BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013K15

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009631161.1|  PREDICTED: polyadenylate-binding protein 2         240   2e-75   Nicotiana tomentosiformis
ref|XP_004235203.1|  PREDICTED: polyadenylate-binding protein 2         238   1e-74   Solanum lycopersicum
ref|XP_006358184.1|  PREDICTED: polyadenylate-binding protein 2-like    237   3e-74   Solanum tuberosum [potatoes]
gb|KDP22495.1|  hypothetical protein JCGZ_26326                         235   1e-73   Jatropha curcas
ref|XP_002511041.1|  polyadenylate-binding protein, putative            233   8e-73   
ref|XP_010933557.1|  PREDICTED: polyadenylate-binding protein 2-like    231   5e-72   Elaeis guineensis
ref|XP_010269828.1|  PREDICTED: polyadenylate-binding protein 2-like    231   7e-72   Nelumbo nucifera [Indian lotus]
emb|CDP01496.1|  unnamed protein product                                230   1e-71   Coffea canephora [robusta coffee]
ref|XP_010274505.1|  PREDICTED: polyadenylate-binding protein 2         230   2e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004307764.1|  PREDICTED: polyadenylate-binding protein 1         229   2e-71   Fragaria vesca subsp. vesca
ref|XP_009363742.1|  PREDICTED: polyadenylate-binding protein 2         229   5e-71   Pyrus x bretschneideri [bai li]
ref|XP_011003544.1|  PREDICTED: polyadenylate-binding protein 1-like    228   1e-70   Populus euphratica
ref|XP_007038220.1|  RNA-binding family protein                         227   2e-70   
emb|CAN77560.1|  hypothetical protein VITISV_031100                     225   3e-70   Vitis vinifera
gb|ACN41220.1|  unknown                                                 226   3e-70   Picea sitchensis
gb|ABK21856.1|  unknown                                                 226   6e-70   Picea sitchensis
ref|XP_002279148.1|  PREDICTED: polyadenylate-binding protein 2         226   6e-70   Vitis vinifera
ref|XP_006376950.1|  hypothetical protein POPTR_0012s11480g             226   8e-70   Populus trichocarpa [western balsam poplar]
gb|KJB19595.1|  hypothetical protein B456_003G110600                    225   1e-69   Gossypium raimondii
gb|KJB07918.1|  hypothetical protein B456_001G052500                    225   1e-69   Gossypium raimondii
ref|XP_010062822.1|  PREDICTED: polyadenylate-binding protein 2 i...    225   2e-69   Eucalyptus grandis [rose gum]
gb|KCW90905.1|  hypothetical protein EUGRSUZ_A02940                     225   2e-69   Eucalyptus grandis [rose gum]
ref|XP_010062812.1|  PREDICTED: polyadenylate-binding protein 2 i...    225   2e-69   Eucalyptus grandis [rose gum]
ref|XP_008234027.1|  PREDICTED: polyadenylate-binding protein 2         224   2e-69   Prunus mume [ume]
ref|XP_008364853.1|  PREDICTED: polyadenylate-binding protein 2-like    224   2e-69   
ref|XP_007218817.1|  hypothetical protein PRUPE_ppa010052mg             226   3e-69   
ref|XP_011040326.1|  PREDICTED: polyadenylate-binding protein 1 i...    224   4e-69   Populus euphratica
ref|XP_011040327.1|  PREDICTED: polyadenylate-binding protein 1 i...    224   4e-69   Populus euphratica
ref|XP_011076455.1|  PREDICTED: polyadenylate-binding protein 1 i...    224   4e-69   Sesamum indicum [beniseed]
gb|KJB19594.1|  hypothetical protein B456_003G110600                    224   4e-69   Gossypium raimondii
gb|KJB07914.1|  hypothetical protein B456_001G052500                    224   4e-69   Gossypium raimondii
ref|XP_010937392.1|  PREDICTED: polyadenylate-binding protein 2 i...    223   6e-69   Elaeis guineensis
ref|XP_010937393.1|  PREDICTED: polyadenylate-binding protein 2 i...    223   6e-69   Elaeis guineensis
