
Sbjct  609  PKQPPFLNASVLSDESSTRSSYTHSWLSNQL  639



>gb|KJB70905.1| hypothetical protein B456_011G095200 [Gossypium raimondii]
Length=656

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL+EKADVYSFGVLVLE+V G+K+++F   +GSLLQTVW L
Sbjct  482  STGIAGTLGYMAPEYLVRGQLSEKADVYSFGVLVLEIVCGKKNSSFTT-AGSLLQTVWTL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E +DP +  + +  EA +V++VGLLC QA   LRPSM+EVV+MLT ED E P 
Sbjct  541  YRSNVLAEAIDPCIRDEMSEKEAPEVLRVGLLCTQASVLLRPSMAEVVQMLTDEDYETPT  600

Query  353  PTQPPFINSSVLAGGSMS---SIKSLVSNALNK  264
            P QPPF+N++VL   + S   S  S V+NAL K
Sbjct  601  PNQPPFLNANVLEAANSSRSYSTDSFVANALKK  633



>ref|XP_010027454.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X1 [Eucalyptus grandis]
Length=680

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRKS+ FA  SGS+LQ+VW  
Sbjct  503  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSIFAQGSGSVLQSVWNH  562

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++      VDP+L G F   EAS V+Q+ LLC QA   LRP+MS VVEML   D  +PE
Sbjct  563  YKSSNLAACVDPALRGKFPVQEASDVLQISLLCTQASMELRPTMSRVVEMLRSRDHAVPE  622

Query  353  PTQPPFINSSVLAGGS---MSSIKSLVSNAL  270
            P QPPF+N+SVL+  S    S   S +SN L
Sbjct  623  PKQPPFLNASVLSDESSTRSSYTHSWLSNQL  653



>ref|XP_007151008.1| hypothetical protein PHAVU_004G011000g [Phaseolus vulgaris]
 gb|ESW23002.1| hypothetical protein PHAVU_004G011000g [Phaseolus vulgaris]
Length=670

 Score =   183 bits (465),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL++GQLT+KADVYSFGVLVLE  SGRK+N F +DS SLLQTVW+L
Sbjct  490  STGIAGTLGYMAPEYLIQGQLTDKADVYSFGVLVLETASGRKNNVFREDSDSLLQTVWKL  549

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E VDP L  +F A EAS+V Q+GLLC QA  +LRPSM++V  ML+  D ++P 
Sbjct  550  YQSNRLGEAVDPCLGNEFPAREASRVFQIGLLCTQASASLRPSMAQVACMLSNSDLDVPI  609

Query  353  PTQPPFINSSVL  318
            P QPPF+NS +L
Sbjct  610  PKQPPFLNSRLL  621



>gb|KDP26626.1| hypothetical protein JCGZ_17784 [Jatropha curcas]
Length=657

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +T IAGTLGYMAPEY++RG+LTEKADVYSFGVLV+E+VSGR++NAF  DSGS+LQ VW L
Sbjct  491  TTVIAGTLGYMAPEYVIRGKLTEKADVYSFGVLVMEVVSGRRNNAFVQDSGSILQMVWTL  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R  E VDP LEGDF   EAS+++Q+GLLC QA   LRP+MS VV+ML     EIP+
Sbjct  551  YGTGRLCEAVDPKLEGDFQEEEASRLLQIGLLCVQASADLRPAMSIVVKMLN-NSHEIPQ  609

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  610  PTQPPFLN  617



>ref|XP_009759879.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nicotiana 
sylvestris]
Length=649

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G+K++    ++ SLLQ +W L
Sbjct  484  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIELVCGKKNSYVFQNTNSLLQQLWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   +S E VDPSLEG+FN  EASK++QVGLLC QA   LRPSMS VV+MLT E+ EIP+
Sbjct  544  YGMGKSCEAVDPSLEGNFNEEEASKLLQVGLLCVQASAELRPSMSSVVKMLT-ENHEIPQ  602

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  603  PTQPPFLNS  611



>gb|KCW83357.1| hypothetical protein EUGRSUZ_B00292 [Eucalyptus grandis]
Length=590

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVY+FGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  427  STGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKQ  486

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E +DP+L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++  +P 
Sbjct  487  YKSNRLSECIDPALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLNDQECIVPM  546

Query  353  PTQPPFINSSVLAGGSMSS  297
            PTQPPF+N++ +   S  S
Sbjct  547  PTQPPFLNNNAIPDDSSGS  565



>ref|NP_001238666.1| protein kinase family protein [Glycine max]
 gb|ACM89504.1| protein kinase family protein [Glycine max]
Length=392

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+VSG+K +++  +S SLLQTVW L
Sbjct  229  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSL  288

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R +E+VDP+LEG F A EA +++Q+GLLC QA   LRPSMS VV+M+   + EIP+
Sbjct  289  YGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVN-NNHEIPQ  347

Query  353  PTQPPFIN  330
            P QPPFIN
Sbjct  348  PAQPPFIN  355



>gb|KCW83330.1| hypothetical protein EUGRSUZ_B00258 [Eucalyptus grandis]
Length=333

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 109/142 (77%), Gaps = 1/142 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL RGQLTEKADVY+FGVLVLE+++GRK++ +   S SLLQ+VW+ 
Sbjct  192  STGIAGTIGYMAPEYLTRGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSLLQSVWKQ  251

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++      +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  +DR +P+
Sbjct  252  YKSTNLAACIDPTLQGKFLVVEASNVLQIGLLCTQASVELRPPMSGVVEMLHDKDRVVPQ  311

Query  353  PTQPPFINSSVLAGGSMSSIKS  288
            P QPPF+N+SVL   S SSI S
Sbjct  312  PNQPPFLNASVLFDKS-SSISS  332



>ref|XP_010041377.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW44396.1| hypothetical protein EUGRSUZ_L02117 [Eucalyptus grandis]
Length=590

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVY+FGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  427  STGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKQ  486

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++   E +DP+L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++  +P 
Sbjct  487  YKSNSLAECIDPALKGKFPVSEALNVIQIALLCTQASPDLRPSMSEVVEMLNDQECIVPM  546

Query  353  PTQPPFINSSVLAGGSMSS  297
            PTQPPF+N++ + G S  S
Sbjct  547  PTQPPFLNNNPIPGDSSRS  565



>ref|XP_010027527.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=654

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVY+FGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  491  STGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKQ  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E +DP+L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++  +P 
Sbjct  551  YKSNRLSECIDPALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLNDQECIVPM  610

Query  353  PTQPPFINSSVLAGGSMSS  297
            PTQPPF+N++ +   S  S
Sbjct  611  PTQPPFLNNNAIPDDSSGS  629



>ref|XP_006356404.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Solanum tuberosum]
Length=649

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG LTEKADVYSFGVLV+E+V G+K+N    ++ SLLQ +W L
Sbjct  484  STAIAGTLGYMAPEYVVRGILTEKADVYSFGVLVVEVVCGKKNNYVFKNTNSLLQQLWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   +S+E VDP LEG+FN  EASK++QVGLLC QA   LRPSMS VV+MLT E+ EIP+
Sbjct  544  YGMGKSYEAVDPLLEGNFNKEEASKLLQVGLLCVQASAELRPSMSSVVKMLT-ENHEIPQ  602

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  603  PTQPPFLNS  611



>ref|XP_010100421.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
 gb|EXB82555.1| Cysteine-rich receptor-like protein kinase 3 [Morus notabilis]
Length=647

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+L+EKAD+YSFGVLV+E++ GRK+N+F   S S+LQ VW L
Sbjct  481  STAIAGTLGYMAPEYIVRGKLSEKADIYSFGVLVIEIICGRKNNSFTQTSYSVLQMVWNL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T +  + VDP LEG+FN+ EAS+++Q+GL+C QA   LRPSMS VV+MLT E  EIP+
Sbjct  541  YGTGKLSDAVDPGLEGNFNSEEASRLLQIGLVCVQASAELRPSMSSVVKMLT-ESHEIPQ  599

Query  353  PTQPPFINSS  324
            PTQPPFINS+
Sbjct  600  PTQPPFINSA  609



>gb|KHG04179.1| Cysteine-rich receptor-like protein kinase 42 [Gossypium arboreum]
Length=656

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 4/153 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL+EKADVYSFGVLVLE+V G+K+++F   +GSLLQTVW L
Sbjct  482  STGIAGTLGYMAPEYLVRGQLSEKADVYSFGVLVLEIVCGKKNSSFTT-TGSLLQTVWTL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E +DP +  + +  EA +V+QVGLLC QA   LRPSM+EVV+MLT +D EIP 
Sbjct  541  YRSNVLAEAIDPCIRDEMSEKEAPEVLQVGLLCTQASVLLRPSMAEVVQMLTDKDYEIPT  600

Query  353  PTQPPFINSSVLAGG---SMSSIKSLVSNALNK  264
            P QPPF+N++VL         S  S V+NAL K
Sbjct  601  PNQPPFLNANVLEAASSSRSCSTDSFVNNALKK  633



>ref|XP_010027508.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 isoform 
X1 [Eucalyptus grandis]
Length=640

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 113/144 (78%), Gaps = 4/144 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE++SGRK+  F   SGS+LQ+VW+ 
Sbjct  477  STGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILSGRKNRIFGQASGSVLQSVWKQ  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE--I  360
            Y+++   E +DP L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  +DRE  +
Sbjct  537  YKSNSLAECIDPVLKGKFPVSEALNVIQIALLCTQASPDLRPSMSEVVEML--KDRECIV  594

Query  359  PEPTQPPFINSSVLAGGSMSSIKS  288
            P PTQPPF+N++++   S  S+ +
Sbjct  595  PVPTQPPFLNNNLIPDDSSRSLNT  618



>gb|KEH22098.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=654

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 113/148 (76%), Gaps = 2/148 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLT+KADVYSFGVLVLE+V GR++N   +DSGSLLQ VW+ 
Sbjct  473  STGIAGTLGYMAPEYLIRGQLTDKADVYSFGVLVLEIVCGRRNNVIREDSGSLLQNVWKH  532

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR++   E +D SL  D    E S+V+ +GLLC QA  +LRPSM++VV+ML+  D ++P 
Sbjct  533  YRSNTLVETIDSSLGDDIPEAEPSRVLHIGLLCTQASASLRPSMTQVVKMLSNSDLDVPT  592

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNAL  270
            P QPPF +S++L   S SSI+S  +N+ 
Sbjct  593  PNQPPFFSSAIL--DSESSIRSYSTNSF  618



>ref|XP_010249418.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nelumbo 
nucifera]
Length=635

 Score =   180 bits (456),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 110/139 (79%), Gaps = 1/139 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE+V GRK++ F  D+GS+LQTVW  
Sbjct  480  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNSVFTQDTGSVLQTVWNN  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++++   E VD  L+ +F+  EAS  +Q+GLLC Q   +LRPSMS+VV+MLT ED  IP 
Sbjct  540  FKSNTLPESVDKCLKDEFSVKEASNALQIGLLCTQTSVSLRPSMSDVVQMLTNEDFPIPL  599

Query  353  PTQPPFINSSVLAGGSMSS  297
            P QPPF+N+SV+ G  MS+
Sbjct  600  PVQPPFLNASVM-GAPMST  617



>emb|CDP01560.1| unnamed protein product [Coffea canephora]
Length=564

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN-AFADDSGSLLQTVWR  537
            ST +AGTLGYMAPEYLV+GQLTEKADVYSFG+LVLE+V GRK N A  +DSGSLLQTVW 
Sbjct  423  STELAGTLGYMAPEYLVKGQLTEKADVYSFGILVLEIVCGRKHNYASKEDSGSLLQTVWT  482

Query  536  LYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
             Y+TD+  E+VDP L+G+F A EA  V+++GLLC QA    RPSM EVV+MLT+ +  IP
Sbjct  483  FYQTDKLEELVDPCLKGNFPALEAWNVLKIGLLCGQASATSRPSMVEVVQMLTVPNCAIP  542

Query  356  EPTQPPFINSS  324
            EP QPPF+NS+
Sbjct  543  EPNQPPFLNSN  553



>gb|KCW83327.1| hypothetical protein EUGRSUZ_B00255 [Eucalyptus grandis]
Length=659

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRKS+ FA  S S+LQ+VW+ 
Sbjct  482  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSVFAQGSSSVLQSVWKH  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     VDP+L+G F   EAS ++Q+ LLC QA   LRP+MS VVEML   D  +PE
Sbjct  542  YKSNNLAACVDPALQGKFPVPEASDMLQISLLCTQASMELRPTMSVVVEMLRNRDHAVPE  601

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  602  PKQPPFLNASVLS  614



>ref|XP_010027449.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=668

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRKS+ FA  S S+LQ+VW+ 
Sbjct  491  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILSGRKSSVFAQGSSSVLQSVWKH  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     VDP+L+G F   EAS ++Q+ LLC QA   LRP+MS VVEML   D  +PE
Sbjct  551  YKSNNLAACVDPALQGKFPVPEASDMLQISLLCTQASMELRPTMSVVVEMLRNRDHAVPE  610

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  611  PKQPPFLNASVLS  623



>gb|KCW45209.1| hypothetical protein EUGRSUZ_L01156, partial [Eucalyptus grandis]
Length=238

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYLVRGQLTEKADVY+FGVLV+E+++GRK++ +   S S+LQ+VW  
Sbjct  92   STGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVMEILTGRKNSVYTRGSSSILQSVWEH  151

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  +DR +P+
Sbjct  152  YKSNNLAVCIDPALQGKFPVLEVSNVLQISLLCTQASMELRPPMSGVVEMLHDKDRVVPQ  211

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  212  PNQPPFLNASVL  223



>ref|XP_002511372.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF51974.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=614

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGYMAPEYL+RGQLTEKADVYSFGVLVLE+ SG+K++ ++  SGS+L  VW+ 
Sbjct  424  TTGIAGTLGYMAPEYLIRGQLTEKADVYSFGVLVLEIASGKKNSVYSQGSGSILHNVWKH  483

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+     E +DP+L+ +    +A  V+Q+GLLC QA  +LRPSM+EVVEMLT ++ EIP 
Sbjct  484  YKARTLAEAIDPALKDEHPGKDAENVLQIGLLCTQASASLRPSMTEVVEMLTNKECEIPT  543

Query  353  PTQPPFINSSVL-AGGSMSSIKSLVS  279
            P QPPF+N+SVL AGGS  +  + VS
Sbjct  544  PMQPPFLNASVLSAGGSTENSITKVS  569



>ref|XP_009616732.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nicotiana 
tomentosiformis]
Length=649

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G+K+N    ++ SLLQ +W L
Sbjct  484  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIELVCGKKNNYVFQNTNSLLQQLWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   +S E VDPSLEG+FN  EASK++QVGLLC QA   LRPSMS VV+MLT ++ EI +
Sbjct  544  YGIGKSCEAVDPSLEGNFNEEEASKLLQVGLLCVQASAELRPSMSSVVKMLT-DNHEILQ  602

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  603  PTQPPFLNS  611



>ref|XP_010027537.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83355.1| hypothetical protein EUGRSUZ_B00290 [Eucalyptus grandis]
Length=640

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVY+FGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  477  STGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKR  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++R  E +DP+L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++  +P 
Sbjct  537  YKSNRLAECIDPALKGKFPISEALNVIQIALLCTQASPDLRPSMSEVVEMLNDQECIVPM  596

Query  353  PTQPPFINSS  324
            P QPPF+N++
Sbjct  597  PMQPPFLNNN  606



>ref|XP_006584463.1| PREDICTED: protein kinase family protein isoform X2 [Glycine 
max]
Length=539

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+VSG+K +++  +S SLLQTVW L
Sbjct  376  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSL  435

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R +E+VDP+LEG F A EA +++Q+GLLC QA   LRPSMS VV+M+   + EIP+
Sbjct  436  YGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVN-NNHEIPQ  494

Query  353  PTQPPFIN  330
            P QPPFIN
Sbjct  495  PAQPPFIN  502



>ref|XP_010042287.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=645

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE++SGRK++ F   SGS+LQ+VW+ 
Sbjct  482  STGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILSGRKNSIFGQASGSVLQSVWKQ  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   E +DP L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  ++  +P 
Sbjct  542  YKANSLAECIDPVLKGKFPVSEALNVLQIALLCTQASPDLRPSMSEVVEMLNDQECAVPV  601

Query  353  PTQPPFINSSVLAGGSMSSIKS  288
            P QPPF+N++++   S  S+ +
Sbjct  602  PMQPPFLNNNLIPDDSSRSLNT  623



>ref|XP_002318677.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa]
 gb|EEE96897.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa]
Length=583

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEK DVY FGVL+LE+ +G+K++ F+  S S+L +VW+ 
Sbjct  410  STGIAGTLGYMAPEYLVRGQLTEKVDVYGFGVLLLEIATGKKNSVFSQGSSSILHSVWKH  469

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   ++VDP L G F+  +A KV+Q+GLLC QA   LRPSM+EVV+MLT    EIP 
Sbjct  470  YKANTITDMVDPGLRGMFSQKQAEKVLQIGLLCTQASSRLRPSMNEVVQMLTDAQCEIPS  529

Query  353  PTQPPFINSSVLA--GGSMSSIK--SLVSNAL  270
            P QPPF+N+SVL+  GG+ S I   SL  N++
Sbjct  530  PKQPPFLNASVLSPDGGADSCITEVSLTCNSV  561



>ref|XP_004300929.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=645

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+ RG+LTEKADVYSFGVLV+E++SG++ N+FA +S S+LQ VW L
Sbjct  480  STAIAGTLGYMAPEYVTRGKLTEKADVYSFGVLVIEIISGKRINSFASNSVSILQAVWVL  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y +D+    VDP LEG+F  NEAS+++QVGLLC QA   LRPSM  VV+MLT ++ EIP 
Sbjct  540  YGSDQLCNAVDPVLEGNFINNEASQLLQVGLLCVQASAELRPSMPLVVKMLTNQNLEIPR  599

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  600  PTQPPFLNS  608



>ref|XP_010045529.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=620

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RGQLTEKADVY+FGVLVLE++SGRK+N +A  S S+LQ+VW+ 
Sbjct  479  STGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNNVYARGSSSVLQSVWKH  538

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ LLC QA   LRP MSEVVEML  ++  +P+
Sbjct  539  YKSNNLAACIDPALQGKFPILEASNVLQISLLCTQACMELRPPMSEVVEMLHDKNHVVPQ  598

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  599  PNQPPFVNTSVL  610



>ref|XP_007153758.1| hypothetical protein PHAVU_003G062700g [Phaseolus vulgaris]
 gb|ESW25752.1| hypothetical protein PHAVU_003G062700g [Phaseolus vulgaris]
Length=655

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY++RG+L+EKADVYSFGVLV+E+VSG+++++F  +S SLLQTVWRL
Sbjct  492  STVIAGTLGYMAPEYVIRGKLSEKADVYSFGVLVIEIVSGKRNSSFIMNSSSLLQTVWRL  551