ref|XP_008453840.1|  PREDICTED: polyadenylate-binding protein 2-l...    223   9e-69   Cucumis melo [Oriental melon]
gb|KHG12327.1|  Polyadenylate-binding 2                                 223   1e-68   Gossypium arboreum [tree cotton]
ref|XP_008777640.1|  PREDICTED: polyadenylate-binding protein 2-like    223   1e-68   Phoenix dactylifera
ref|XP_004146890.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    223   1e-68   
ref|XP_004166616.1|  PREDICTED: polyadenylate-binding protein 2-like    223   2e-68   
ref|XP_002511038.1|  polyadenylate-binding protein, putative            223   2e-68   
ref|XP_006437033.1|  hypothetical protein CICLE_v10032621mg             222   2e-68   
ref|XP_006374587.1|  hypothetical protein POPTR_0015s12230g             222   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_008786202.1|  PREDICTED: polyadenylate-binding protein 2-like    221   3e-68   Phoenix dactylifera
ref|XP_006828070.1|  hypothetical protein AMTR_s00008p00267630          221   3e-68   Amborella trichopoda
ref|NP_001275811.1|  poly(A)-binding protein 1                          221   4e-68   Citrus sinensis [apfelsine]
ref|XP_009362727.1|  PREDICTED: polyadenylate-binding protein 2-like    221   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_007205858.1|  hypothetical protein PRUPE_ppa011157mg             221   4e-68   Prunus persica
ref|XP_008353926.1|  PREDICTED: polyadenylate-binding protein 2-l...    221   5e-68   
ref|XP_003635560.2|  PREDICTED: polyadenylate-binding protein 2         221   5e-68   Vitis vinifera
ref|XP_002531675.1|  poly-A binding protein, putative                   221   5e-68   Ricinus communis
ref|XP_006485035.1|  PREDICTED: polyadenylate-binding protein 2 i...    221   5e-68   Citrus sinensis [apfelsine]
ref|XP_008353925.1|  PREDICTED: polyadenylate-binding protein 2-l...    221   7e-68   
gb|KHN30707.1|  Polyadenylate-binding protein 2                         220   8e-68   Glycine soja [wild soybean]
ref|XP_010917314.1|  PREDICTED: polyadenylate-binding protein 2-like    220   8e-68   Elaeis guineensis
ref|XP_010523297.1|  PREDICTED: polyadenylate-binding protein 2-like    219   9e-68   Tarenaya hassleriana [spider flower]
ref|XP_006437034.1|  hypothetical protein CICLE_v10032621mg             221   9e-68   Citrus clementina [clementine]
gb|KJB17316.1|  hypothetical protein B456_003G040800                    218   1e-67   Gossypium raimondii
ref|XP_010267253.1|  PREDICTED: polyadenylate-binding protein 2         220   1e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007144150.1|  hypothetical protein PHAVU_007G133000g             219   1e-67   Phaseolus vulgaris [French bean]
ref|XP_009344452.1|  PREDICTED: polyadenylate-binding protein 2 i...    219   1e-67   
gb|KJB17317.1|  hypothetical protein B456_003G040800                    219   2e-67   Gossypium raimondii
ref|XP_009344451.1|  PREDICTED: polyadenylate-binding protein 2 i...    219   2e-67   Pyrus x bretschneideri [bai li]
ref|XP_008381986.1|  PREDICTED: polyadenylate-binding protein 2 i...    219   3e-67   Malus domestica [apple tree]
gb|KJB17319.1|  hypothetical protein B456_003G040800                    219   3e-67   Gossypium raimondii
gb|KHG00394.1|  Polyadenylate-binding 2                                 219   4e-67   Gossypium arboreum [tree cotton]
ref|XP_003608452.1|  Polyadenylate-binding protein                      218   5e-67   Medicago truncatula
ref|XP_004495250.1|  PREDICTED: polyadenylate-binding protein 2-l...    218   5e-67   
ref|XP_008453839.1|  PREDICTED: polyadenylate-binding protein 2-l...    218   5e-67   Cucumis melo [Oriental melon]
ref|XP_004495249.1|  PREDICTED: polyadenylate-binding protein 2-l...    218   7e-67   