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  EIVDP+LE  F A EA +++Q+GLLC QA   LRPSMS VV+M+   + EIP+
Sbjct  552  YGSNRLSEIVDPTLECPFPAEEACQLLQIGLLCAQATAELRPSMSVVVKMVN-HNHEIPQ  610

Query  353  PTQPPFINS  327
            PTQPPFINS
Sbjct  611  PTQPPFINS  619



>gb|KHN42529.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=572

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+VSG+K +++  +S SLLQTVW L
Sbjct  409  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSL  468

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R +E+VDP+LEG F A EA +++Q+GLLC QA   LRPSMS VV+M+   + EIP+
Sbjct  469  YGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVN-NNHEIPQ  527

Query  353  PTQPPFIN  330
            P QPPFIN
Sbjct  528  PAQPPFIN  535



>ref|XP_009362983.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Pyrus 
x bretschneideri]
Length=586

 Score =   177 bits (448),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY+FGV+VLE+V G+K+  F + S S+L +VW+ 
Sbjct  424  STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVCGKKNRVFVEGSSSVLYSVWKH  483

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+     E VDP+L+G F   EAS V+Q+GL+C QA  A+RPSM+EVV MLT E   IP 
Sbjct  484  YKEKNITETVDPTLKGGFPEREASDVLQIGLMCTQASLAVRPSMAEVVRMLTDEKHVIPS  543

Query  353  PTQPPFINSSVL-AGGSMSSIKSLVS  279
            P QPPF+N+S+L +  S +SIK  +S
Sbjct  544  PKQPPFLNASILNSDASKASIKYTLS  569



>gb|KJB11529.1| hypothetical protein B456_001G263700 [Gossypium raimondii]
Length=605

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 111/154 (72%), Gaps = 4/154 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGYMAPEYL+RGQLTEKADVYSFGVLVLE+V G+++  F+ DS SLLQTVW L
Sbjct  429  STGVAGTLGYMAPEYLIRGQLTEKADVYSFGVLVLEIVCGKRNATFSKDSSSLLQTVWTL  488

Query  533  YRTDRSFEIVDPSLEGDFNANEA-SKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
            YR++R  E VDP +  +  A      V+Q+GLLC QA  +LRPSM EVV+MLT  D EIP
Sbjct  489  YRSNRLAEAVDPCIRDEILAKGGPDYVLQIGLLCTQASVSLRPSMVEVVQMLTDTDCEIP  548

Query  356  EPTQPPFINSSVLA---GGSMSSIKSLVSNALNK  264
             P QPPFIN +V          S+ S +SNA+ K
Sbjct  549  IPNQPPFINGNVQEPERSTKSYSLDSFISNAVKK  582



>ref|XP_006841048.1| hypothetical protein AMTR_s00085p00155370 [Amborella trichopoda]
 gb|ERN02723.1| hypothetical protein AMTR_s00085p00155370 [Amborella trichopoda]
Length=638

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RG+LTEKADVYSFGVL++E++SGR+ N+++  +G +LQ VW L
Sbjct  483  STGIAGTLGYMAPEYIIRGKLTEKADVYSFGVLIVEILSGRRVNSYSQTTGPVLQVVWDL  542

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR+ R +E VDPSLEG ++  + S+V+Q+GLLC QA   LRPSM+ VV+ML   +  IP 
Sbjct  543  YRSCRLYEAVDPSLEGGYSREDVSRVLQIGLLCTQASAELRPSMALVVQMLKDTNCNIPL  602

Query  353  PTQPPFINSSVL  318
            PTQPPFIN+ +L
Sbjct  603  PTQPPFINTGLL  614



>ref|XP_004141193.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cucumis sativus]
 ref|XP_004164734.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cucumis sativus]
Length=601

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 119/153 (78%), Gaps = 6/153 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVL+LE+V GR++++F ++S  LLQTVW L
Sbjct  422  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLILEIVCGRRNSSFTENSTPLLQTVWDL  481

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIE-DREIP  357
            Y+T+R  E +D SL  D+ A EA  ++Q+GLLC QA+ +LRPSM+ +V++LT + +R++ 
Sbjct  482  YKTERLTEAIDTSLNKDYPAKEAMDILQIGLLCTQALASLRPSMATIVKLLTSDVERKVG  541

Query  356  EPTQPPFINSSVLAGGSMSS--IKSLVSNALNK  264
             P QPPF+N     G S  S  I SLVS+A++K
Sbjct  542  IPEQPPFLNP---CGTSKRSCRISSLVSHAVSK  571



>emb|CAN64525.1| hypothetical protein VITISV_005912 [Vitis vinifera]
Length=690

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEK DVY FGVLV+E+V G+++N+F  DS S+LQ VW L
Sbjct  442  STAIAGTLGYMAPEYVVRGKLTEKVDVYGFGVLVIEVVCGKRNNSFTQDSFSILQMVWNL  501

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R +E VDPSL G+F  + AS+V++VGLLC QA   LRPSMS VV+MLT E+ E P+
Sbjct  502  YGTGRLYEAVDPSLGGNFQEDMASRVLKVGLLCVQASAELRPSMSLVVKMLT-ENHETPQ  560

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  561  PTQPPFLNS  569



>ref|XP_006584462.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
Length=657

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+VSG+K +++  +S SLLQTVW L
Sbjct  494  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEIVSGKKISSYIMNSSSLLQTVWSL  553

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R +E+VDP+LEG F A EA +++Q+GLLC QA   LRPSMS VV+M+   + EIP+
Sbjct  554  YGSNRLYEVVDPTLEGAFPAEEACQLLQIGLLCAQASAELRPSMSVVVKMVN-NNHEIPQ  612

Query  353  PTQPPFIN  330
            P QPPFIN
Sbjct  613  PAQPPFIN  620



>ref|XP_010251164.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nelumbo 
nucifera]
Length=640

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%), Gaps = 2/144 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE+V GRK+  F  ++GS+LQ VW+ 
Sbjct  481  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEIVCGRKNTIFVQETGSVLQRVWKH  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++++   E VDP L+ DF   EAS V+Q+GLLC QA  +LRP M +VV+MLT +   IP 
Sbjct  541  FQSNTLPECVDPCLKDDFPVKEASDVLQIGLLCTQASVSLRPFMPDVVQMLTDKSVSIPL  600

Query  353  PTQPPFINSSVLAGGSMSSIKSLV  282
            P QPPF+NS+++     +SIKS +
Sbjct  601  PRQPPFLNSTIM--DPTTSIKSFI  622



>ref|XP_009377193.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Pyrus 
x bretschneideri]
Length=677

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 117/160 (73%), Gaps = 12/160 (8%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDS--GSLLQTVW  540
            STGIAGT GYMAPEYL +GQLTEKADVYSFGVLVLE+VSG+++N F  +S   SLL  VW
Sbjct  491  STGIAGTFGYMAPEYLTQGQLTEKADVYSFGVLVLEIVSGQRNNTFRSESDPDSLLHRVW  550

Query  539  RLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREI  360
            +LYR++   ++VDP L  DF A +AS V+++GLLC QA  ALRPSM+EVVEMLT  DREI
Sbjct  551  KLYRSNELAKVVDPCLGEDFPAGDASNVLRIGLLCTQASVALRPSMAEVVEMLT--DREI  608

Query  359  ----PEPTQPPFINSSVLAGGS----MSSIKSLVSNALNK  264
                P P QPPF+NS+ L   S    + S  S +SNAL K
Sbjct  609  MAAVPSPKQPPFLNSTTLEPVSTRFRLYSANSSMSNALTK  648



>ref|XP_010045537.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=589

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  448  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSSVLQSVWKH  507

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  ++R +P+
Sbjct  508  YKSNNLAACIDPALQGKFPILEASNVLQIGLLCTQAYMELRPPMSGVVEMLHDKNRVVPQ  567

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+SVL   S S
Sbjct  568  PSQPPFVNASVLFDKSSS  585



>ref|XP_004238643.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Solanum 
lycopersicum]
Length=649

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG LTEKADVYSFGVLV+E+V G+K+N    ++ SLLQ +W L
Sbjct  484  STAIAGTLGYMAPEYVVRGILTEKADVYSFGVLVVEVVCGKKNNYVFKNTNSLLQQLWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   +S E VDP LEG+FN  EASK++QVGL+C QA   LRPSMS VV+ML+ E+ EIP+
Sbjct  544  YGMGKSNEAVDPLLEGNFNKEEASKLLQVGLVCVQASAELRPSMSSVVKMLS-ENHEIPQ  602

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  603  PTQPPFLNS  611



>gb|KCW83338.1| hypothetical protein EUGRSUZ_B00270 [Eucalyptus grandis]
Length=608

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  467  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSSVLQSVWKH  526

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  ++R +P+
Sbjct  527  YKSNNLAACIDPALQGKFPILEASNVLQIGLLCTQAYMELRPPMSGVVEMLHDKNRVVPQ  586

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+SVL   S S
Sbjct  587  PSQPPFVNASVLFDKSSS  604



>ref|XP_007211016.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica]
 gb|EMJ12215.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica]
Length=633

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY+FGV+VLE+VSGRK+  FA+ S S+L  VW+ 
Sbjct  467  STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVSGRKNRVFAEGSSSILYAVWKH  526

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+     E VDP L+G F   EAS V+++GLLC QA  A+RPSM+EVV+MLT ++  IP 
Sbjct  527  YKARNITEAVDPILKGGFPEREASDVLRIGLLCTQASLAVRPSMTEVVQMLTDKECVIPS  586

Query  353  PTQPPFINSSVLAGG-SMSSIKSLVSNALN  267
            P +PPF+N+S+L+   S +S+K  +S  ++
Sbjct  587  PKRPPFLNASILSSDVSRTSMKYFLSQPID  616



>ref|XP_006841049.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda]
 gb|ERN02724.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda]
Length=644

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLE++ GRK++ +A  SGS+LQ+VW  
Sbjct  480  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEVICGRKNSVYAPQSGSILQSVWEH  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++++   E VD  L  +F A +AS V+Q+GLLC QA   LRPSMS VV MLT +D  IP 
Sbjct  540  FKSNSLAEAVDQGLRDNFPARQASNVLQIGLLCTQASANLRPSMSTVVRMLTDDDHPIPL  599

Query  353  PTQPPFINSSVL  318
            P QPPF+N++V+
Sbjct  600  PMQPPFLNTNVI  611



>ref|XP_008245018.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Prunus 
mume]
Length=648

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY+FGV+VLE+VSGRK+  FA+ S S+L  VW+ 
Sbjct  482  STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVSGRKNRVFAEGSSSILYAVWKH  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+     E VDP L+G F   EAS V+++GLLC QA  A+RPSM+EVV+MLT ++  IP 
Sbjct  542  YKARNITEAVDPILKGGFPEREASDVLRIGLLCTQASLAVRPSMTEVVQMLTDKECVIPS  601

Query  353  PTQPPFINSSVLAGG-SMSSIKSLVSNALN  267
            P +PPF+N+S+L+   S +S+K  +S  ++
Sbjct  602  PKRPPFLNASILSSDVSRTSMKYFLSQPID  631



>ref|XP_002266015.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Vitis 
vinifera]
 emb|CBI28579.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEK DVY FGVLV+E+V G+++N+F  DS S+LQ VW L
Sbjct  485  STAIAGTLGYMAPEYVVRGKLTEKVDVYGFGVLVIEVVCGKRNNSFTQDSFSILQMVWNL  544

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R +E VDPSL G+F  + AS+V++VGLLC QA   LRPSMS VV+MLT E+ E P+
Sbjct  545  YGTGRLYEAVDPSLGGNFQEDMASRVLKVGLLCVQASAELRPSMSLVVKMLT-ENHETPQ  603

Query  353  PTQPPFINS  327
            PTQPPF++S
Sbjct  604  PTQPPFLHS  612



>gb|KHG06976.1| Cysteine-rich receptor-like protein kinase 42 [Gossypium arboreum]
Length=596

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 114/155 (74%), Gaps = 6/155 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGYMAPEYL+RGQLTEKADVYSFG+LVLE+V G+++  F+ DS SLLQ VW L
Sbjct  420  STGVAGTLGYMAPEYLIRGQLTEKADVYSFGILVLEIVCGKRNATFSKDSSSLLQAVWTL  479

Query  533  YRTDRSFEIVDPSLEGDFNANEA-SKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
            YR++R  E VDP +  +  A  +   V+Q+GLLC QA  +LRPSM EVV+MLT +D EIP
Sbjct  480  YRSNRLAEAVDPCIRDEILAKVSPDYVLQIGLLCTQASVSLRPSMVEVVQMLTDKDCEIP  539

Query  356  EPTQPPFINSSV----LAGGSMSSIKSLVSNALNK  264
             P QPPFIN +V     +  S SS  S +SNA+ K
Sbjct  540  IPNQPPFINGNVQEPERSTKSYSS-DSFISNAVKK  573



>ref|XP_008390081.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Malus 
domestica]
Length=381

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY VRG+LTEKADVYSFGVLV+E++ GR++N+    S S+LQ  W L
Sbjct  225  STAIAGTLGYMAPEYAVRGKLTEKADVYSFGVLVIEVICGRRNNSVLSSSTSILQMTWDL  284

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R  E VDP LEG F   EAS+++Q+GLLC QA   LRP+MS VV+MLT E+ EIP+
Sbjct  285  YGTCRLREAVDPLLEGKFENEEASRLLQIGLLCVQASAELRPAMSLVVKMLT-ENLEIPQ  343

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  344  PTQPPFLNS  352



>ref|XP_003552033.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
Length=656

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+VSG+K +A+  +S SLL TVW L
Sbjct  493  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEIVSGKKISAYIMNSSSLLHTVWSL  552

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  E+VDP+LEG F A  A +++Q+GLLC QA   LRPSMS VV+M+   D EIP+
Sbjct  553  YGSNRLSEVVDPTLEGAFPAEVACQLLQIGLLCAQASAELRPSMSVVVKMVN-NDHEIPQ  611

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  612  PTQPPFMNS  620



>gb|KCW83328.1| hypothetical protein EUGRSUZ_B00256 [Eucalyptus grandis]
Length=330

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGT+GYMAPEYLVRGQLTEKADVY+FGVLV+E+++GRK++ +   S S+LQ+VW  
Sbjct  184  NTGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVMEILTGRKNSVYTRGSSSILQSVWEH  243

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  +DR +P+
Sbjct  244  YKSNNLAVCIDPALQGKFPVLEVSNVLQISLLCTQASMELRPPMSGVVEMLHDKDRVVPQ  303

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  304  PNQPPFLNASVL  315



>ref|XP_010045536.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=330

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL EKADVY+FGVLVLE++ GRK++A+   S S+LQ VW+ 
Sbjct  184  STGIAGTLGYMAPEYLVRGQLIEKADVYAFGVLVLEILIGRKNSAYTQGSSSVLQLVWKH  243

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ LLC QA   LRP M  VVEML  +DR +P+
Sbjct  244  YKSNNLAACIDPALQGKFPILEASNVLQICLLCTQASMELRPPMPRVVEMLHDKDRIVPQ  303

Query  353  PTQPPFINSSVL  318
            P QPPF+N+S+L
Sbjct  304  PNQPPFLNASML  315



>gb|KCW45358.1| hypothetical protein EUGRSUZ_L00960 [Eucalyptus grandis]
Length=630

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = -3

Query  710  TGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLY  531
            TGIAGT+GYMAPEYLVRGQLTEKADVY+FGVLVLE+++GRK++ +   S S+LQ+VW+ Y
Sbjct  485  TGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGRKNSVYTQGSSSILQSVWKHY  544

Query  530  RTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEP  351
            ++      +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  +D+ +P+P
Sbjct  545  KSTNLAACIDPTLQGKFLVLEASNVLQIGLLCTQASMELRPPMSRVVEMLHDKDQVVPQP  604

Query  350  TQPPFINSSVL  318
             QPPF+N+SVL
Sbjct  605  NQPPFLNASVL  615



>ref|XP_010040445.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=631

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL+RGQLTEKADVY+FGVLVLE+++GRK++ +   S S+LQ+VW+ 
Sbjct  485  STGIAGTIGYMAPEYLMRGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKH  544

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  +D+ +P+
Sbjct  545  YKSNNLAACIDPALQGKFPVLEASNVLQIGLLCTQASMELRPPMSGVVEMLHNKDQVVPQ  604

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  605  PNQPPFLNASVL  616



>gb|KCW45208.1| hypothetical protein EUGRSUZ_L01155 [Eucalyptus grandis]
Length=621

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL+RGQLTEKADVY+FGVLVLE+++GRK++ +   S S+LQ+VW+ 
Sbjct  475  STGIAGTIGYMAPEYLMRGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKH  534

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  +D+ +P+
Sbjct  535  YKSNNLAACIDPALQGKFPVLEASNVLQIGLLCTQASMELRPPMSGVVEMLHNKDQVVPQ  594

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPF+N+SVL   S S
Sbjct  595  PNQPPFLNASVLFDKSSS  612



>gb|KCW83341.1| hypothetical protein EUGRSUZ_B00274 [Eucalyptus grandis]
Length=621

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE+++GRK+N +   S  +LQ VW+ 
Sbjct  475  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGRKNNVYTQGSNLVLQLVWKH  534

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F+  EAS V+Q+ LLC QA   LRP M  VVEML  +DR IP+
Sbjct  535  YKSNNLAACIDPALQGKFSVLEASNVLQISLLCTQASMELRPPMPGVVEMLHDKDRIIPQ  594

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  595  PNQPPFLNASVL  606



>ref|XP_007036266.1| Cysteine-rich RLK 42, putative [Theobroma cacao]
 gb|EOY20767.1| Cysteine-rich RLK 42, putative [Theobroma cacao]
Length=649

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY+FGV+VLE+ +GRK++ F++ S S+L +VW+ 
Sbjct  479  STAIAGTLGYMAPEYLVRGQLTEKADVYAFGVVVLEIATGRKNSVFSEGSSSILYSVWKN  538

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ D   + +D  L G F   EAS V+ VGLLC QA  ALRPSM+EVV+MLT +  EIP 
Sbjct  539  YKADTITQAIDSGLRGRFEEREASSVLLVGLLCTQASAALRPSMAEVVQMLTDKSCEIPS  598

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  599  PKQPPFLNASVLS  611



>ref|XP_002527897.1| kinase, putative [Ricinus communis]
 gb|EEF34454.1| kinase, putative [Ricinus communis]
Length=649

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+VSG+++N+F  DSGS+LQ VW L
Sbjct  484  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLLIEVVSGKRNNSFVQDSGSILQMVWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R +E VDP L G+F   EAS+++QVGLLC QA   LRP+MS  V+ML+    E+ +
Sbjct  544  YGTGRLWEAVDPVLAGNFQEEEASRLLQVGLLCVQASAELRPAMSVAVKMLS-GIHELSQ  602

Query  353  PTQPPFINSSV  321
            PTQPPF+N S 
Sbjct  603  PTQPPFLNPST  613



>gb|KJB37078.1| hypothetical protein B456_006G188600 [Gossypium raimondii]
Length=635