gb|KJB51353.1|  hypothetical protein B456_008G213100                    217   1e-66   Gossypium raimondii
ref|XP_004137160.1|  PREDICTED: polyadenylate-binding protein 2-like    216   1e-66   Cucumis sativus [cucumbers]
gb|ACU17272.1|  unknown                                                 216   1e-66   Glycine max [soybeans]
ref|XP_008462875.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   1e-66   Cucumis melo [Oriental melon]
gb|KGN53719.1|  hypothetical protein Csa_4G110060                       216   1e-66   Cucumis sativus [cucumbers]
gb|KJB51351.1|  hypothetical protein B456_008G213100                    217   1e-66   Gossypium raimondii
ref|XP_009404041.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404040.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010094140.1|  Polyadenylate-binding protein 2                    216   2e-66   Morus notabilis
ref|XP_002306300.1|  hypothetical protein POPTR_0005s07440g             216   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_011031058.1|  PREDICTED: polyadenylate-binding protein 3-l...    216   2e-66   Populus euphratica
gb|AFK38116.1|  unknown                                                 216   3e-66   Medicago truncatula
ref|NP_001237617.1|  uncharacterized protein LOC100527545               216   3e-66   
ref|XP_008462873.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   3e-66   Cucumis melo [Oriental melon]
gb|KJB51354.1|  hypothetical protein B456_008G213100                    216   3e-66   Gossypium raimondii
ref|XP_004504815.1|  PREDICTED: polyadenylate-binding protein 2-A...    215   3e-66   Cicer arietinum [garbanzo]
ref|XP_004504816.1|  PREDICTED: polyadenylate-binding protein 2-A...    215   3e-66   Cicer arietinum [garbanzo]
ref|NP_001235474.1|  uncharacterized protein LOC100527139               216   4e-66   
gb|KHG11684.1|  Polyadenylate-binding 2                                 216   4e-66   Gossypium arboreum [tree cotton]
ref|XP_004504812.1|  PREDICTED: polyadenylate-binding protein 2-A...    216   5e-66   
ref|XP_010519384.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   5e-66   Tarenaya hassleriana [spider flower]
ref|XP_008804765.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   5e-66   Phoenix dactylifera
ref|XP_008804766.1|  PREDICTED: polyadenylate-binding protein 2-l...    216   6e-66   Phoenix dactylifera
ref|XP_002321779.2|  hypothetical protein POPTR_0015s12230g             216   6e-66   
ref|XP_006374586.1|  hypothetical protein POPTR_0015s12230g             216   6e-66   
ref|XP_011022817.1|  PREDICTED: polyadenylate-binding protein 2-l...    215   7e-66   Populus euphratica
ref|XP_004146877.1|  PREDICTED: polyadenylate-binding protein 2-like    215   8e-66   Cucumis sativus [cucumbers]
ref|XP_007148398.1|  hypothetical protein PHAVU_006G205100g             214   9e-66   Phaseolus vulgaris [French bean]
ref|XP_004168611.1|  PREDICTED: polyadenylate-binding protein 2-like    214   1e-65   
gb|KGN53209.1|  hypothetical protein Csa_4G026860                       215   1e-65   Cucumis sativus [cucumbers]
ref|NP_201329.1|  RNA recognition motif-containing protein              214   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394056.1|  hypothetical protein EUTSA_v10004890mg             214   1e-65   Eutrema salsugineum [saltwater cress]
ref|XP_002866661.1|  polyadenylate-binding protein family protein       214   1e-65   Arabidopsis lyrata subsp. lyrata
ref|XP_006279497.1|  hypothetical protein CARUB_v10027046mg             215   2e-65   
gb|AFK33591.1|  unknown                                                 213   2e-65   Medicago truncatula