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY FGVLVLE+ +GRK++ F++ S S+L +VW+ 
Sbjct  470  STAIAGTLGYMAPEYLVRGQLTEKADVYGFGVLVLEIATGRKNSVFSEGSSSILYSVWKQ  529

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ D   + +DP LEG F   EAS V+ VGLLC Q   A+RPSM +V++MLT    EIP 
Sbjct  530  YKADHITQSIDPGLEGKFEEREASNVLLVGLLCTQPSVAIRPSMHDVLQMLTNAHCEIPC  589

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  590  PKQPPFLNASVLS  602



>ref|XP_010251163.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Nelumbo 
nucifera]
Length=646

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 109/138 (79%), Gaps = 1/138 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G++ ++F  DS ++LQ VW L
Sbjct  483  STAIAGTLGYMAPEYIVRGKLTEKADVYSFGVLVIEVVCGKRISSFTQDSYNILQMVWNL  542

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y + R +E VDPSL   F   +AS+++Q+GLLC QA   LRPSMS VV+MLT ++ +IP+
Sbjct  543  YGSARLYEAVDPSLASRFQKEQASRLLQIGLLCTQASAELRPSMSMVVKMLT-DNHDIPK  601

Query  353  PTQPPFINSSVLAGGSMS  300
            PTQPPF+NS+ +   S+S
Sbjct  602  PTQPPFLNSNNVGPSSIS  619



>ref|XP_010045527.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83331.1| hypothetical protein EUGRSUZ_B00259 [Eucalyptus grandis]
Length=637

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SG+K++ +   S S+L +VW+ 
Sbjct  491  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNSTYTQGSSSVLNSVWKH  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L G F   E S+++Q+ LLC QA   LRP MSEV+EML  +DR +P+
Sbjct  551  YKSNNLAACIDPALRGKFPVLEVSRLLQISLLCTQACMELRPPMSEVIEMLHDKDRVVPQ  610

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  611  PNQPPFVNASVL  622



>ref|XP_008341436.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Malus 
domestica]
Length=663

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 116/160 (73%), Gaps = 12/160 (8%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDS--GSLLQTVW  540
            STGIAGT GYMAPEYL++GQLTEKADVYSFGVLVLE+VSG++++ F  +S   SLL  VW
Sbjct  477  STGIAGTFGYMAPEYLIQGQLTEKADVYSFGVLVLEIVSGQRNSTFRSESDPDSLLHRVW  536

Query  539  RLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREI  360
            +LYR++    +VDP L  DF A +AS V+++GLLC QA  ALRPSM+EVVEMLT  DREI
Sbjct  537  KLYRSNXLAXVVDPCLGEDFPAGDASNVLRIGLLCTQASVALRPSMAEVVEMLT--DREI  594

Query  359  ----PEPTQPPFINSSVLAGGSMS----SIKSLVSNALNK  264
                P P QPPF+NS+ +   S      S  S +SNAL K
Sbjct  595  MAAVPSPKQPPFLNSTTIEPVSTRFRSYSATSSMSNALTK  634



>ref|XP_010040447.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=259

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SG+K++ +   S S    VW+ 
Sbjct  117  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNSTYTQGSSS----VWKH  172

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L G F   EAS+++Q+ LLC QA   LRP MSEV+EML  +DR +P+
Sbjct  173  YKSNNLAACIDPALLGKFPVLEASRLLQISLLCTQACMELRPPMSEVIEMLHDKDRVVPQ  232

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPF+N+S+L   S S
Sbjct  233  PNQPPFVNASMLFDNSSS  250



>ref|XP_008443549.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Cucumis 
melo]
Length=662

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 118/153 (77%), Gaps = 6/153 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGY+APEYLVRGQLTEKADVYSFGVL+LE+V GR++++F ++S  LLQTVW L
Sbjct  483  STGIAGTLGYIAPEYLVRGQLTEKADVYSFGVLILEIVCGRRNSSFTENSTPLLQTVWDL  542

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIE-DREIP  357
            Y+T+R    +D SL  D+ A EA  V+Q+GLLC QA+ +LRPSM+ +V++LT + +R++ 
Sbjct  543  YKTERLTAAIDTSLNKDYPAKEAMDVLQIGLLCTQALASLRPSMATIVKLLTSDVERKVG  602

Query  356  EPTQPPFINSSVLAGGSMSS--IKSLVSNALNK  264
             P QPPF+N     G S  S  I SLVS+A++K
Sbjct  603  IPEQPPFLNP---CGPSRRSCRISSLVSHAVSK  632



>ref|XP_010045539.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=325

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEY++RGQLTEK DVY+FGVLVLE++SG K+N +A    S+LQ+VW+ 
Sbjct  184  STGIAGTIGYMAPEYIMRGQLTEKVDVYAFGVLVLEILSGMKNNVYARGLSSVLQSVWKH  243

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  ++R +P+
Sbjct  244  YKSNNLAMCIDSALQGKFPILEASNVLQIGLLCNQACMELRPPMSGVVEMLHNKNRVVPQ  303

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPFIN+S+L   S S
Sbjct  304  PNQPPFINASLLFDKSSS  321



>ref|XP_011040494.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Populus 
euphratica]
Length=595

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEK DVY FGVL+LE+ +G+K++ F+  S S+L +VW+ 
Sbjct  422  STGIAGTLGYMAPEYLVRGQLTEKVDVYGFGVLLLEIATGKKNSVFSQGSSSILHSVWKH  481

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   ++VDP L G F+  +A KV+Q+GLLC QA   LRPSM+ VV+MLT    +IP 
Sbjct  482  YKANTITDMVDPGLRGMFSQKQAEKVLQIGLLCTQASSRLRPSMNGVVQMLTDAQCQIPS  541

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  542  PKQPPFLNASVLS  554



>gb|KCW83337.1| hypothetical protein EUGRSUZ_B00269 [Eucalyptus grandis]
Length=499

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQL EKADVY+FGVLVLE++ GRK++A+   S S+LQ VW+ 
Sbjct  353  STGIAGTLGYMAPEYLVRGQLIEKADVYAFGVLVLEILIGRKNSAYTQGSSSVLQLVWKH  412

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ LLC QA   LRP M  VVEML  +DR +P+
Sbjct  413  YKSNNLAACIDPALQGKFPILEASNVLQICLLCTQASMELRPPMPRVVEMLHDKDRIVPQ  472

Query  353  PTQPPFINSSVL  318
            P QPPF+N+S+L
Sbjct  473  PNQPPFLNASML  484



>gb|KJB39164.1| hypothetical protein B456_007G001400 [Gossypium raimondii]
Length=327

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY+FGVL+LE+ +GRK+N F++ S S L  VW+ 
Sbjct  170  STAIAGTLGYMAPEYLVRGQLTEKADVYAFGVLMLEIATGRKNNVFSERSSSTLYLVWKQ  229

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   + +D +L+G F+  EAS V++VGLLC Q+  ALRP+MSEV + LT     IP 
Sbjct  230  YKAESITQAIDSTLKGRFDEREASIVLRVGLLCTQSSVALRPTMSEVAQTLTDRRCVIPS  289

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNALN  267
            P QPPF+N+SVL+     +   + S+ALN
Sbjct  290  PKQPPFLNASVLSPEDAMTSSFMGSSALN  318



>ref|XP_010045541.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=618

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  477  STGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVLQSVWKH  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++      DP+L+G F   EAS V+Q+ LLC QA   LRP MS VVEML  ++R +P+
Sbjct  537  YKSNNLAACSDPALQGKFPILEASNVLQISLLCTQACMELRPPMSRVVEMLHDKNRVVPQ  596

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+S+L   S S
Sbjct  597  PSQPPFVNASLLFDKSSS  614



>emb|CDY47146.1| BnaA08g05370D [Brassica napus]
Length=618

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++GR++NAF+ DS S+LQTVWRL
Sbjct  455  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDSSSILQTVWRL  514

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VDP L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  515  YGTSNFVQVVDPVLGDNFNKMEASRLLEIGLLCVQAAFDQRPAMSAVVKMMK-GSLEIPT  573

Query  353  PTQPPFIN-SSVLAGGSMSS  297
            PTQPPF+N  SVL    M S
Sbjct  574  PTQPPFLNPGSVLEMRKMMS  593



>ref|XP_008393012.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Malus 
domestica]
Length=641

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY+FGV+VLE+V G+K+  F + S S+L +VW+ 
Sbjct  479  STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVMVLEIVCGKKNRVFVEGSSSVLYSVWKH  538

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+     E VDP+L+G F    AS V+Q+GL+C QA  A+RPSM+EVV MLT E   IP 
Sbjct  539  YKEKNITETVDPTLKGGFPERGASDVLQIGLMCTQASLAVRPSMAEVVRMLTDEKHVIPS  598

Query  353  PTQPPFINSSVL  318
            P QPPF N+S+L
Sbjct  599  PKQPPFXNASIL  610



>ref|XP_008230569.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Prunus 
mume]
Length=663

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 105/134 (78%), Gaps = 4/134 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFA---DDSGSLLQTV  543
            STGIAGTLGYMAPEYLV+GQLTE+ADVYSFGVLVLE+VSG++++ F    DD  SLL  V
Sbjct  480  STGIAGTLGYMAPEYLVQGQLTERADVYSFGVLVLEIVSGKRNSTFRQDWDDPDSLLHKV  539

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDR-  366
            W+LY ++     VDP L  DF A EAS+V+Q+GLLC QA  ALRPSM+EVV MLT ++R 
Sbjct  540  WKLYISNDLARAVDPCLRDDFPAEEASRVLQIGLLCTQASVALRPSMAEVVAMLTNKERA  599

Query  365  EIPEPTQPPFINSS  324
             +P P QPPF+N++
Sbjct  600  AVPNPNQPPFLNAT  613



>ref|XP_008389699.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Malus 
domestica]
Length=647

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG LTEKADVYSFGVLV+E++SGR++N+    S S+L+  W L
Sbjct  482  STAIAGTLGYMAPEYVVRGMLTEKADVYSFGVLVIEIISGRRNNSVFSSSTSILKMTWDL  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R  E VDP LEG F   EAS+++Q+GLLC QA   LRP+MS VV+MLT E+ EIP+
Sbjct  542  YGTCRLCEAVDPLLEGKFENEEASRLLQIGLLCMQASAELRPAMSLVVKMLT-ENLEIPQ  600

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  601  PTQPPFLNS  609



>gb|KCW83344.1| hypothetical protein EUGRSUZ_B00278 [Eucalyptus grandis]
Length=611

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  470  STGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVLQSVWKH  529

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++      DP+L+G F   EAS V+Q+ LLC QA   LRP MS VVEML  ++R +P+
Sbjct  530  YKSNNLAACSDPALQGKFPILEASNVLQISLLCTQACMELRPPMSRVVEMLHDKNRVVPQ  589

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+S+L   S S
Sbjct  590  PSQPPFVNASLLFDKSSS  607



>ref|XP_009105722.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Brassica 
rapa]
Length=648

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++GR++NAF+ DS S+LQTVWRL
Sbjct  485  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDSSSILQTVWRL  544

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VDP L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  545  YGTSNFVQVVDPVLGDNFNKMEASRLLEIGLLCVQAAFDQRPAMSAVVKMMK-GSLEIPT  603

Query  353  PTQPPFIN-SSVLAGGSMSS  297
            PTQPPF+N  SVL    M S
Sbjct  604  PTQPPFLNPGSVLEMRKMMS  623



>ref|NP_198854.3| cysteine-rich receptor-like protein kinase 42 [Arabidopsis thaliana]
 sp|Q9FNE1.1|CRK42_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 42; 
Short=Cysteine-rich RLK42; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB11593.1| receptor-like serine/threonine kinase [Arabidopsis thaliana]
 gb|AED94540.1| cysteine-rich receptor-like protein kinase 42 [Arabidopsis thaliana]
Length=651

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G + NAF  ++G LLQ VW L
Sbjct  473  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRINAFVPETGHLLQRVWNL  532

Query  533  YRTDRSFEIVDPSLEGDF-----NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E +DP L+ +F     +  EA KV++VGLLC QA P+LRPSM EV+ MLT  D
Sbjct  533  YTLNRLVEALDPCLKDEFLQVQGSEAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERD  592

Query  368  REIPEPTQPPFINSSVLA  315
              IP PT PPF+  S L 
Sbjct  593  YPIPSPTSPPFLRVSSLT  610



>gb|KDP31073.1| hypothetical protein JCGZ_11449 [Jatropha curcas]
Length=610

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY FGVLVLE+ +G+K++ ++  S S+L +VWR 
Sbjct  423  STGIAGTLGYMAPEYLIRGQLTEKADVYGFGVLVLEIATGKKNSVYSQGSSSILHSVWRH  482

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+  R  E +DP L       EA  V+Q+GLLC QA  +LRP+M+E+++MLT ++ ++P 
Sbjct  483  YKAKRIIEAIDPKLRDILPCKEAEIVLQLGLLCTQASASLRPTMAEIIQMLTDKECQMPS  542

Query  353  PTQPPFINSSVLAG  312
            P QPPF+N+S+L+ 
Sbjct  543  PKQPPFLNASILSA  556



>ref|XP_010045540.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83343.1| hypothetical protein EUGRSUZ_B00276 [Eucalyptus grandis]
Length=628

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  487  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVLQSVWKH  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  ++  +P+
Sbjct  547  YKSNNLVACIDPALQGKFPILEVSNVLQISLLCTQACMELRPPMSGVVEMLHDKNHVVPQ  606

Query  353  PTQPPFINSSVL  318
            P+QPPF+N+S+L
Sbjct  607  PSQPPFVNASML  618



>ref|XP_009392180.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Musa 
acuminata subsp. malaccensis]
Length=655

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 108/131 (82%), Gaps = 1/131 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRG+LTEKAD++SFGVL++E+++GR++++ ++D  S LQ VW L
Sbjct  493  STGIAGTLGYMAPEYLVRGRLTEKADIFSFGVLLIEVITGRRNSSRSEDPISTLQEVWNL  552

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  E +DP LEG+F   +A++V+Q+GLLC QA   LRP++S VV+ML ++D  IP 
Sbjct  553  YTSNRLLEAIDPILEGNFPMEKATRVLQIGLLCAQASAELRPAISMVVKML-VDDSPIPS  611

Query  353  PTQPPFINSSV  321
            PTQPPF+NSS+
Sbjct  612  PTQPPFLNSSM  622



>ref|XP_007215016.1| hypothetical protein PRUPE_ppa002530mg [Prunus persica]
 gb|EMJ16215.1| hypothetical protein PRUPE_ppa002530mg [Prunus persica]
Length=661

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 4/133 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFA---DDSGSLLQTV  543
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE+VSG++++ F    DDS SLL  V
Sbjct  480  STGIAGTLGYMAPEYLVQGQLTEKADVYSFGVLVLEIVSGKRNSTFRQDWDDSDSLLHKV  539

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+LY ++     +DP L  DF A EAS+V+Q+GLLC QA  ALRPSM+EVV MLT ++R 
Sbjct  540  WKLYISNDLARAIDPCLRDDFPAEEASRVLQIGLLCTQASVALRPSMAEVVAMLTNKER-  598

Query  362  IPEPTQPPFINSS  324
            +  P QPPF+N++
Sbjct  599  VAVPNQPPFLNAT  611



>gb|KCW83332.1| hypothetical protein EUGRSUZ_B00260 [Eucalyptus grandis]
Length=600

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 104/132 (79%), Gaps = 6/132 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RGQLTEKADVY+FGVLVLE++SGRK+N +A  S S+LQ+VW+ 
Sbjct  465  STGIAGTLGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNNVYARGSSSVLQSVWKH  524

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+      EAS V+Q+ LLC QA   LRP MSEVVEML  ++  +P+
Sbjct  525  YKSNNLAACIDPALQ------EASNVLQISLLCTQACMELRPPMSEVVEMLHDKNHVVPQ  578

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  579  PNQPPFVNTSVL  590



>gb|KCW83334.1| hypothetical protein EUGRSUZ_B00264 [Eucalyptus grandis]
Length=578

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT GYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  437  STGIAGTFGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSILQSVWKH  496

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ L+C QA   LRP MS VVEML  ++  +P+
Sbjct  497  YKSNNLAACIDPALQGKFPILEASNVLQISLICTQACMELRPPMSRVVEMLHDKNCVLPQ  556

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+SVL   S S
Sbjct  557  PSQPPFLNASVLFDKSSS  574



>ref|XP_008221860.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Prunus mume]
Length=647

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G+++N +  +S S+L   W L
Sbjct  482  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDL  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R   +VDP LEG F+  EAS+++Q+GLLC QA   LRP+MS VV+ML IE+ +IP+
Sbjct  542  YGTGRLCSVVDPLLEGKFDEEEASRLLQIGLLCVQASAELRPAMSLVVKML-IENPKIPQ  600

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  601  PTQPPFLNS  609



>gb|KCW83333.1| hypothetical protein EUGRSUZ_B00261 [Eucalyptus grandis]
Length=621

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVY+FGVLVLE+++GRK++ +   S S+LQ+VW+ 
Sbjct  475  STGIAGTLGYMAPEYLVKGQLTEKADVYAFGVLVLEILTGRKNSVYTRGSSSVLQSVWKH  534

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ LLC Q    LRP M  VVEML  +DR +P+
Sbjct  535  YKSNNLAACIDPTLQGKFPILEASNVLQISLLCTQTSMELRPPMPGVVEMLHDKDRVVPQ  594

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  595  PNQPPFLNASVL  606



>gb|KJB39165.1| hypothetical protein B456_007G001400 [Gossypium raimondii]
Length=404

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY+FGVL+LE+ +GRK+N F++ S S L  VW+ 
Sbjct  247  STAIAGTLGYMAPEYLVRGQLTEKADVYAFGVLMLEIATGRKNNVFSERSSSTLYLVWKQ  306

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   + +D +L+G F+  EAS V++VGLLC Q+  ALRP+MSEV + LT     IP 
Sbjct  307  YKAESITQAIDSTLKGRFDEREASIVLRVGLLCTQSSVALRPTMSEVAQTLTDRRCVIPS  366

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNALN  267
            P QPPF+N+SVL+     +   + S+ALN
Sbjct  367  PKQPPFLNASVLSPEDAMTSSFMGSSALN  395



>ref|XP_007222003.1| hypothetical protein PRUPE_ppa002895mg [Prunus persica]
 gb|EMJ23202.1| hypothetical protein PRUPE_ppa002895mg [Prunus persica]
Length=623

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G+++N +  +S S+L   W L
Sbjct  458  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDL  517

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R    VDP LEG F+  EAS+++Q+GLLC QA   LRP+MS VV+ML IE+ EIP+
Sbjct  518  YGTGRLCSAVDPLLEGKFDEEEASRLLQIGLLCVQASAELRPAMSLVVKML-IENPEIPQ  576

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  577  PTQPPFLNS  585



>ref|XP_008221861.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X2 [Prunus mume]
Length=623

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E+V G+++N +  +S S+L   W L
Sbjct  458  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEVVCGKRNNCYIPNSVSILHMAWDL  517