ref|XP_010444551.1|  PREDICTED: polyadenylate-binding protein 2-l...    214   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010463257.1|  PREDICTED: polyadenylate-binding protein 2-like    214   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011084771.1|  PREDICTED: polyadenylate-binding protein 1-like    214   2e-65   Sesamum indicum [beniseed]
gb|ACJ85460.1|  unknown                                                 214   2e-65   Medicago truncatula
ref|XP_010444550.1|  PREDICTED: polyadenylate-binding protein 2-l...    214   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002323754.1|  hypothetical protein POPTR_0017s07850g             213   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004164242.1|  PREDICTED: polyadenylate-binding protein 2-like    213   4e-65   
ref|XP_008453809.1|  PREDICTED: polyadenylate-binding protein 2 i...    213   5e-65   
ref|NP_001288928.1|  polyadenylate-binding protein 2                    213   5e-65   Brassica rapa
gb|KFK28208.1|  hypothetical protein AALP_AA8G486500                    213   6e-65   Arabis alpina [alpine rockcress]
ref|XP_010937391.1|  PREDICTED: polyadenylate-binding protein 2 i...    213   6e-65   
ref|XP_010937390.1|  PREDICTED: polyadenylate-binding protein 2 i...    213   6e-65   
ref|XP_004504101.1|  PREDICTED: polyadenylate-binding protein 2-A...    213   7e-65   Cicer arietinum [garbanzo]
ref|XP_011076456.1|  PREDICTED: polyadenylate-binding protein 1 i...    210   9e-65   
ref|XP_002309968.1|  hypothetical protein POPTR_0007s05140g             213   9e-65   Populus trichocarpa [western balsam poplar]
emb|CDY37814.1|  BnaAnng04750D                                          210   1e-64   Brassica napus [oilseed rape]
ref|XP_008392810.1|  PREDICTED: polyadenylate-binding protein 2-like    210   1e-64   
ref|XP_009624759.1|  PREDICTED: polyadenylate-binding protein 2-like    211   1e-64   Nicotiana tomentosiformis
gb|KJB19596.1|  hypothetical protein B456_003G110600                    213   1e-64   Gossypium raimondii
ref|XP_006466250.1|  PREDICTED: polyadenylate-binding protein 2-like    212   1e-64   Citrus sinensis [apfelsine]
ref|XP_010318203.1|  PREDICTED: polyadenylate-binding protein 2-like    210   1e-64   
emb|CDY55162.1|  BnaCnng28280D                                          212   1e-64   Brassica napus [oilseed rape]
ref|NP_001239931.1|  uncharacterized protein LOC100791351               211   2e-64   Glycine max [soybeans]
gb|KDO60716.1|  hypothetical protein CISIN_1g041633mg                   212   2e-64   Citrus sinensis [apfelsine]
ref|XP_009130503.1|  PREDICTED: polyadenylate-binding protein 2-like    211   2e-64   Brassica rapa
gb|AFK45960.1|  unknown                                                 210   2e-64   Lotus japonicus
ref|XP_003590723.1|  Polyadenylate-binding protein                      210   2e-64   
ref|XP_007047889.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    211   2e-64   
ref|XP_002983261.1|  hypothetical protein SELMODRAFT_117870             211   2e-64   
ref|XP_007159120.1|  hypothetical protein PHAVU_002G210300g             211   3e-64   Phaseolus vulgaris [French bean]
ref|XP_007047888.1|  RNA-binding (RRM/RBD/RNP motifs) family prot...    211   3e-64   
gb|EYU20156.1|  hypothetical protein MIMGU_mgv1a008942mg                216   3e-64   Erythranthe guttata [common monkey flower]
gb|AFK37484.1|  unknown                                                 211   3e-64   Lotus japonicus
ref|XP_006838494.1|  hypothetical protein AMTR_s00002p00165660          211   3e-64   
ref|XP_010484391.1|  PREDICTED: polyadenylate-binding protein 2-l...    211   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010484390.1|  PREDICTED: polyadenylate-binding protein 2-l...    211   3e-64   Camelina sativa [gold-of-pleasure]