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T R   +VDP LEG F+  EAS+++Q+GLLC QA   LRP+MS VV+ML IE+ +IP+
Sbjct  518  YGTGRLCSVVDPLLEGKFDEEEASRLLQIGLLCVQASAELRPAMSLVVKML-IENPKIPQ  576

Query  353  PTQPPFINS  327
            PTQPPF+NS
Sbjct  577  PTQPPFLNS  585



>ref|XP_010045542.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83348.1| hypothetical protein EUGRSUZ_B00282 [Eucalyptus grandis]
Length=628

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ VW+ 
Sbjct  487  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVLQLVWKH  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  ++  +P+
Sbjct  547  YKSNNLVACIDPALQGKFPILEVSNVLQISLLCTQACMELRPPMSGVVEMLHDKNCVVPQ  606

Query  353  PTQPPFINSSVL  318
            P+QPPF+N+SVL
Sbjct  607  PSQPPFVNASVL  618



>ref|XP_010044592.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Eucalyptus grandis]
Length=650

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGYMAPEY+VRG+LTEK DVYS+GVL++E++SG+K+ +F++ S S+LQTVW L
Sbjct  484  STGVAGTLGYMAPEYVVRGKLTEKVDVYSYGVLMMEVLSGKKNYSFSESSCSILQTVWNL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            + + R  E +DP LEG F   E S+++Q+GLLC QA   LRPSMS VV+ML  E  E+P 
Sbjct  544  FGSGRLCEAIDPILEGQFQEQEVSRLLQIGLLCVQASAELRPSMSVVVKMLK-ESSELPT  602

Query  353  PTQPPFINSS  324
            PTQPPF+NSS
Sbjct  603  PTQPPFLNSS  612



>ref|XP_010471049.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=654

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  ++GS+LQTVW L
Sbjct  489  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSL  548

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP LE +FN  EAS+++Q+GLLC QA    RP+MS VV+M+   + EI  
Sbjct  549  YRTRNLEEAVDPILEDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GNLEIHT  607

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  608  PTQPPFLN  615



>ref|XP_010045441.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83345.1| hypothetical protein EUGRSUZ_B00279 [Eucalyptus grandis]
Length=624

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY++RG LTEKADVY+FGV+VLE++SGRK++ +A  S S+L +VW+ 
Sbjct  483  STGIAGTLGYMAPEYIMRGLLTEKADVYAFGVMVLEILSGRKNSVYARGSSSVLHSVWKH  542

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EAS V+Q+ LLC Q    LRP MS VVEML  ++R +P+
Sbjct  543  YKSNNLAACIDPALQGKFPILEASNVLQISLLCTQTCMELRPPMSGVVEMLHDKNRVVPQ  602

Query  353  PTQPPFINSSVL  318
            P+QPPF+N+SVL
Sbjct  603  PSQPPFVNASVL  614



>ref|XP_010040446.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=845

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYLVRGQLTEKADVY+FGVLV+E+++GRK++ +   S S+LQ+VW  
Sbjct  699  STGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVMEILTGRKNSVYTRGSSSILQSVWEH  758

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  +DR +P+
Sbjct  759  YKSNNLAVCIDPALQGKFPVLEVSNVLQISLLCTQASMELRPPMSGVVEMLHDKDRVVPQ  818

Query  353  PTQPPFINSSVL  318
            P QPPF+N+SVL
Sbjct  819  PNQPPFLNASVL  830



>gb|KCW83335.1| hypothetical protein EUGRSUZ_B00265 [Eucalyptus grandis]
Length=620

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 104/132 (79%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  479  STGIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGRKNSVYIRGSSSVLQSVWKH  538

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP+L+G F   EA  V+Q+ LLC QA   LRP MS VV+ML  ++  +P+
Sbjct  539  YKSNNLAACIDPALQGKFPILEALNVLQISLLCTQAYMELRPPMSGVVKMLHDKNYVVPQ  598

Query  353  PTQPPFINSSVL  318
            P+QPPFIN+SVL
Sbjct  599  PSQPPFINASVL  610



>ref|XP_011045283.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X2 [Populus euphratica]
Length=563

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEK DVYSFGVLV+E+VSG+  ++   DS S+LQ VW L
Sbjct  398  STAIAGTLGYMAPEYVVRGKLTEKVDVYSFGVLVIEVVSGKGKDSVPQDSRSILQKVWSL  457

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            +   R  E VDP LEG+F  +EAS+++Q+GLLC QA P LRPSMS +V+M+  +  EIP+
Sbjct  458  HGNGRLCEAVDPVLEGNFQEDEASRLLQIGLLCVQASPELRPSMSIIVKMIN-DSHEIPQ  516

Query  353  PTQPPFINSSVL  318
            PTQPPF++ + +
Sbjct  517  PTQPPFLSPATM  528



>ref|XP_010041375.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
 gb|KCW44397.1| hypothetical protein EUGRSUZ_L02119 [Eucalyptus grandis]
Length=154

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = -3

Query  683  MAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLYRTDRSFEIV  504
            MAPEYLV+GQLTEKADVY+FGVLVLE++SGRK++ F   SGS+LQ+VW+ Y+++R  E +
Sbjct  1    MAPEYLVKGQLTEKADVYAFGVLVLEILSGRKNSIFGQASGSVLQSVWKRYKSNRLAECI  60

Query  503  DPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE--IPEPTQPPFIN  330
            DP+L+G F  +EA  V+++ LLC QA P LRPSMSEVVEML   DRE  +P P QPPF+N
Sbjct  61   DPALKGKFLVSEALNVIRIALLCTQASPDLRPSMSEVVEMLN--DRECIVPMPMQPPFLN  118

Query  329  SSVLAGGSMSS  297
            ++ +   S  S
Sbjct  119  NNPIPDDSSRS  129



>ref|XP_011045282.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 isoform 
X1 [Populus euphratica]
Length=646

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEK DVYSFGVLV+E+VSG+  ++   DS S+LQ VW L
Sbjct  481  STAIAGTLGYMAPEYVVRGKLTEKVDVYSFGVLVIEVVSGKGKDSVPQDSRSILQKVWSL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            +   R  E VDP LEG+F  +EAS+++Q+GLLC QA P LRPSMS +V+M+  +  EIP+
Sbjct  541  HGNGRLCEAVDPVLEGNFQEDEASRLLQIGLLCVQASPELRPSMSIIVKMIN-DSHEIPQ  599

Query  353  PTQPPFINSSVL  318
            PTQPPF++ + +
Sbjct  600  PTQPPFLSPATM  611



>gb|KHG30441.1| Cysteine-rich receptor-like protein kinase 1 [Gossypium arboreum]
Length=633

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY+FGVL+LE+ +GRK+N F + S S L  VW+ 
Sbjct  475  STAIAGTLGYMAPEYLVRGQLTEKADVYAFGVLMLEIATGRKNNVFCERSSSTLYLVWKQ  534

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   + +D +L+G F+  EAS V++VGLLC Q+  ALRP+MSEV +MLT     IP 
Sbjct  535  YKAESITQAIDSTLKGRFDEREASIVLRVGLLCTQSSVALRPTMSEVAQMLTDRRCVIPS  594

Query  353  PTQPPFINSSVLA  315
            P QPPF+N+SVL+
Sbjct  595  PKQPPFLNASVLS  607



>ref|XP_002870713.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46972.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=651

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G ++NAF   +G LLQ VW L
Sbjct  473  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNNAFEPMTGHLLQRVWNL  532

Query  533  YRTDRSFEIVDPSLEGDF-----NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E +DP L+ +F     + +EA KV++VGLLC QA P LRPSM EV+ MLT  D
Sbjct  533  YTLNRLVEPLDPCLKDEFLQVQGSEDEACKVLRVGLLCTQASPWLRPSMEEVIRMLTERD  592

Query  368  REIPEPTQPPFINSSVLA  315
               P PT PPF+  S L 
Sbjct  593  YPFPSPTNPPFLRISSLT  610



>gb|KCW83342.1| hypothetical protein EUGRSUZ_B00275 [Eucalyptus grandis]
Length=599

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEY++RGQLTEK DVY+FGVLVLE++SG K+N +A    S+LQ+VW+ 
Sbjct  458  STGIAGTIGYMAPEYIMRGQLTEKVDVYAFGVLVLEILSGMKNNVYARGLSSVLQSVWKH  517

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  ++R +P+
Sbjct  518  YKSNNLAMCIDSALQGKFPILEASNVLQIGLLCNQACMELRPPMSGVVEMLHNKNRVVPQ  577

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPFIN+S+L   S S
Sbjct  578  PNQPPFINASLLFDKSSS  595



>ref|XP_010552664.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Tarenaya 
hassleriana]
Length=653

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY+VRG+LTEKADVYSFGVL++E++SGR++NAF+ +S S+LQ VW L
Sbjct  488  STAVAGTLGYMAPEYIVRGKLTEKADVYSFGVLMIEVISGRRNNAFSQNSSSILQMVWSL  547

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    E VDP +  +F+  EA +V+++GLLC QA    RP+MS VV+M+T  + EIPE
Sbjct  548  YGTRTLREAVDPIMGDNFDVEEAKRVMKIGLLCVQAAFDQRPAMSSVVKMMTGRE-EIPE  606

Query  353  PTQPPFINSS  324
            PTQPPF+N++
Sbjct  607  PTQPPFLNTA  616



>gb|KJB39166.1| hypothetical protein B456_007G001400 [Gossypium raimondii]
Length=576

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 109/149 (73%), Gaps = 0/149 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYLVRGQLTEKADVY+FGVL+LE+ +GRK+N F++ S S L  VW+ 
Sbjct  419  STAIAGTLGYMAPEYLVRGQLTEKADVYAFGVLMLEIATGRKNNVFSERSSSTLYLVWKQ  478

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +   + +D +L+G F+  EAS V++VGLLC Q+  ALRP+MSEV + LT     IP 
Sbjct  479  YKAESITQAIDSTLKGRFDEREASIVLRVGLLCTQSSVALRPTMSEVAQTLTDRRCVIPS  538

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNALN  267
            P QPPF+N+SVL+     +   + S+ALN
Sbjct  539  PKQPPFLNASVLSPEDAMTSSFMGSSALN  567



>ref|XP_010427831.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=651

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  ++GS+LQTVW L
Sbjct  486  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSL  545

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+   + EI  
Sbjct  546  YRTRNLEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GNLEIHT  604

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  605  PTQPPFLN  612



>ref|XP_011468279.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Fragaria 
vesca subsp. vesca]
Length=660

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 114/156 (73%), Gaps = 6/156 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG---SLLQTV  543
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE+VSG +++ F  ++    SLL  V
Sbjct  483  STGIAGTLGYMAPEYLVQGQLTEKADVYSFGVLVLEIVSGMRNSTFKQENSNTDSLLHKV  542

Query  542  WRLYRTDRSFEIVDPSLEG-DFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI-ED  369
            W+ YR++   E+VDP L+  +  A E S V+Q+GLLC QA  ALRPSM+EVV MLT  ++
Sbjct  543  WKHYRSNELAEVVDPRLKNHELPAKEVSNVLQIGLLCTQASVALRPSMAEVVLMLTANKE  602

Query  368  REIPEPTQPPFINSSVL-AGGSMSSIKSLVSNALNK  264
              IP P QPPF+++S L    S+++  S VSN L K
Sbjct  603  THIPVPNQPPFLSASTLEQASSINTANSSVSNTLTK  638



>ref|XP_011086609.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Sesamum 
indicum]
Length=642

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY+VRG+LTEKADVYSFGV+V+E+VSGR++NAF+ +S S+LQ VW L
Sbjct  477  STAVAGTLGYMAPEYVVRGKLTEKADVYSFGVVVMEVVSGRRNNAFSQNSLSILQKVWDL  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y++ +  E VDPS++G F    A++++Q+GL+C QA    RPSMS +V+MLT  + EIP 
Sbjct  537  YQSGQLIEAVDPSVKGKFPEEGATRLLQIGLICAQAAAERRPSMSVIVKMLT-GNEEIPG  595

Query  353  PTQPPFINSS  324
            PTQPPF++S+
Sbjct  596  PTQPPFLSSN  605



>gb|KCW45360.1| hypothetical protein EUGRSUZ_L00962 [Eucalyptus grandis]
Length=678

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SG+K++ +   S S+L +VW  
Sbjct  532  STVIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNSTYTQGSSSVLNSVWNH  591

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L G F   EAS+++Q+ LLC QA   LRP MSEV+EML  +DR +P+
Sbjct  592  YKSNNLAACIDLALRGKFPILEASRLLQISLLCTQACMELRPPMSEVIEMLHDKDRVVPQ  651

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPF+N+SVL   S S
Sbjct  652  PNQPPFVNASVLFDNSSS  669



>ref|XP_010044591.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Eucalyptus 
grandis]
Length=648

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGY+APEY+VRG+LT+K DVYS+GVL++E++SG+K+  F++ S S+LQ VW  
Sbjct  483  STGVAGTLGYLAPEYVVRGKLTDKVDVYSYGVLMMEVLSGKKNYTFSESSCSILQMVWNQ  542

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y + R FE +DP LEG F   E S+++Q+GLLC QA   LRPSMS VV+ML  E  E+P 
Sbjct  543  YGSGRLFEAIDPILEGQFQEEEVSRLLQIGLLCVQASAELRPSMSVVVKMLK-ESSELPT  601

Query  353  PTQPPFINSS  324
            PTQPPF+NSS
Sbjct  602  PTQPPFLNSS  611



>ref|NP_177210.1| cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana]
 sp|Q9CAL2.1|CRK3_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 3; Short=Cysteine-rich 
RLK3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52470.1|AC010796_9 putative protein kinase; 41292-38663 [Arabidopsis thaliana]
 gb|AEE35075.1| cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana]
Length=646

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  D+GS+LQ+VW L
Sbjct  481  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWSL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+     EI  
Sbjct  541  YRTSNVEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSVVVKMMK-GSLEIHT  599

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  600  PTQPPFLN  607



>ref|XP_002888786.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65045.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  ++GS+LQTVW L
Sbjct  484  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSL  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+     EI  
Sbjct  544  YRTRNLEEAVDPILGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSTVVKMMK-GSLEIHT  602

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  603  PTQPPFLN  610



>ref|XP_006405500.1| hypothetical protein EUTSA_v10027683mg [Eutrema salsugineum]
 gb|ESQ46953.1| hypothetical protein EUTSA_v10027683mg [Eutrema salsugineum]
Length=645

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 98/137 (72%), Gaps = 5/137 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYS+GVLVLE+  G ++N F   +G LLQ VW L
Sbjct  470  STGIAGTLGYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLQRVWNL  529

Query  533  YRTDRSFEIVDPSLEGDF-----NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            YR +R  E +DP L+ +      +  EA KV+ VGLLC QA P+LRPSM EV+ MLT  D
Sbjct  530  YRLNRLVEALDPCLKEELLQAQCSEAEACKVLCVGLLCAQASPSLRPSMEEVILMLTERD  589

Query  368  REIPEPTQPPFINSSVL  318
              IP PT PPF+  S L
Sbjct  590  YPIPSPTNPPFLRISSL  606



>ref|XP_010415737.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Camelina 
sativa]
Length=655

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  ++GS+LQTVW L
Sbjct  490  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSL  549

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+     EI  
Sbjct  550  YRTRNLEEAVDPVLGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GSLEIHT  608

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  609  PTQPPFLN  616



>gb|KFK41463.1| hypothetical protein AALP_AA2G134200 [Arabis alpina]
Length=645

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 109/145 (75%), Gaps = 6/145 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+V+GR++NAF+ D+ S+LQTVW L
Sbjct  481  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLLIEVVTGRRNNAFSQDASSILQTVWNL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    E VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+   + EI  
Sbjct  541  YGTRNLSEAVDPVLGDNFNKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GNLEIQT  599

Query  353  PTQPPFINSSVLAGGSMSSIKSLVS  279
            PTQPPF+N      GS+  ++ ++S
Sbjct  600  PTQPPFLNP-----GSVVELRKMMS  619



>ref|NP_001269003.1| uncharacterized protein LOC101255872 [Solanum lycopersicum]
 gb|AGN92795.1| CRK1 [Solanum lycopersicum]
Length=616

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGY+APEYL++G LTEKADVYSFGV+ +E+    KSN F  D+GS+LQ+VWR 
Sbjct  430  STGIAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKSNVFVSDNGSVLQSVWRN  489

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ ++  E +D  L  DF   EAS+V+Q+GLLC Q     RPSMS+VV +L  E+ EIP 
Sbjct  490  YKLNKITESIDSRLMSDFQEQEASRVLQIGLLCTQTRRFSRPSMSQVVRILRNEEIEIPT  549

Query  353  PTQPPFINSSVLAGGSMSS  297
            PTQPPF NSS+LA    SS
Sbjct  550  PTQPPFQNSSLLAPPDTSS  568



>ref|XP_008446185.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 3 [Cucumis melo]
Length=653

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+L+EKADVYSFGV  +E+++GR++  F  DS S+LQ VW L
Sbjct  488  STAIAGTLGYMAPEYVVRGKLSEKADVYSFGVFAIEVITGRRNGHFYQDSTSILQRVWNL  547

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   R +  VDP L GD+  +EAS+++Q+GL+C QA   LRPSMS VV+MLT  + EIP+
Sbjct  548  YGEGRLYAAVDPILAGDYPRDEASRLLQIGLVCVQAFADLRPSMSMVVKMLT-ANYEIPQ  606

Query  353  PTQPPFINSSVLAGGSM  303
            P QPP+++ S  + GSM
Sbjct  607  PKQPPYLHPS--SSGSM  621



>ref|XP_006283294.1| hypothetical protein CARUB_v10004332mg [Capsella rubella]
 gb|EOA16192.1| hypothetical protein CARUB_v10004332mg [Capsella rubella]
Length=651

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G ++N+F   +G LLQ VW L
Sbjct  473  STGIAGTLGYMAPEYIVRGQLTEKADVYSFGVLVLEIACGTRNNSFVPVTGHLLQRVWSL  532

Query  533  YRTDRSFEIVDPSLEGDF-----NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E +D  L+ +      +  EA KV++VGLLC QA P+LRPSM EV+ MLT  D
Sbjct  533  YTLNRLGEALDSCLKDELLQEQGSKAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERD  592

Query  368  REIPEPTQPPFINSSVLA  315
              IP PT PPF+ +S L 
Sbjct  593  HLIPAPTNPPFLRTSPLT  610



>ref|XP_006374531.1| hypothetical protein POPTR_0015s09050g [Populus trichocarpa]
 gb|ERP52328.1| hypothetical protein POPTR_0015s09050g [Populus trichocarpa]
Length=135

 Score =   153 bits (387),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 95/135 (70%), Gaps = 4/135 (3%)
 Frame = -3

Query  683  MAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLYRTDRSFEIV  504
            MAPEYLVRGQLTEKADVY FGVLVLE  +GRK++ F+  S S+L +VW+ Y+     +++
Sbjct  1    MAPEYLVRGQLTEKADVYGFGVLVLETATGRKNSVFSQGSSSILHSVWKHYKVKTITDMI  60