gb|AGV54499.1|  RNA binding/nucleic acid binding                        211   3e-64   Phaseolus vulgaris [French bean]
ref|XP_010680512.1|  PREDICTED: polyadenylate-binding protein 2         211   4e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010030027.1|  PREDICTED: polyadenylate-binding protein 2-like    210   5e-64   Eucalyptus grandis [rose gum]
ref|XP_004143458.1|  PREDICTED: polyadenylate-binding protein 2-like    210   5e-64   Cucumis sativus [cucumbers]
ref|XP_007159717.1|  hypothetical protein PHAVU_002G261500g             210   5e-64   Phaseolus vulgaris [French bean]
gb|ACU19123.1|  unknown                                                 210   5e-64   Glycine max [soybeans]
ref|XP_006358185.1|  PREDICTED: polyadenylate-binding protein 2-l...    208   6e-64   Solanum tuberosum [potatoes]
ref|XP_010676727.1|  PREDICTED: polyadenylate-binding protein 1-like    210   6e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010536563.1|  PREDICTED: polyadenylate-binding protein 2         211   6e-64   Tarenaya hassleriana [spider flower]
ref|NP_001240115.1|  uncharacterized protein LOC100784473               209   7e-64   Glycine max [soybeans]
ref|XP_002961293.1|  hypothetical protein SELMODRAFT_74095              210   7e-64   
gb|KHN29042.1|  Polyadenylate-binding protein 2                         209   1e-63   Glycine soja [wild soybean]
emb|CDP20626.1|  unnamed protein product                                209   1e-63   Coffea canephora [robusta coffee]
ref|XP_003525045.1|  PREDICTED: polyadenylate-binding protein 2 i...    209   1e-63   Glycine max [soybeans]
ref|XP_006585263.1|  PREDICTED: polyadenylate-binding protein 2-A       209   1e-63   Glycine max [soybeans]
ref|XP_002525843.1|  poly-A binding protein, putative                   209   1e-63   Ricinus communis
gb|AFK45716.1|  unknown                                                 209   1e-63   Lotus japonicus
ref|XP_009404038.1|  PREDICTED: polyadenylate-binding protein 2-l...    209   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404039.1|  PREDICTED: polyadenylate-binding protein 2-l...    209   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84516.1|  unknown                                                 209   2e-63   Medicago truncatula
gb|KFK25338.1|  hypothetical protein AALP_AA8G099700                    209   2e-63   Arabis alpina [alpine rockcress]
gb|EYU23964.1|  hypothetical protein MIMGU_mgv1a013628mg                209   2e-63   Erythranthe guttata [common monkey flower]
gb|KCW56969.1|  hypothetical protein EUGRSUZ_I02641                     209   2e-63   Eucalyptus grandis [rose gum]
gb|KJB47020.1|  hypothetical protein B456_008G016100                    208   3e-63   Gossypium raimondii
ref|XP_006353217.1|  PREDICTED: polyadenylate-binding protein 2-A...    208   3e-63   Solanum tuberosum [potatoes]
gb|ACU24426.1|  unknown                                                 208   3e-63   Glycine max [soybeans]
ref|XP_011092432.1|  PREDICTED: polyadenylate-binding protein 2-l...    207   4e-63   
emb|CDY33970.1|  BnaC02g43670D                                          208   5e-63   Brassica napus [oilseed rape]
gb|KDP40916.1|  hypothetical protein JCGZ_24915                         207   6e-63   Jatropha curcas
ref|XP_009760239.1|  PREDICTED: polyadenylate-binding protein 2-like    207   7e-63   Nicotiana sylvestris
ref|XP_010442595.1|  PREDICTED: polyadenylate-binding protein 2-like    208   7e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006281051.1|  hypothetical protein CARUB_v10027069mg             207   8e-63   Capsella rubella
ref|XP_010027916.1|  PREDICTED: polyadenylate-binding protein 2 i...    207   8e-63   Eucalyptus grandis [rose gum]