Query  503  DPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEPTQPPFINSS  324
            DP L+  F   +A  V+Q+GLLC QA P LRP M+EVV ML     EIP P QPPF+N+S
Sbjct  61   DPGLKDSFPEKQAETVLQIGLLCTQASPRLRPFMNEVVSMLANAKSEIPSPKQPPFLNAS  120

Query  323  VLA----GGSMSSIK  291
            VL+     GS S++K
Sbjct  121  VLSPDANKGSSSTLK  135



>emb|CDX67454.1| BnaA07g14940D [Brassica napus]
Length=657

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYS+GVLVLE+  G ++N F   +G LL  VW L
Sbjct  483  STGIAGTLGYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNL  542

Query  533  YRTDRSFEIVDPSLEGDF------NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIE  372
            YR +R  E +DP L  +       +  E  KV+ VGLLC QA P+LRPSM EV+ MLT  
Sbjct  543  YRLNRLVEALDPCLNDEKLLQVQGSQAEVCKVLSVGLLCAQASPSLRPSMEEVISMLTER  602

Query  371  DREIPEPTQPPFINSSVLA  315
            D  IP PT PPF+  S LA
Sbjct  603  DYPIPSPTNPPFLRISSLA  621



>emb|CDY11571.1| BnaC06g31680D [Brassica napus]
Length=2213

 Score =   167 bits (423),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 107/140 (76%), Gaps = 2/140 (1%)
 Frame = -3

Query  713   STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
             ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++GR++NAF+ DS S+LQTVW L
Sbjct  1438  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDSSSILQTVWSL  1497

Query  533   YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
             Y T    ++VDP L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  1498  YGTSNFVQVVDPVLGDNFNKMEASRLLEIGLLCVQAAFDQRPAMSAVVKMMK-GSLEIPT  1556

Query  353   PTQPPFIN-SSVLAGGSMSS  297
             PTQPPF+N  SVL    M S
Sbjct  1557  PTQPPFLNPGSVLEMRKMMS  1576


 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGT GYMAPEY VRG+LTEKADVYSFGV+++E+++GR+++AF+ D+ S+LQTVW L
Sbjct  670  STAIAGTRGYMAPEYAVRGKLTEKADVYSFGVVMIEVITGRRNSAFSQDATSILQTVWSL  729

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VD  L  +FN  EAS+++++GLLC QA    RP+MS VV+M+   + EIP 
Sbjct  730  YGTSNLAQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMMK-GNMEIPT  788

Query  353  PTQPPFIN-SSVLAGGSMSS  297
            P QPPF++  SVL    M S
Sbjct  789  PKQPPFLDPGSVLEARKMMS  808


 Score =   137 bits (344),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 97/141 (69%), Gaps = 10/141 (7%)
 Frame = -3

Query  713   STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKS--NAFADDSGSLLQTVW  540
             ST IAGTLGYMAPEYL  GQLTEK DVYSFGVLVLE+V+G+++  +  +D S SL+   W
Sbjct  2047  STAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLVLEIVTGKQNTKSKMSDYSDSLITEAW  2106

Query  539   RLYRTDRSFEIVDPSLEGDFNAN-------EASKVVQVGLLCCQAIPALRPSMSEVVEML  381
             + ++T    EI DP+L+   N N       E  +VVQ+GLLC Q + +LRPSMS+V+ ML
Sbjct  2107  KHFQTGELEEIYDPNLDWK-NQNDSLIIKKEIVRVVQIGLLCTQEMASLRPSMSKVLHML  2165

Query  380   TIEDREIPEPTQPPFINSSVL  318
               ++  +P P+ PPF++  V+
Sbjct  2166  KHKEEVLPLPSNPPFMDERVM  2186



>ref|XP_009125135.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Brassica 
rapa]
Length=656

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYS+GVLVLE+  G ++N F   +G LL  VW L
Sbjct  482  STGIAGTLGYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNL  541

Query  533  YRTDRSFEIVDPSLEGDF------NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIE  372
            YR +R  E +DP L  +       +  E  KV+ VGLLC QA P+LRPSM EV+ MLT  
Sbjct  542  YRLNRLVEALDPCLNDEKLLQVQGSQAEVCKVLSVGLLCAQASPSLRPSMEEVISMLTER  601

Query  371  DREIPEPTQPPFINSSVLA  315
            D  IP PT PPF+  S LA
Sbjct  602  DYPIPSPTNPPFLRISSLA  620



>ref|XP_006390874.1| hypothetical protein EUTSA_v10018240mg [Eutrema salsugineum]
 gb|ESQ28160.1| hypothetical protein EUTSA_v10018240mg [Eutrema salsugineum]
Length=660

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 112/147 (76%), Gaps = 6/147 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++GR++NA + D+ S+LQTVW L
Sbjct  491  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGRRNNALSQDASSILQTVWSL  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VDP L  +FN  EAS+++Q+GLLC QA    RP+MS VV+M+   + EI  
Sbjct  551  YGTSNLTKVVDPILGDNFNEIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GNLEIQT  609

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNA  273
            PTQPPF+N      GS++ ++ ++S++
Sbjct  610  PTQPPFLNP-----GSVAEMRKMMSHS  631



>ref|XP_010450675.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=651

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 99/138 (72%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G+++NAF   +G LLQ VW L
Sbjct  473  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEISCGKRNNAFVPVTGHLLQRVWNL  532

Query  533  YRTDRSFEIVDPSLEGDFNAN-----EASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E +D  L+ +         EA KV++VGLLC QA P+LRPSM EV+ MLT  +
Sbjct  533  YTLNRLVEALDSCLKDEVRQEQGREAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTESE  592

Query  368  REIPEPTQPPFINSSVLA  315
              IP PT PPF+ +S L 
Sbjct  593  YLIPSPTNPPFLRTSPLT  610



>ref|XP_004509569.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
isoform X2 [Cicer arietinum]
Length=643

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY++RG+LTEKADVYSFGVLV+E+VSG++++++  +S S+LQTVW L
Sbjct  470  STVVAGTLGYMAPEYVIRGKLTEKADVYSFGVLVIEIVSGKRNSSYVLNSSSILQTVWNL  529

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  +I DP LEG+F   EA +++Q+GLLC QA   LRPSMS VV+M+   + EI +
Sbjct  530  YGSNRLSDIFDPILEGNFPTEEACQMLQIGLLCAQATAELRPSMSVVVKMIN-NNHEISQ  588

Query  353  PTQPPFIN  330
             TQPPFIN
Sbjct  589  LTQPPFIN  596



>emb|CDY47147.1| BnaA08g05360D [Brassica napus]
Length=387

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGT GYMAPEY VRG+LTEKADVYSFGVL++E+++GR++NAF+ D+ S+LQTVW L
Sbjct  220  STAIAGTRGYMAPEYAVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDASSILQTVWSL  279

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VD  L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  280  YGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMIK-GSLEIPT  338

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  339  PTQPPFLN  346



>ref|XP_004135260.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Cucumis sativus]
 ref|XP_004165355.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Cucumis sativus]
Length=651

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+L+EKADVYSFGV  +E+++GR++  F  DS S+LQ VW L
Sbjct  487  STAIAGTLGYMAPEYVVRGKLSEKADVYSFGVFAIEVITGRRNGHFYQDSTSILQKVWNL  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   R +  VDP L GD+  +EAS+++Q+GL+C QA   LRPSMS VV+MLT  + EIP+
Sbjct  547  YGEGRLYAAVDPILAGDYPRDEASRLLQIGLVCVQAFADLRPSMSMVVKMLT-ANYEIPQ  605

Query  353  PTQPPFINSSVLAGGSM  303
            P QPP+++ S    GSM
Sbjct  606  PKQPPYLHPS---SGSM  619



>ref|XP_004509568.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
isoform X1 [Cicer arietinum]
Length=664

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY++RG+LTEKADVYSFGVLV+E+VSG++++++  +S S+LQTVW L
Sbjct  491  STVVAGTLGYMAPEYVIRGKLTEKADVYSFGVLVIEIVSGKRNSSYVLNSSSILQTVWNL  550

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  +I DP LEG+F   EA +++Q+GLLC QA   LRPSMS VV+M+   + EI +
Sbjct  551  YGSNRLSDIFDPILEGNFPTEEACQMLQIGLLCAQATAELRPSMSVVVKMIN-NNHEISQ  609

Query  353  PTQPPFIN  330
             TQPPFIN
Sbjct  610  LTQPPFIN  617



>emb|CDY11684.1| BnaC06g12920D [Brassica napus]
Length=650

 Score =   163 bits (412),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 96/139 (69%), Gaps = 6/139 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYS+GVLVLE+  G ++N F   +G LL  VW L
Sbjct  477  STGIAGTLGYMAPEYVVRGQLTEKADVYSYGVLVLEIACGTRNNVFVPGAGHLLHRVWNL  536

Query  533  YRTDRSFEIVDPSLEGDF------NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIE  372
            YR +R  E +DP L  +       +  E  KV+ VGLLC QA P+LRPSM EV+ MLT  
Sbjct  537  YRLNRLVEALDPCLNDEKLLQVQGSQAEVCKVLCVGLLCAQASPSLRPSMDEVIRMLTER  596

Query  371  DREIPEPTQPPFINSSVLA  315
            D  IP PT PPF+  S LA
Sbjct  597  DYPIPSPTNPPFLRISSLA  615



>ref|XP_010029936.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
 gb|KCW83621.1| hypothetical protein EUGRSUZ_B00516 [Eucalyptus grandis]
Length=620

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYL+RG LTEKADVY+FGVLVLE++SGRK++ +   S S+LQ VW+ 
Sbjct  479  STGIAGTLGYMAPEYLMRGHLTEKADVYAFGVLVLEILSGRKNSVYTRGSSSVLQLVWKH  538

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L+G F   E SKV+Q+ LLC QA   LRP MS VVEML  ++  +P+
Sbjct  539  YKSNNLAACIDSALQGKFPMLEVSKVLQISLLCTQAYMELRPPMSGVVEMLHDKNCVLPQ  598

Query  353  PTQPPFINSSVL  318
            P+QPPF+N+S++
Sbjct  599  PSQPPFVNASLM  610



>ref|XP_009105721.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Brassica 
rapa]
Length=347

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGT GYMAPEY VRG+LTEKADVYSFGV+++E+++GR++NAF+ D+ S+LQTVW L
Sbjct  180  STAIAGTRGYMAPEYAVRGKLTEKADVYSFGVVMIEVITGRRNNAFSQDATSILQTVWSL  239

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VD  L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP+
Sbjct  240  YGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMMK-GSLEIPK  298

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  299  PTQPPFLN  306



>ref|XP_006301715.1| hypothetical protein CARUB_v10022175mg [Capsella rubella]
 gb|EOA34613.1| hypothetical protein CARUB_v10022175mg [Capsella rubella]
Length=652

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVL++E+++G+++NAF  ++GS+LQTVW L
Sbjct  487  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQEAGSILQTVWSL  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YRT    E VDP L  +F+  EAS+++Q+GLLC QA    RP+MS VV+M+     EI  
Sbjct  547  YRTSNVEEAVDPILGDNFDKIEASRLLQIGLLCVQAAFDQRPAMSAVVKMMK-GSLEILT  605

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  606  PTQPPFLN  613



>gb|KCW83350.1| hypothetical protein EUGRSUZ_B00284, partial [Eucalyptus grandis]
Length=564

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 2/121 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLV+GQLTEKADVYSFGVLVLE++SGRK+  F   SGS+LQ+VW+ 
Sbjct  446  STGIAGTLGYMAPEYLVKGQLTEKADVYSFGVLVLEILSGRKNRIFGQASGSVLQSVWKQ  505

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++   E +DP L+G F  +EA  V+Q+ LLC QA P LRPSMSEVVEML  +DRE   
Sbjct  506  YKSNSLAECIDPVLKGKFPVSEALNVIQIALLCTQASPDLRPSMSEVVEML--KDRECIV  563

Query  353  P  351
            P
Sbjct  564  P  564



>ref|XP_007044719.1| Cysteine-rich RLK 3 isoform 2 [Theobroma cacao]
 gb|EOY00551.1| Cysteine-rich RLK 3 isoform 2 [Theobroma cacao]
Length=493

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY+V G+L+EK DVYSFGVLV+E++ G++ N F++DS S+L  VW  
Sbjct  330  STAVAGTLGYMAPEYVVCGKLSEKVDVYSFGVLVIEVICGKR-NKFSEDSVSILHMVWNH  388

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  D+  E VDP +E +F   EAS+++++GLLC QA   +RPSMS VV+MLT +  EIP+
Sbjct  389  YEVDKLCEAVDPIIEDNF-LKEASRLLKIGLLCVQAYAEMRPSMSTVVQMLTDDAHEIPQ  447

Query  353  PTQPPFINSS  324
            PTQPPF+NSS
Sbjct  448  PTQPPFLNSS  457



>ref|XP_010045533.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=621

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVLVLE++SGRK++ +   S ++LQ+VW+ 
Sbjct  475  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLVLEVLSGRKNSIYTRGSSTVLQSVWKH  534

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
             +++     +DP+L+G F   EAS V+Q+ LLC QA   LRP MS V EML  +D  +P+
Sbjct  535  CKSNNLAACIDPALQGKFPVLEASNVLQISLLCTQASMELRPPMSGVFEMLRDKDCVVPQ  594

Query  353  PTQPPFINSSVL  318
            P QPPF+ +S+L
Sbjct  595  PNQPPFLKASLL  606



>ref|XP_007044718.1| Cysteine-rich RLK 3 isoform 1 [Theobroma cacao]
 gb|EOY00550.1| Cysteine-rich RLK 3 isoform 1 [Theobroma cacao]
Length=648

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 101/130 (78%), Gaps = 2/130 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY+V G+L+EK DVYSFGVLV+E++ G++ N F++DS S+L  VW  
Sbjct  485  STAVAGTLGYMAPEYVVCGKLSEKVDVYSFGVLVIEVICGKR-NKFSEDSVSILHMVWNH  543

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  D+  E VDP +E +F   EAS+++++GLLC QA   +RPSMS VV+MLT +  EIP+
Sbjct  544  YEVDKLCEAVDPIIEDNF-LKEASRLLKIGLLCVQAYAEMRPSMSTVVQMLTDDAHEIPQ  602

Query  353  PTQPPFINSS  324
            PTQPPF+NSS
Sbjct  603  PTQPPFLNSS  612



>ref|XP_010435908.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=653

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 98/137 (72%), Gaps = 5/137 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G ++NAF   +G LLQ VW L
Sbjct  474  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNNAFVPVTGHLLQRVWNL  533

Query  533  YRTDRSFEIVDPSLEGDFNAN-----EASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E ++  L+ +         EA KV++VGLLC QA P+LRPSM EV+ MLT  +
Sbjct  534  YTLNRLVEALESCLKDEVRQEQGREAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERE  593

Query  368  REIPEPTQPPFINSSVL  318
              IP PT PPF+ +S L
Sbjct  594  YLIPSPTNPPFLRTSPL  610



>gb|KCW84027.1| hypothetical protein EUGRSUZ_B00900, partial [Eucalyptus grandis]
Length=599

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLTEKADVY+FGVL+LE+++GRK   +   S S+L  VW+ 
Sbjct  469  STGIAGTLGYMAPEYLVRGQLTEKADVYAFGVLLLEILTGRKITIYTRGSSSVLHLVWKH  528

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +DP L+G F   +AS VVQ+ LLC QA   LRP MS VVEML  +D  +P+
Sbjct  529  YKSNNLAACIDPVLQGKFPILKASNVVQISLLCTQASMELRPPMSGVVEMLHDKDCVVPQ  588

Query  353  PTQPPFINSS  324
            P QPPF+N+S
Sbjct  589  PNQPPFLNAS  598



>ref|XP_010532281.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Tarenaya 
hassleriana]
Length=627

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 4/149 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEK DVY+FGVL+LE+ +G+K++AF   + S+L +VW  
Sbjct  482  NTGIAGTLGYLAPEYLIKGQLTEKTDVYAFGVLILEIATGKKNSAFTKGANSVLYSVWEH  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            +  +     VDP L+G F   E SKV+Q+GLLC Q+  A+RPSMSE+V ML   D E P 
Sbjct  542  FEANALTRSVDPRLKGKFPEEETSKVLQIGLLCVQSSVAMRPSMSEIVAMLKNRDCECPF  601

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNALN  267
            P QPPF++S+VL    MS+  + +S  +N
Sbjct  602  PKQPPFLSSTVL----MSNEDTRLSQVIN  626



>ref|XP_009772712.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
sylvestris]
Length=675

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 106/148 (72%), Gaps = 0/148 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGY+APEYL++G LTEKADVYSFGV+ +E+    K+N F  DSGS+LQ+VWR 
Sbjct  488  STGVAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKNNVFVSDSGSVLQSVWRN  547

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ ++  E +D  L  DF   EAS+V+Q+GLLC Q     RPSMS+VV +L  ++ E+P 
Sbjct  548  YKLNKITESIDSRLMSDFQEQEASRVLQLGLLCTQTRRFSRPSMSQVVRILRDKETEVPV  607

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNAL  270
            P QPPF NSS+LA    +S  SL  ++L
Sbjct  608  PMQPPFQNSSLLAPPDTTSRSSLTKDSL  635



>ref|XP_003519826.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Glycine max]
 gb|KHN00377.1| Cysteine-rich receptor-like protein kinase 3 [Glycine soja]
Length=648

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST I GTLGYMAPEY+V G+LTEKADVYSFGVL++E++SG+KS +F ++S S+LQTVW L
Sbjct  481  STAICGTLGYMAPEYVVLGKLTEKADVYSFGVLIMEIISGKKSKSFVENSYSILQTVWSL  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y ++R  +IVDP L+G++   EA K++++GLLC QA   LRP MS VVEM+   +  I +
Sbjct  541  YGSNRLCDIVDPILDGNYPEMEACKLLKIGLLCAQASAELRPPMSVVVEMIN-NNHGITQ  599

Query  353  PTQPPFINSS  324
            PTQPPF++ S
Sbjct  600  PTQPPFLSCS  609



>gb|KCW45210.1| hypothetical protein EUGRSUZ_L01157 [Eucalyptus grandis]
Length=137

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 0/122 (0%)
 Frame = -3

Query  683  MAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLYRTDRSFEIV  504
            MAPEYLVRGQLTEKADVY+FGVLV+E+++GRK++ +   S S+LQ+VW  Y+++     +
Sbjct  1    MAPEYLVRGQLTEKADVYAFGVLVMEILTGRKNSVYTRGSSSILQSVWEHYKSNNLAVCI  60

Query  503  DPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEPTQPPFINSS  324
            DP+L+G F   E S V+Q+ LLC QA   LRP MS VVEML  +DR +P+P QPPF+N+S
Sbjct  61   DPALQGKFPVLEVSNVLQISLLCTQASMELRPPMSGVVEMLHDKDRVVPQPNQPPFLNAS  120

Query  323  VL  318
            VL
Sbjct  121  VL  122



>ref|XP_006307016.1| hypothetical protein CARUB_v10008603mg [Capsella rubella]
 gb|EOA39914.1| hypothetical protein CARUB_v10008603mg [Capsella rubella]
Length=616

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  
Sbjct  476  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEH  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+       +DP L+G+F   EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D     
Sbjct  536  YKASTLKSSIDPRLKGNFTEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLKKKDCNFDS  595

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  596  PKQPPFLSASVL  607



>ref|XP_006483912.1| PREDICTED: cysteine-rich receptor-like protein kinase 3-like 
[Citrus sinensis]
Length=626

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            S  +AGTLGYMAPEY+VRG+LTEKADVYSFGV+V+E+V  ++ N F  +S S+LQTVW L
Sbjct  482  SATLAGTLGYMAPEYVVRGKLTEKADVYSFGVVVIEVVCRKRINLFTQNSFSILQTVWDL  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   R  E VDP+L G+F   E S+++Q+GLLC QA   LRPSMS VV+MLT  + EI +
Sbjct  542  YVKGRLHEAVDPALAGNFQEGEPSRLLQIGLLCVQASAELRPSMSIVVKMLT-GNHEILQ  600

Query  353  PTQPPFINSSVLAGGSMSSI  294
            PTQPPF+N +   G  +SS+
Sbjct  601  PTQPPFLNPN---GSEISSV  617



>ref|XP_006438314.1| hypothetical protein CICLE_v10030965mg [Citrus clementina]
 gb|ESR51554.1| hypothetical protein CICLE_v10030965mg [Citrus clementina]
Length=626

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            S  +AGTLGYMAPEY+VRG+LTEKADVYSFGV+V+E+V  ++ N F  +S S+LQTVW L
Sbjct  482  SATLAGTLGYMAPEYVVRGKLTEKADVYSFGVVVIEVVCRKRINLFTQNSFSILQTVWDL  541

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   R  E VDP+L G+F   E S+++Q+GLLC QA   LRPSMS VV+MLT  + EI +
Sbjct  542  YVKGRLHEAVDPALAGNFQEGEPSRLLQIGLLCVQASAELRPSMSIVVKMLT-GNHEILQ  600

Query  353  PTQPPFINSSVLAGGSMSSI  294
            PTQPPF+N +   G  +SS+
Sbjct  601  PTQPPFLNPN---GSEISSV  617



>ref|XP_009618146.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Nicotiana 
tomentosiformis]
Length=675

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGY+APEYL++G LTEKADVYSFGV+ +E+    K+N F  DS S+LQTVWR 
Sbjct  488  STGVAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKNNVFVSDSRSVLQTVWRN  547

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ ++  E +D  L  DF   EAS+V+Q+GLLC Q     RPSMS+VV++L  ++ E+P 
Sbjct  548  YKLNKITESIDSRLMSDFQEQEASRVLQLGLLCTQTRRFSRPSMSQVVKILRNKETEVPV  607

Query  353  PTQPPFINSSVLAGGSMSSIKSLVSNAL  270
            P QPPF NSS+LA    +S+ S+  ++L
Sbjct  608  PMQPPFQNSSLLAPPDTTSMSSVTKDSL  635



>emb|CDP13195.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 2/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSG-RKSNAFADDSGSLLQTVWR  537
            ST IAGTLGYMAPEY+VRG+LTEKADVYSFGVLV+E++ G R +NA + +S S+LQ  W+
Sbjct  476  STAIAGTLGYMAPEYVVRGKLTEKADVYSFGVLVIEVICGKRNNNAVSQNSFSVLQKAWK  535

Query  536  LYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIP  357
            LY T +  E V+ SL+G+F   EAS+++Q+GLLC QA   LRPSMS VV+ML     EI 
Sbjct  536  LYGTGKLGEAVEASLQGNFIIEEASRLLQIGLLCVQASAELRPSMSVVVKMLN-NQHEIA  594

Query  356  EPTQPPFINSS  324
            +PTQPPF+N S
Sbjct  595  QPTQPPFLNCS  605



>emb|CDY61395.1| BnaA08g30660D [Brassica napus]
Length=599

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGT GYMAPEY VRG+LTEKADVYSFGVL++E+++GR++NAF+ D+ S+LQTVW L
Sbjct  432  STAIAGTRGYMAPEYAVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDASSILQTVWSL  491

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VD  L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  492  YGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMIK-GSLEIPT  550

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  551  PTQPPFLN  558



>ref|XP_006344422.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Solanum tuberosum]
Length=653

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG+AGTLGY+APEYL++G LTEKADVYSFGV+ +E+    KSN F  D+GS+LQ+VWR 
Sbjct  467  STGVAGTLGYLAPEYLLQGCLTEKADVYSFGVVAIEVACCIKSNVFVSDNGSVLQSVWRN  526

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ ++  E +D  L  DF   EAS+V+Q+GLLC Q     RPSMS+VV +L  E+ EIP 
Sbjct  527  YKLNKITESIDSRLMSDFQEEEASRVLQLGLLCTQTRRFSRPSMSQVVTILRNEEIEIPT  586

Query  353  PTQPPFINSSVLAGGSMSS  297
            P QPPF NSS+LA    SS
Sbjct  587  PMQPPFQNSSLLAPPDTSS  605



>emb|CDY67166.1| BnaCnng53810D [Brassica napus]
Length=613

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGT GYMAPEY VRG+LTEKADVYSFGVL++E+++GR++NAF+ D+ S+LQTVW L
Sbjct  446  STAIAGTRGYMAPEYAVRGKLTEKADVYSFGVLMIEVITGRRNNAFSQDASSILQTVWSL  505

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y T    ++VD  L  +FN  EAS+++++GLLC QA    RP+MS VV+M+     EIP 
Sbjct  506  YGTSNLVQVVDQVLGDNFNKMEASRLLEIGLLCVQAAFEQRPAMSAVVKMIK-GSLEIPT  564

Query  353  PTQPPFIN  330
            PTQPPF+N
Sbjct  565  PTQPPFLN  572



>ref|NP_564071.3| receptor-like serine/threonine kinase 2 [Arabidopsis thaliana]
 gb|AEE29801.1| receptor-like serine/threonine kinase 2 [Arabidopsis thaliana]
Length=600

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+V+G+K+NAF   + S+L +VW  
Sbjct  461  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEH  520

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+G F   EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  521  FKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLQNKDSKFEY  580

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  581  PKQPPFLSASVL  592



>sp|Q9LMB9.2|CRK1_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 1; Short=Cysteine-rich 
RLK1; AltName: Full=Receptor-like kinase 
in flowers 2; Flags: Precursor [Arabidopsis thaliana]
Length=615

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+V+G+K+NAF   + S+L +VW  
Sbjct  476  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEH  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+G F   EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  536  FKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLQNKDSKFEY  595

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  596  PKQPPFLSASVL  607



>gb|KDO82322.1| hypothetical protein CISIN_1g008239mg [Citrus sinensis]
Length=573

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            S  +AGTLGYMAPEY+VRG+LTEKADVYSFGV+V+E+V  ++ N F  +S S+LQTVW L
Sbjct  429  SATLAGTLGYMAPEYVVRGKLTEKADVYSFGVVVIEVVCRKRINLFTQNSCSILQTVWDL  488

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y   R  E VDP+L G+F   + S+++Q+GLLC QA   LRPSMS VV+MLT  + EI +
Sbjct  489  YVKGRLHEAVDPALAGNFQEGKPSRLLQIGLLCVQASAELRPSMSIVVKMLT-GNHEILQ  547

Query  353  PTQPPFINSSVLAGGSMSSI  294
            PTQPPF+N +   G  +SS+
Sbjct  548  PTQPPFLNPN---GSEISSV  564



>gb|AAF79292.1|AC068602_15 F14D16.24 [Arabidopsis thaliana]
Length=668

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+V+G+K+NAF   + S+L +VW  
Sbjct  529  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEH  588

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+G F   EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  589  FKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLQNKDSKFEY  648

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  649  PKQPPFLSASVL  660



>ref|XP_002890316.1| hypothetical protein ARALYDRAFT_472129 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66575.1| hypothetical protein ARALYDRAFT_472129 [Arabidopsis lyrata subsp. 
lyrata]
Length=600

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  
Sbjct  461  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEH  520

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+G F+  EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  521  FKANTLDRSIDPRLKGSFSEEEALKVLQIGLLCVQSSVELRPSMSEIVFMLKNKDSKFEC  580

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  581  PKQPPFLSASVL  592



>ref|XP_010441173.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Camelina 
sativa]
Length=651

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 98/138 (71%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKAD+YSFGVLVLE+  G ++NAF   +G LLQ VW L
Sbjct  473  STGIAGTLGYMAPEYVVRGQLTEKADIYSFGVLVLEISCGTRNNAFVPVTGHLLQRVWNL  532

Query  533  YRTDRSFEIVDPSLEGDFNAN-----EASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E ++  L+ +         EA +V++VGLLC QA P+LRPSM EV+ MLT  +
Sbjct  533  YTLNRLVEALESCLKDEVRQEQGREAEACRVLRVGLLCTQASPSLRPSMEEVIRMLTESE  592

Query  368  REIPEPTQPPFINSSVLA  315
              IP PT PPF+ +S L 
Sbjct  593  YLIPSPTNPPFLRTSPLT  610



>emb|CDY41017.1| BnaC05g14750D [Brassica napus]
Length=603

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY++GVL++E+ +G+K+NAF+  + S L +VW  
Sbjct  464  NTGIAGTLGYLAPEYLIKGQLTEKADVYAYGVLIIEIATGKKNNAFSQGTSSALHSVWEH  523

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ D     VDP L+G F   EA KV+++GLLC Q+   LRPSMSE+V ML   D +   
Sbjct  524  FKADTLKSSVDPRLKGMFTEEEALKVLEIGLLCVQSSVELRPSMSEIVYMLKNNDCKFDS  583

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  584  PRQPPFLSASVL  595



>ref|XP_006654958.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Oryza brachyantha]
Length=610

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+++GRKS+   A + +  SL+  +
Sbjct  442  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSHNSVASSAEGHSLMSLI  501

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L       EA KV  VGLLC QA P LRP M +VVEML   D+E
Sbjct  502  WKHYNAGALMELLDPNLREQCTEEEALKVFHVGLLCAQASPNLRPPMWKVVEMLGSRDKE  561

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  562  LPRPTQPPFIN  572



>ref|XP_010040242.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Eucalyptus 
grandis]
Length=633

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEYL+RGQLTEKADVY+FGVLVLE++SG+K++ +   S S    VW  
Sbjct  491  STVIAGTLGYMAPEYLMRGQLTEKADVYAFGVLVLEILSGKKNSTYTQGSSS----VWNH  546

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L G F   EAS+++Q+ LLC QA   LRP MSEV+EML  +DR +P+
Sbjct  547  YKSNNLAACIDLALRGKFPILEASRLLQISLLCTQACMELRPPMSEVIEMLHDKDRVVPQ  606

Query  353  PTQPPFINSSVLAGGSMS  300
            P QPPF+N+SVL   S S
Sbjct  607  PNQPPFVNASVLFDNSSS  624



>gb|KCW83347.1| hypothetical protein EUGRSUZ_B00281 [Eucalyptus grandis]
Length=614

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 103/138 (75%), Gaps = 0/138 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEY++RGQLTEK DVY+ GVLVLE++SGRK++ +   S S+LQ+VW+ 
Sbjct  473  STGIAGTVGYMAPEYIMRGQLTEKVDVYAIGVLVLEILSGRKNSVYTRGSSSVLQSVWKH  532

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L+G F   EAS V+Q+ LLC QA   LRP M  VVEML  ++  +P+
Sbjct  533  YKSNNLATCIDLALQGKFPILEASNVLQISLLCTQASMELRPPMYGVVEMLHNKNHLVPQ  592

Query  353  PTQPPFINSSVLAGGSMS  300
            P+QPPF+N+S+L   S S
Sbjct  593  PSQPPFVNASLLFDKSSS  610



>emb|CDY26700.1| BnaA06g13220D [Brassica napus]
Length=603

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY++GVL++E+ +G+K+NAF+  + S+L +VW  
Sbjct  464  NTGIAGTLGYLAPEYLIKGQLTEKADVYAYGVLIIEIATGKKNNAFSQGTSSVLHSVWEH  523

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ D     VDP L+G F   +A KV+++GLLC Q+   LRPSMSE+V ML   D +   
Sbjct  524  FKADTLKSSVDPRLKGMFTEEDALKVLEIGLLCVQSSVELRPSMSEIVYMLKNNDCKFDS  583

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  584  PRQPPFLSASVL  595



>ref|XP_009149385.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Brassica 
rapa]
Length=615

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY++GVL++E+ +G+K+NAF+  + S+L +VW  
Sbjct  476  NTGIAGTLGYLAPEYLIKGQLTEKADVYAYGVLIIEIATGKKNNAFSQGTSSVLHSVWEH  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ D     VDP L+G F   +A KV+++GLLC Q+   LRPSMSE+V ML   D +   
Sbjct  536  FKADTLKSSVDPRLKGMFTEEDALKVLEIGLLCVQSSVELRPSMSEIVYMLKNNDCKFDS  595

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  596  PRQPPFLSASVL  607



>gb|ACN39857.1| unknown [Picea sitchensis]
Length=702

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 2/141 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST +AGTLGYMAPEY +RGQLTEKADV+SFGVLVLE++SGRK+ +  +D   L++  WRL
Sbjct  524  STRVAGTLGYMAPEYALRGQLTEKADVFSFGVLVLEIISGRKNQSSTEDMEFLIEGTWRL  583

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+ +R  EI+DP+L+  ++  +  + +++GLLC QA  ALRPSM  VV MLT E   +P 
Sbjct  584  YKANRGLEIMDPALKDSYSWEDGIRAIKIGLLCTQAAAALRPSMFRVVSMLTSEREHLPS  643

Query  353  PTQPPFINSSVLAGGSMSSIK  291
            PT+P FI+  + A G+   +K
Sbjct  644  PTRPAFID--LDAAGAAQQLK  662



>gb|EMT04496.1| Cysteine-rich receptor-like protein kinase 42 [Aegilops tauschii]
Length=380

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRK++   A + +  SL+  +
Sbjct  211  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKNHNSVASSAEGLSLMSQL  270

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      EI+DP+L    +  EA KV QVGLLC QA P LRP M +VVEML   DR 
Sbjct  271  WKHYNAGTLMEILDPNLRDQCSEAEALKVFQVGLLCAQASPNLRPPMWKVVEMLGSGDRV  330

Query  362  IPEPTQPPFIN  330
            +P+PT+PPFIN
Sbjct  331  LPKPTEPPFIN  341



>gb|KHN18443.1| Cysteine-rich receptor-like protein kinase 1 [Glycine soja]
Length=579

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            S G A TLGYMAPEY++ GQLTEKAD+Y+FGVLV+E+VSG+K++ +  +S S+L +VW+ 
Sbjct  388  SIGNAETLGYMAPEYVINGQLTEKADIYAFGVLVIEIVSGKKNSDYIPESTSVLHSVWKN  447

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  +     VDP+L G F A EAS  +Q GLLC Q+   LRPSMSEVV+MLT +D  IP 
Sbjct  448  YNANIITSSVDPTLHGKFTAEEASNALQAGLLCTQSSDTLRPSMSEVVQMLTKKDYVIPS  507

Query  353  PTQPPFINS--SVLAGGSMSSIKS  288
            P Q PF+NS   +L+    +S +S
Sbjct  508  PNQQPFLNSIARILSSNGHASARS  531



>gb|EMS52195.1| Cysteine-rich receptor-like protein kinase 42 [Triticum urartu]
Length=380

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRK++   A + +  SL+  +
Sbjct  211  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKNHNSVASSAEGLSLMSQL  270

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L    +  EA KV QVGLLC QA P LRP M +VVEML   DR 
Sbjct  271  WKHYNAGTLMELLDPNLRDQCSEAEALKVFQVGLLCAQASPNLRPPMWKVVEMLGSGDRV  330

Query  362  IPEPTQPPFIN  330
            +P PT+PPFIN
Sbjct  331  LPRPTEPPFIN  341



>ref|XP_002439751.1| hypothetical protein SORBIDRAFT_09g019455 [Sorghum bicolor]
 gb|EES18181.1| hypothetical protein SORBIDRAFT_09g019455 [Sorghum bicolor]
Length=216

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 5/133 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GR ++   A +++  SL+  +
Sbjct  73   STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRNNHNSVALSEEGLSLIALI  132

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            WR Y      E++DP+L    +  +A +V  VGLLC QA P LRP M ++VEML+  D  
Sbjct  133  WRHYNAGTLMELMDPNLREQCSEEDAVQVFHVGLLCTQASPNLRPPMWKMVEMLSCRDHN  192

Query  362  I--PEPTQPPFIN  330
            +  P PTQPPFIN
Sbjct  193  VVLPRPTQPPFIN  205



>ref|XP_003550730.2| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Glycine max]
Length=619

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 102/144 (71%), Gaps = 2/144 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            S G A TLGYMAPEY++ GQLTEKAD+Y+FGVLV+E+VSG+K++ +  +S S+L +VW+ 
Sbjct  428  SIGNAETLGYMAPEYVINGQLTEKADIYAFGVLVIEIVSGKKNSDYIPESTSVLHSVWKN  487

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  +     VDP+L G F A EAS  +Q GLLC Q+   LRPSMSEVV+MLT +D  IP 
Sbjct  488  YNANIITSSVDPTLHGKFTAEEASNALQAGLLCTQSSDTLRPSMSEVVQMLTKKDYVIPS  547

Query  353  PTQPPFINS--SVLAGGSMSSIKS  288
            P Q PF+NS   +L+    +S +S
Sbjct  548  PNQQPFLNSIARILSSNGHASARS  571



>gb|KJB50240.1| hypothetical protein B456_008G160100 [Gossypium raimondii]
Length=675

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY VRG LT+KADVYSFGVLV+E+  G+++  F+ D   +L  VW  
Sbjct  486  STAIAGTLGYMAPEYAVRGMLTQKADVYSFGVLVIEITCGKRNKCFSPDMVCILHMVWNQ  545

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  D+  E+VDP +E  F   EA +++Q+GLLC QA   LRPSMS +V+MLT +  EIP 
Sbjct  546  YEADKLGEVVDPVIEHHFR-EEACRLLQIGLLCVQASTELRPSMSTIVQMLTDDTCEIPC  604

Query  353  PTQPPFINSS  324
            PTQPPF++ S
Sbjct  605  PTQPPFLSPS  614



>gb|AAC50044.1| receptor-like serine/threonine kinase [Arabidopsis thaliana]
Length=617

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+V+G+K+NAF   + S+L +VW  
Sbjct  477  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEH  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRP-SMSEVVEMLTIEDREIP  357
            ++ +     +DP L+G F   EA KV+Q+GLLC Q+   LRP SMSE+V ML  +D +  
Sbjct  537  FKANTLDRSIDPRLKGSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFE  596

Query  356  EPTQPPFINSSVL  318
             P QPPF+++SVL
Sbjct  597  YPKQPPFLSASVL  609



>gb|KJB50242.1| hypothetical protein B456_008G160100 [Gossypium raimondii]
Length=675

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY VRG LT+KADVYSFGVLV+E+  G+++  F+ D   +L  VW  
Sbjct  486  STAIAGTLGYMAPEYAVRGMLTQKADVYSFGVLVIEITCGKRNKCFSPDMVCILHMVWNQ  545

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  D+  E+VDP +E  F   EA +++Q+GLLC QA   LRPSMS +V+MLT +  EIP 
Sbjct  546  YEADKLGEVVDPVIEHHFR-EEACRLLQIGLLCVQASTELRPSMSTIVQMLTDDTCEIPC  604

Query  353  PTQPPFINSS  324
            PTQPPF++ S
Sbjct  605  PTQPPFLSPS  614



>ref|XP_010921575.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Elaeis 
guineensis]
Length=649

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG---SLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRK+N+   +S    SL+  +
Sbjct  481  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKNNSSIAESAEGHSLVSLI  540

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ + ++R  E++DP L+   +  +A KV  +GLLC QA P LRP M +VVEMLT   ++
Sbjct  541  WQKFNSERLLELLDPYLQDQCSEEQALKVFHIGLLCAQASPNLRPPMWKVVEMLTSNSKD  600

Query  362  IPEPTQPPFI  333
            +P PTQPPFI
Sbjct  601  LPLPTQPPFI  610



>ref|XP_011465646.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Fragaria 
vesca subsp. vesca]
Length=471

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEYLVRGQLT+KADVY+FGVLVLE+V GRK++ F + S S+L +V++ 
Sbjct  350  STGIAGTLGYMAPEYLVRGQLTDKADVYAFGVLVLEIVCGRKNHVFMEGSSSILNSVYQN  409

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            YR + + + VD  L+ ++   EAS V+Q+GLLC QA  ALRPSMSEVV+MLT ++  IP 
Sbjct  410  YRANTNTKSVDAILKSEYPEREASNVLQIGLLCTQASLALRPSMSEVVQMLTDKECSIPS  469

Query  353  P  351
            P
Sbjct  470  P  470



>ref|XP_006840433.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
 gb|ERN02108.1| hypothetical protein AMTR_s00045p00163010 [Amborella trichopoda]
Length=644

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 98/131 (75%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STGIAGTLGYMAPEY++ GQLTEKAD+YS+GVLVLEMV+GRK+N   + + +  SL+  +
Sbjct  476  STGIAGTLGYMAPEYVIHGQLTEKADIYSYGVLVLEMVTGRKNNNSISTSVEGHSLMSLI  535

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y ++   EIVDP+++G  +  +  +V  VGLLC QA P LRP M +VVE+L    +E
Sbjct  536  WKQYSSNTLLEIVDPNIQGLCSEEQLLRVFHVGLLCTQASPTLRPPMWKVVELLVSMGKE  595

Query  362  IPEPTQPPFIN  330
            +P PTQPPFI+
Sbjct  596  LPLPTQPPFID  606



>dbj|BAJ92547.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=671

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRK++   A + +  SL+  +
Sbjct  502  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKNHNSVASSAEGLSLMSQL  561

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      EI+DP+L    +  EA KV QVGLLC QA P LRP M +VVEML   DR 
Sbjct  562  WKHYNAGTLMEILDPNLRDQCSEAEALKVFQVGLLCAQASPNLRPPMWKVVEMLGSGDRV  621

Query  362  IPEPTQPPFIN  330
            +P PT+PPFIN
Sbjct  622  LPRPTEPPFIN  632



>gb|KCW45361.1| hypothetical protein EUGRSUZ_L009632, partial [Eucalyptus grandis]
Length=335

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 96/129 (74%), Gaps = 6/129 (5%)
 Frame = -3

Query  704  IAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLYRT  525
            IA   GYMAPEY++RGQLTEKADVY+FGVLVLE++SGRK+N +A    S+LQ+VW+ Y++
Sbjct  203  IALDTGYMAPEYIMRGQLTEKADVYAFGVLVLEILSGRKNNVYARGLSSVLQSVWKHYKS  262

Query  524  DRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEPTQ  345
            +     +DP+L+      EAS V+Q+ LLC QA   LRP MS VVEML  ++  +P+P Q
Sbjct  263  NNLAACIDPALQ------EASNVLQINLLCTQACMELRPPMSGVVEMLHDKNCVVPQPNQ  316

Query  344  PPFINSSVL  318
            PPF+N++VL
Sbjct  317  PPFVNTNVL  325



>ref|XP_010498315.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 isoform 
X1 [Camelina sativa]
 ref|XP_010498316.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 isoform 
X2 [Camelina sativa]
Length=616

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  
Sbjct  477  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEH  536

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+      EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  537  FKANTLERSIDPRLKEKVTEEEALKVLQIGLLCVQSSVELRPSMSEIVYMLKNKDCKFDC  596

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  597  PKQPPFLSASVL  608



>ref|XP_010462782.1| PREDICTED: cysteine-rich receptor-like protein kinase 1, partial 
[Camelina sativa]
Length=632

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  
Sbjct  493  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEH  552

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+      EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  553  FKANTLERSIDPRLKEKVTEEEALKVLQIGLLCVQSSVELRPSMSEIVYMLKNKDCKFDC  612

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  613  PKQPPFLSASVL  624



>ref|XP_002439224.1| hypothetical protein SORBIDRAFT_09g002550 [Sorghum bicolor]
 gb|EES17654.1| hypothetical protein SORBIDRAFT_09g002550 [Sorghum bicolor]
Length=690

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 102/156 (65%), Gaps = 9/156 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRKS+   A + +  SL+  +
Sbjct  517  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKSHNSVASSTEGLSLMALI  576

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            WR Y      E++DP+L       +A +V  VGLLC QA P LRP M +VVEML+  D  
Sbjct  577  WRHYNAGTLMELLDPNLREQCTEEDALRVFHVGLLCAQASPNLRPPMWKVVEMLSGRDHH  636

Query  362  ---IPEPTQPPFINSSVLAGGS---MSSIKSLVSNA  273
               +P PTQPPFIN  V   G     S   SL+SN+
Sbjct  637  KVVLPRPTQPPFINVKVSKNGKSDGSSGSASLMSNS  672



>gb|EEE62217.1| hypothetical protein OsJ_17004 [Oryza sativa Japonica Group]
Length=551

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKS-NAFAD--DSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+++GRKS N+ A   +  SL+  +
Sbjct  378  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSLNSVASSAEGHSLMSLI  437

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L+       A KV  VGLLC QA P LRP M +VVEML   + E
Sbjct  438  WKHYNEGTLMELLDPNLQEQCTEEGALKVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNE  497

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  498  LPRPTQPPFIN  508



>ref|XP_010477109.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Camelina 
sativa]
Length=617

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TGIAGTLGY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  
Sbjct  478  NTGIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEH  537

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     +DP L+      EA KV+Q+GLLC Q+   LRPSMSE+V ML  +D +   
Sbjct  538  FKANTLEGSIDPRLKEKVTEEEALKVLQIGLLCVQSSVELRPSMSEIVYMLKNKDCKFDC  597

Query  353  PTQPPFINSSVL  318
            P QPPF+++SVL
Sbjct  598  PKQPPFLSASVL  609



>ref|XP_010528239.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Tarenaya 
hassleriana]
Length=654

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 5/138 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGTLGYMAPEY+VRGQLTEKADVYSFGVLVLE+  G +++ F    GSLLQ VW+L
Sbjct  478  STGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACGTRNSVFVPGLGSLLQRVWKL  537

Query  533  YRTDRSFEIVDPSLEGDF-----NANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIED  369
            Y  +R  E + P L+ +         EA   ++VGLLC QA   LRPSM+EV+ MLT  D
Sbjct  538  YTLNRLQEALHPCLKDELLQTQETQAEAFTTLRVGLLCTQASATLRPSMTEVIRMLTERD  597

Query  368  REIPEPTQPPFINSSVLA  315
              IP P+ PPF+  + LA
Sbjct  598  CGIPIPSSPPFLRINSLA  615



>ref|XP_008655309.1| PREDICTED: uncharacterized protein LOC100384005 isoform X2 [Zea 
mays]
 gb|AFW82728.1| hypothetical protein ZEAMMB73_493658 [Zea mays]
Length=385

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 6/134 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRKS+   A + +  SL+  +
Sbjct  216  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKSHNSVASSAEGLSLMALI  275

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            WR Y      E++DP+L    +  +A +V  VGLLC QA P LRP M +VVEML+  D +
Sbjct  276  WRHYTAGTLTELLDPNLREQCSEEDALRVFHVGLLCAQASPNLRPPMWKVVEMLSGRDHK  335

Query  362  ---IPEPTQPPFIN  330
               +P PTQPPFIN
Sbjct  336  AVALPRPTQPPFIN  349



>ref|NP_001170087.1| uncharacterized protein LOC100384005 [Zea mays]
 gb|ACN35757.1| unknown [Zea mays]
 gb|AFW82729.1| hypothetical protein ZEAMMB73_493658 [Zea mays]
Length=402

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 6/134 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRKS+   A + +  SL+  +
Sbjct  233  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKSHNSVASSAEGLSLMALI  292

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            WR Y      E++DP+L    +  +A +V  VGLLC QA P LRP M +VVEML+  D +
Sbjct  293  WRHYTAGTLTELLDPNLREQCSEEDALRVFHVGLLCAQASPNLRPPMWKVVEMLSGRDHK  352

Query  362  ---IPEPTQPPFIN  330
               +P PTQPPFIN
Sbjct  353  AVALPRPTQPPFIN  366



>ref|XP_008655308.1| PREDICTED: uncharacterized protein LOC100384005 isoform X1 [Zea 
mays]
Length=401

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 95/134 (71%), Gaps = 6/134 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRKS+   A + +  SL+  +
Sbjct  232  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKSHNSVASSAEGLSLMALI  291

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            WR Y      E++DP+L    +  +A +V  VGLLC QA P LRP M +VVEML+  D +
Sbjct  292  WRHYTAGTLTELLDPNLREQCSEEDALRVFHVGLLCAQASPNLRPPMWKVVEMLSGRDHK  351

Query  362  ---IPEPTQPPFIN  330
               +P PTQPPFIN
Sbjct  352  AVALPRPTQPPFIN  365



>ref|XP_007155445.1| hypothetical protein PHAVU_003G202000g [Phaseolus vulgaris]
 gb|ESW27439.1| hypothetical protein PHAVU_003G202000g [Phaseolus vulgaris]
Length=656

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STG + TLGYMAPEY+ +GQLTEK D+Y+FGVL++E+V G+K++     S SLL +VW+ 
Sbjct  461  STGNSRTLGYMAPEYVSKGQLTEKVDIYAFGVLIVEIVCGKKNSDHIPGSTSLLHSVWKN  520

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+T+     VDP+L G     EAS  +Q GLLC Q+   LRPSMSEVV+MLT +D  IP 
Sbjct  521  YKTNNITASVDPALHGKLTVEEASNTLQTGLLCTQSTVTLRPSMSEVVQMLTKKDYAIPS  580

Query  353  PTQPPFINSSVLA  315
            P Q PF+N S L+
Sbjct  581  PKQKPFLNFSGLS  593



>gb|AAU44217.1| hypothetical protein [Oryza sativa Japonica Group]
Length=702

 Score =   150 bits (379),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKS-NAFAD--DSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+++GRKS N+ A   +  SL+  +
Sbjct  506  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSLNSVASSAEGHSLMSLI  565

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L+       A KV  VGLLC QA P LRP M +VVEML   + E
Sbjct  566  WKHYNEGTLMELLDPNLQEQCTEEGALKVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNE  625

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  626  LPRPTQPPFIN  636



>gb|EEC78453.1| hypothetical protein OsI_18315 [Oryza sativa Indica Group]
Length=671

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 92/131 (70%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKS-NAFAD--DSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+++GRKS N+ A   +  SL+  +
Sbjct  495  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSLNSVASSAEGHSLMSLI  554

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L        A KV  VGLLC QA P LRP M +VVEML   + E
Sbjct  555  WKHYNEGTLMELLDPNLREQCTEEGALKVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNE  614

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  615  LPRPTQPPFIN  625



>ref|XP_010040238.1| PREDICTED: cysteine-rich receptor-like protein kinase 1 [Eucalyptus 
grandis]
Length=646

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  710  TGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLY  531
            TGIAGT+GYMAPEYLVRGQLTEKADVY+FGVLVLE+++GRK++ +   S S+LQ+VW+ Y
Sbjct  499  TGIAGTIGYMAPEYLVRGQLTEKADVYAFGVLVLEILTGRKNSVYTQGSSSILQSVWKHY  558

Query  530  RTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            ++      +DP+L+G F   EAS V+Q+GLLC QA   LRP MS VVEML  +D++
Sbjct  559  KSTNLAACIDPTLQGKFLVLEASNVLQIGLLCTQASMELRPPMSRVVEMLHDKDQQ  614



>ref|XP_004508879.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like 
[Cicer arietinum]
Length=682

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            +TG AGTL YMAPE L +GQ+TEK+D+Y+FGV+V E+V G+K++A+   S S+L +VW+ 
Sbjct  480  NTGTAGTLRYMAPECLSQGQMTEKSDIYAFGVMVTEIVCGKKNSAYPQGSNSVLHSVWKS  539

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            ++ +     VDPSL+G     EAS  +Q+GLLC Q+   LRPSMSEVV+MLT +D  IP 
Sbjct  540  FKENNITTSVDPSLQGKCVVEEASSALQIGLLCTQSSATLRPSMSEVVQMLTKKDYIIPS  599

Query  353  PTQPPFINSSVLA--GGSMSSIKSLVSNA  273
            P Q PF+N +VL     +++S  S+ SN 
Sbjct  600  PKQQPFLNYTVLTLDDRTLASTMSITSNG  628



>ref|XP_008781331.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Phoenix 
dactylifera]
Length=648

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 98/130 (75%), Gaps = 3/130 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG---SLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+V+GRK+++   +S    SL+  +
Sbjct  480  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIVTGRKNHSSIAESAEGHSLVSLI  539

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ + ++R  E++DP+L+   +  +A KV  VGLLC QA P+LRP M +VVEML    ++
Sbjct  540  WQNFNSERLTELLDPNLQDQCSEEQAIKVFHVGLLCTQASPSLRPPMWKVVEMLRSNSKD  599

Query  362  IPEPTQPPFI  333
            +P PT+PPFI
Sbjct  600  LPLPTRPPFI  609



>ref|XP_006348514.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006348515.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006348516.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006348517.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X4 [Solanum tuberosum]
 ref|XP_006348518.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
isoform X5 [Solanum tuberosum]
Length=654

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 107/166 (64%), Gaps = 18/166 (11%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG--SLLQTVW  540
            ST IAGTLGYMAPEYL RGQLTEKADVYSFGVL+LE+V+GR++N   +D    SL+  VW
Sbjct  477  STAIAGTLGYMAPEYLARGQLTEKADVYSFGVLLLEIVTGRQNNKRKNDEDTVSLVSNVW  536

Query  539  RLYRTDRSFEIVDPSLE-GDFNA----NEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
              ++     E+ DP+L   +++     NE ++V+ VGLLC Q IP+LRPSMS+ ++M   
Sbjct  537  EHFQRGIVEELFDPNLMLHNYHTINVKNEVARVLHVGLLCTQEIPSLRPSMSKALQMFVK  596

Query  374  EDREIPEPTQPPFINSS-----------VLAGGSMSSIKSLVSNAL  270
            +D E+P PT PPF++             +L  G  +SI  L+S  L
Sbjct  597  KDEELPPPTNPPFVDEKTMELHDPWDKYLLKQGDSASIAKLISQVL  642



>gb|KHG18697.1| Cysteine-rich receptor-like protein kinase 3 [Gossypium arboreum]
Length=666

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY VRG LT+KADVYSFGVLV+E+  G+++  F+ D   +L  VW  
Sbjct  481  STAIAGTLGYMAPEYAVRGMLTQKADVYSFGVLVIEITCGKRNKCFSPDMVCILHMVWNQ  540

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y  D+  E+VDP +E +F   +A +++Q+GLLC QA   LRPSMS +V++LT +  EIP 
Sbjct  541  YEADKLREVVDPVIELNFR-EKACRLLQIGLLCVQASTELRPSMSTIVQILTDDTCEIPF  599

Query  353  PTQPPFINSS  324
            PTQPP ++ S
Sbjct  600  PTQPPILSPS  609



>gb|KCW45359.1| hypothetical protein EUGRSUZ_L00961 [Eucalyptus grandis]
Length=513

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 94/132 (71%), Gaps = 12/132 (9%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            STGIAGT+GYMAPEYL RGQLTEKADVY+FGVLVLE++ GRK+            +VW+ 
Sbjct  379  STGIAGTIGYMAPEYLTRGQLTEKADVYAFGVLVLEILIGRKN------------SVWKH  426

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            Y+++     +D +L+G F   EAS V+Q+GLLC QA   LRP MS VV+ML  +D  +P+
Sbjct  427  YKSNNLAACIDLALQGKFPVLEASNVLQIGLLCTQASMELRPPMSGVVKMLHDKDWVVPQ  486

Query  353  PTQPPFINSSVL  318
            P QPPF+ +SVL
Sbjct  487  PNQPPFLKASVL  498



>ref|XP_006357154.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
43-like [Solanum tuberosum]
Length=661

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 99/140 (71%), Gaps = 3/140 (2%)
 Frame = -3

Query  704  IAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAF-ADDSGSLLQTV-WRLY  531
            IAGT GYMAPEYL +GQLT+K DVYSFGVL+LE+VSGR+ N   ADD+   L T+ W+ +
Sbjct  477  IAGTFGYMAPEYLAQGQLTDKVDVYSFGVLMLEIVSGREFNKIPADDTLDTLVTIAWKHF  536

Query  530  RTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEP  351
            +  R++ I+DPS+E + + NE  +VVQ+ LLC Q  P +RP MS ++++LT E+ E+P P
Sbjct  537  KEKRAYRIIDPSMEIE-DVNEVVRVVQIALLCTQESPIMRPDMSTIIKLLTQENLEVPVP  595

Query  350  TQPPFINSSVLAGGSMSSIK  291
            ++PPFI+ S        SI 
Sbjct  596  SKPPFIDDSFYGSEQHGSIH  615



>gb|KJB50236.1| hypothetical protein B456_008G160000 [Gossypium raimondii]
 gb|KJB50237.1| hypothetical protein B456_008G160000 [Gossypium raimondii]
 gb|KJB50238.1| hypothetical protein B456_008G160000 [Gossypium raimondii]
Length=651

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 97/139 (70%), Gaps = 8/139 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+V+G+++N     + S S++   W
Sbjct  481  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGKQNNKSKATEYSDSIVTVTW  540

Query  539  RLYRTDRSFEIVDPSL------EGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLT  378
            R ++     EI DP+L       G    NE  +VVQ+GLLC Q IP+LRPSMS+V+ +LT
Sbjct  541  RHFQLGTMEEIYDPNLMLHNDNHGSNVRNEIFRVVQIGLLCTQEIPSLRPSMSKVLHLLT  600

Query  377  IEDREIPEPTQPPFINSSV  321
             +D ++P PT PPF++  +
Sbjct  601  KKDEDLPAPTNPPFLDEKM  619



>gb|AFW77897.1| putative DUF26-domain receptor-like protein kinase family protein 
[Zea mays]
Length=593

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVL+LE+V+GRKSN   A +++  SL+  +
Sbjct  435  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLILEIVTGRKSNNSVASSEEGLSLMALI  494

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W  Y T    E++D +L    +  +A +V  VGLLC QA P LRP M +VVEML+     
Sbjct  495  WSHYNTGTLMELLDLNLREQCSEEDALRVFHVGLLCTQASPNLRPPMWKVVEMLSGGREV  554

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  555  LPRPTQPPFIN  565



>ref|XP_006841050.1| hypothetical protein AMTR_s00085p00158310 [Amborella trichopoda]
 gb|ERN02725.1| hypothetical protein AMTR_s00085p00158310 [Amborella trichopoda]
Length=635

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 102/142 (72%), Gaps = 6/142 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRL  534
            ST IAGTLGYMAPEY+  GQLTEKADVYSFGVLVLE++SG+++N   D   +L+ T W+L
Sbjct  479  STAIAGTLGYMAPEYVAHGQLTEKADVYSFGVLVLEIISGKQNNRSVD---TLVPTSWKL  535

Query  533  YRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPE  354
            + +D    IVDPS+    +  E ++V+ +GLLC Q  P+LRP M+EVV+ L+ +  ++P 
Sbjct  536  FMSDAIMRIVDPSMS-IMDLAEVTRVIHIGLLCTQESPSLRPCMAEVVDYLSKQTVQLPS  594

Query  353  PTQPPFINSSVLAGGSMSSIKS  288
            PT+PPF++   L  GS S+ +S
Sbjct  595  PTKPPFMDE--LGAGSCSTSES  614



>ref|XP_004960388.1| PREDICTED: cysteine-rich receptor-like protein kinase 2-like 
[Setaria italica]
Length=653

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 94/131 (72%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVLVLE+++GRK++   A + +  SL+  +
Sbjct  495  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKNHNSVASSAEGLSLMALI  554

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W+ Y      E++DP+L    +  EA +V  +GLLC QA P LRP M +VVEML+   + 
Sbjct  555  WKHYNAGTLMELLDPNLRDQCSEEEALQVFHIGLLCAQASPNLRPPMWKVVEMLSGRAKV  614

Query  362  IPEPTQPPFIN  330
            +P PTQPPFI+
Sbjct  615  LPRPTQPPFID  625



>ref|XP_010026658.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
Length=648

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (67%), Gaps = 7/150 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL RGQLTEKADVYS+GVL+LE V+G ++N    ++ S SL+Q  W
Sbjct  478  STAIAGTLGYMAPEYLARGQLTEKADVYSYGVLLLENVTGIQNNRSKTSEYSDSLVQIAW  537

Query  539  RLYRTDRSFEIVDPSL----EGDFN-ANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
              ++ +R  E+ DP+L      D N  NE S+VV +GLLC Q  P+LRP MS+ +EMLT 
Sbjct  538  NHFQANRVEELFDPNLMLHNYPDSNIKNEVSRVVHIGLLCMQEAPSLRPKMSKALEMLTK  597

Query  374  EDREIPEPTQPPFINSSVLAGGSMSSIKSL  285
            +D E+P  T PPFI+   +    M   +S 
Sbjct  598  KDEELPPTTNPPFIDERTMTLNDMCKEQSF  627



>ref|XP_007044714.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 2 isoform 1 
[Theobroma cacao]
 gb|EOY00546.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 2 isoform 1 
[Theobroma cacao]
Length=652

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 97/140 (69%), Gaps = 8/140 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEK DVYSFGVL+LE+V+G+++N    A+ S SL+   W
Sbjct  481  STAIAGTLGYMAPEYLAHGQLTEKVDVYSFGVLLLEIVTGKQNNRSKAAEYSDSLVTIAW  540

Query  539  RLYRTDRSFEIVDPSLEGDFN------ANEASKVVQVGLLCCQAIPALRPSMSEVVEMLT  378
            + ++     EI DP+L    N       NE  +VV +GLLC Q IP+LRPSMS+V++MLT
Sbjct  541  KHFQLGTVEEIYDPNLMLHNNNHSSNVKNEIFRVVHIGLLCAQEIPSLRPSMSKVLQMLT  600

Query  377  IEDREIPEPTQPPFINSSVL  318
             +D ++P PT PPF++   +
Sbjct  601  KKDEDLPAPTNPPFMDEKTM  620



>ref|XP_010317091.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
43 isoform X2 [Solanum lycopersicum]
Length=312

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -3

Query  704  IAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAF-ADDSGSLLQTV-WRLY  531
            IAGT GYMAPEYL +GQL++K DVYSFGVL+LE+VSG++ N   ADD+   L T+ W+ +
Sbjct  132  IAGTFGYMAPEYLAQGQLSDKVDVYSFGVLILEIVSGQEFNKVPADDTLDTLVTIAWKHF  191

Query  530  RTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEP  351
            +  R++ I+DPS+E + + NE  +VVQ+ LLC Q  P +RP MS ++++LT ++ E+P P
Sbjct  192  KEKRAYRIIDPSMEIE-DVNEVLRVVQIALLCTQESPIMRPDMSTIIKLLTQKNIEVPVP  250

Query  350  TQPPFINSSVLAG  312
            ++PPFI+ S   G
Sbjct  251  SKPPFIDDSEQHG  263



>ref|XP_008649611.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Zea mays]
Length=654

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVL+LE+V+GRKSN   A +++  SL+  +
Sbjct  496  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLILEIVTGRKSNNSVASSEEGLSLMALI  555

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W  Y T    E++D +L    +  +A +V  VGLLC QA P LRP M +VVEML+     
Sbjct  556  WSHYNTGTLMELLDLNLREQCSEEDALRVFHVGLLCTQASPNLRPPMWKVVEMLSGGREV  615

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  616  LPRPTQPPFIN  626



>ref|XP_008649610.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Zea mays]
Length=656

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 3/131 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN---AFADDSGSLLQTV  543
            STG+AGT GYMAPEY+V GQLTEKAD+YS+GVL+LE+V+GRKSN   A +++  SL+  +
Sbjct  498  STGLAGTFGYMAPEYIVHGQLTEKADIYSYGVLILEIVTGRKSNNSVASSEEGLSLMALI  557

Query  542  WRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDRE  363
            W  Y T    E++D +L    +  +A +V  VGLLC QA P LRP M +VVEML+     
Sbjct  558  WSHYNTGTLMELLDLNLREQCSEEDALRVFHVGLLCTQASPNLRPPMWKVVEMLSGGREV  617

Query  362  IPEPTQPPFIN  330
            +P PTQPPFIN
Sbjct  618  LPRPTQPPFIN  628



>ref|XP_006416539.1| hypothetical protein EUTSA_v10007076mg [Eutrema salsugineum]
 gb|ESQ34892.1| hypothetical protein EUTSA_v10007076mg [Eutrema salsugineum]
Length=623

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 0/124 (0%)
 Frame = -3

Query  689  GYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGSLLQTVWRLYRTDRSFE  510
            GY+APEYL++GQLTEKADVY+FGVL++E+ +G+K+NAF   + S+L +VW  Y+ +    
Sbjct  492  GYLAPEYLIKGQLTEKADVYAFGVLIIEIATGKKNNAFTQGTSSVLYSVWEHYKANTLHR  551

Query  509  IVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEPTQPPFIN  330
             +DP L+G F   EA KV+++GLLC Q+   LRPSMSE+V ML  +D +   P QPPF++
Sbjct  552  SIDPRLKGKFTEEEALKVLEIGLLCVQSSVELRPSMSEIVFMLKNKDCKFDCPKQPPFLS  611

Query  329  SSVL  318
            +SVL
Sbjct  612  ASVL  615



>gb|KHG05033.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
 gb|KHG18968.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
 gb|KHG19685.1| Cysteine-rich receptor-like protein kinase 2 [Gossypium arboreum]
Length=648

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 98/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+V+G+++N     + S S++   W
Sbjct  478  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGKQNNKSKATEYSDSIVTVTW  537

Query  539  RLYRTDRSFEIVDPS--LEGDFNA----NEASKVVQVGLLCCQAIPALRPSMSEVVEMLT  378
            R ++     EI DP+  L  D N     NE  ++VQ+GLLC Q IP+LRPSMS+V+ +LT
Sbjct  538  RHFQLGTVEEIYDPNLMLHNDNNGSNVRNEIFRMVQIGLLCTQEIPSLRPSMSKVLHLLT  597

Query  377  IEDREIPEPTQPPFINSSV  321
             +D ++P PT PPF++  +
Sbjct  598  KKDEDLPAPTNPPFLDEKM  616



>ref|XP_009616730.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
 ref|XP_009616731.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Nicotiana 
tomentosiformis]
Length=652

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+V+GR++N     + S SL+   W
Sbjct  482  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIAW  541

Query  539  RLYRTDRSFEIVDPSLE-GDFNA----NEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
            + ++  R  E+ DP+L   +++     NE  +VV VGLLC Q +P LRPSMS+ ++ML  
Sbjct  542  QHFQHGRVEELFDPNLMLRNYHTINVKNEVLRVVHVGLLCTQEVPGLRPSMSKALQMLVK  601

Query  374  EDREIPEPTQPPFINSSVL  318
            ++ E+P PT PPFI+   +
Sbjct  602  KEEELPAPTNPPFIDEKTM  620



>ref|XP_008785014.1| PREDICTED: cysteine-rich receptor-like protein kinase 3 [Phoenix 
dactylifera]
Length=687

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 95/131 (73%), Gaps = 5/131 (4%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSGS----LLQT  546
            +T IAGTLGYMAPEYL  G+LTEKADV+SFGVL++E+V+G+++N+  D+  +    +LQ 
Sbjct  522  TTAIAGTLGYMAPEYLASGKLTEKADVFSFGVLLIEVVTGKRNNSRKDEQSNNPLGVLQM  581

Query  545  VWRLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDR  366
            VW  Y ++R  E VDP LEG+F   +AS+ + +GLLC Q    LRPSMS VV+ML  ED 
Sbjct  582  VWNCYTSNRMLEAVDPVLEGNFPLEKASRALHIGLLCAQLSAELRPSMSAVVKMLK-EDD  640

Query  365  EIPEPTQPPFI  333
             I +PT PPF+
Sbjct  641  TITQPTPPPFL  651



>ref|XP_009768897.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X1 [Nicotiana sylvestris]
Length=653

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+V+GR++N     + S SL+   W
Sbjct  483  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIAW  542

Query  539  RLYRTDRSFEIVDPSLE-GDFNA----NEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
            + ++  R  E+ DP+L   +++     NE  +VV VGLLC Q +P LRPSMS+ ++ML  
Sbjct  543  QHFQHGRVEELFDPNLMLHNYHTINVENEVLRVVHVGLLCTQEVPGLRPSMSKALQMLVK  602

Query  374  EDREIPEPTQPPFINSSVL  318
            ++ E+P PT PPF++   +
Sbjct  603  KEEELPAPTNPPFVDEKTM  621



>ref|XP_009768898.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 isoform 
X2 [Nicotiana sylvestris]
Length=652

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+V+GR++N     + S SL+   W
Sbjct  482  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIVTGRQNNRSKHTEYSDSLISIAW  541

Query  539  RLYRTDRSFEIVDPSLE-GDFNA----NEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
            + ++  R  E+ DP+L   +++     NE  +VV VGLLC Q +P LRPSMS+ ++ML  
Sbjct  542  QHFQHGRVEELFDPNLMLHNYHTINVENEVLRVVHVGLLCTQEVPGLRPSMSKALQMLVK  601

Query  374  EDREIPEPTQPPFINSSVL  318
            ++ E+P PT PPF++   +
Sbjct  602  KEEELPAPTNPPFVDEKTM  620



>ref|XP_010023497.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023498.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 ref|XP_010023499.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Eucalyptus 
grandis]
 gb|KCW59789.1| hypothetical protein EUGRSUZ_H02538 [Eucalyptus grandis]
Length=651

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 95/139 (68%), Gaps = 7/139 (5%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFAD--DSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYS+GVL+LE V+GR++N   +   S SL+   W
Sbjct  481  STAIAGTLGYMAPEYLAHGQLTEKADVYSYGVLLLETVTGRQNNRSKNLEYSESLITIAW  540

Query  539  RLYRTDRSFEIVDPS--LEGDFN---ANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTI  375
              ++ +R  E+ DPS  L    N    NE  +V+ +GLLC Q  P+LRP+MSE ++MLT 
Sbjct  541  NHFQANRVEELFDPSLMLHNHHNRNIKNEVLRVIHIGLLCTQEAPSLRPTMSEALQMLTK  600

Query  374  EDREIPEPTQPPFINSSVL  318
            ++ E+P PT PPFI+   +
Sbjct  601  KNEELPPPTNPPFIDERTM  619



>ref|XP_002265910.1| PREDICTED: cysteine-rich receptor-like protein kinase 2 [Vitis 
vinifera]
 emb|CBI28578.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+ +GR++N    A+ S SL+   W
Sbjct  484  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIATGRQNNRSKTAEYSDSLVTIAW  543

Query  539  RLYRTDRSFEIVDPSL------EGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLT  378
            + ++     E+ DP+L       G+   NE  +V+Q+GLLC Q +P+LRPSMS+ ++MLT
Sbjct  544  KHFQLGTLEELFDPNLMLHNHDNGNIK-NEVLRVMQIGLLCTQEVPSLRPSMSKALQMLT  602

Query  377  IEDREIPEPTQPPFINSSVL  318
             +D  +P PT PPFI+   +
Sbjct  603  KKDEHLPTPTSPPFIDERTM  622



>ref|XP_004233329.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
43 isoform X1 [Solanum lycopersicum]
Length=409

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 98/133 (74%), Gaps = 3/133 (2%)
 Frame = -3

Query  704  IAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAF-ADDSGSLLQTV-WRLY  531
            IAGT GYMAPEYL +GQL++K DVYSFGVL+LE+VSG++ N   ADD+   L T+ W+ +
Sbjct  229  IAGTFGYMAPEYLAQGQLSDKVDVYSFGVLILEIVSGQEFNKVPADDTLDTLVTIAWKHF  288

Query  530  RTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREIPEP  351
            +  R++ I+DPS+E + + NE  +VVQ+ LLC Q  P +RP MS ++++LT ++ E+P P
Sbjct  289  KEKRAYRIIDPSMEIE-DVNEVLRVVQIALLCTQESPIMRPDMSTIIKLLTQKNIEVPVP  347

Query  350  TQPPFINSSVLAG  312
            ++PPFI+ S   G
Sbjct  348  SKPPFIDDSEQHG  360



>emb|CAN64526.1| hypothetical protein VITISV_005913 [Vitis vinifera]
Length=654

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 9/140 (6%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSN--AFADDSGSLLQTVW  540
            ST IAGTLGYMAPEYL  GQLTEKADVYSFGVL+LE+ +GR++N    A+ S SL+   W
Sbjct  484  STAIAGTLGYMAPEYLAHGQLTEKADVYSFGVLLLEIXTGRQNNRSKTAEYSDSLVTIAW  543

Query  539  RLYRTDRSFEIVDPSL------EGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLT  378
            + ++     E+ DP+L       G+   NE  +V+Q+GLLC Q +P+LRPSMS+ ++MLT
Sbjct  544  KHFQLGTLEELFDPNLMLHNHDNGNIK-NEVLRVMQIGLLCTQEVPSLRPSMSKALQMLT  602

Query  377  IEDREIPEPTQPPFINSSVL  318
             +D  +P PT PPFI+   +
Sbjct  603  KKDEHLPTPTSPPFIDERTM  622



>ref|XP_006446553.1| hypothetical protein CICLE_v10018177mg [Citrus clementina]
 gb|ESR59793.1| hypothetical protein CICLE_v10018177mg [Citrus clementina]
Length=579

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG--SLLQTVW  540
            +T IAGTLGYMAPEY+  GQLTEK D+YSFGVLVLE+VSG ++N F  D G  +L+   W
Sbjct  428  NTAIAGTLGYMAPEYIANGQLTEKVDIYSFGVLVLEIVSGVQNNKFQSDDGFETLVTHTW  487

Query  539  RLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREI  360
            + ++     EI+D S+E + +  E  +VV VGLLC Q +P LRPSM+ VV+ML  +D  +
Sbjct  488  KHFQAKTVLEIIDKSIEIE-DVEEVKRVVWVGLLCTQELPTLRPSMTNVVQMLKQKDITL  546

Query  359  PEPTQPPFINSSV  321
            P P++PPF +  +
Sbjct  547  PTPSKPPFTDECM  559



>gb|KDO55205.1| hypothetical protein CISIN_1g037160mg, partial [Citrus sinensis]
Length=569

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG--SLLQTVW  540
            +T IAGTLGYMAPEY+  GQLTEK D+YSFGVLVLE+VSG ++N F  D G  +L+   W
Sbjct  417  NTAIAGTLGYMAPEYIANGQLTEKVDIYSFGVLVLEIVSGVQNNKFQSDDGFETLVTHTW  476

Query  539  RLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREI  360
            + ++     EI+D S+E + +  E  +VV VGLLC Q +P LRPSM+ VV+ML  +D  +
Sbjct  477  KHFQAKTVLEIIDKSIEIE-DIEEVKRVVWVGLLCTQELPTLRPSMTNVVQMLKQKDITL  535

Query  359  PEPTQPPFINSSV  321
            P P++PPF +  +
Sbjct  536  PTPSKPPFTDECM  548



>ref|XP_006470476.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
43-like [Citrus sinensis]
Length=625

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 93/133 (70%), Gaps = 3/133 (2%)
 Frame = -3

Query  713  STGIAGTLGYMAPEYLVRGQLTEKADVYSFGVLVLEMVSGRKSNAFADDSG--SLLQTVW  540
            +T IAGTLGYMAPEY+  GQLTEK D+YSFGVLVLE+VSG ++N F  D G  +L+   W
Sbjct  473  NTAIAGTLGYMAPEYIANGQLTEKVDIYSFGVLVLEIVSGVQNNKFQSDDGFETLVTHTW  532

Query  539  RLYRTDRSFEIVDPSLEGDFNANEASKVVQVGLLCCQAIPALRPSMSEVVEMLTIEDREI  360
            + ++     EI+D S+E + +  E  +VV VGLLC Q +P LRPSM+ VV+ML  +D  +
Sbjct  533  KHFQAKTVLEIIDKSIEIE-DIEEVKRVVWVGLLCTQELPTLRPSMTNVVQMLKQKDITL  591

Query  359  PEPTQPPFINSSV  321
            P P++PPF +  +
Sbjct  592  PTPSKPPFTDECM  604



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395