gb|KHG15936.1|  Polyadenylate-binding 2                                 206   8e-63   Gossypium arboreum [tree cotton]
ref|XP_006366227.1|  PREDICTED: polyadenylate-binding protein 2-A...    207   9e-63   Solanum tuberosum [potatoes]
ref|XP_006402013.1|  hypothetical protein EUTSA_v10014588mg             207   9e-63   Eutrema salsugineum [saltwater cress]
gb|AFK37159.1|  unknown                                                 207   1e-62   Lotus japonicus
ref|XP_011092431.1|  PREDICTED: polyadenylate-binding protein 2-l...    206   1e-62   Sesamum indicum [beniseed]
ref|XP_009776052.1|  PREDICTED: polyadenylate-binding protein 2-like    206   2e-62   Nicotiana sylvestris
ref|XP_009611267.1|  PREDICTED: polyadenylate-binding protein 2         206   2e-62   Nicotiana tomentosiformis
ref|XP_009390281.1|  PREDICTED: polyadenylate-binding protein 2-l...    206   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390280.1|  PREDICTED: polyadenylate-binding protein 2-l...    206   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26726.1|  hypothetical protein AALP_AA8G284900                    206   3e-62   Arabis alpina [alpine rockcress]
ref|XP_007042909.1|  RNA-binding family protein isoform 1               205   3e-62   Theobroma cacao [chocolate]
ref|XP_009132625.1|  PREDICTED: polyadenylate-binding protein 2-like    206   3e-62   Brassica rapa
gb|AFJ66183.1|  hypothetical protein 11M19.19                           206   3e-62   Arabidopsis halleri
ref|XP_002864097.1|  hypothetical protein ARALYDRAFT_918145             206   3e-62   Arabidopsis lyrata subsp. lyrata
ref|XP_007042910.1|  RNA-binding family protein isoform 2               204   4e-62   
ref|XP_001784768.1|  predicted protein                                  205   5e-62   
gb|EYU35168.1|  hypothetical protein MIMGU_mgv1a013256mg                205   6e-62   Erythranthe guttata [common monkey flower]
ref|NP_850803.1|  RNA recognition motif-containing protein              204   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140879.1|  PREDICTED: polyadenylate-binding protein 2-like    205   7e-62   Brassica rapa
ref|XP_006359788.1|  PREDICTED: polyadenylate-binding protein 2-like    204   7e-62   Solanum tuberosum [potatoes]
ref|XP_002873452.1|  polyadenylate-binding protein family protein       204   1e-61   
gb|EYU35167.1|  hypothetical protein MIMGU_mgv1a013256mg                205   1e-61   Erythranthe guttata [common monkey flower]
ref|NP_196597.1|  RNA recognition motif-containing protein              204   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004250109.1|  PREDICTED: polyadenylate-binding protein 2 i...    204   2e-61   
ref|XP_004504814.1|  PREDICTED: polyadenylate-binding protein 2-A...    203   2e-61   
ref|XP_004288178.1|  PREDICTED: polyadenylate-binding protein 2-like    204   2e-61   Fragaria vesca subsp. vesca
dbj|BAA97374.1|  unnamed protein product                                205   3e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61036.1|  contains similarity to poly(A)-binding protein II       204   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568751.1|  polyadenylate-binding protein 1                       204   3e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71690.1|  BnaC09g27310D                                          204   3e-61   
ref|XP_009393548.1|  PREDICTED: polyadenylate-binding protein 2-like    203   4e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009127326.1|  PREDICTED: polyadenylate-binding protein 2-like    204   4e-61   Brassica rapa
emb|CDY16338.1|  BnaA02g11420D                                          203   5e-61   Brassica napus [oilseed rape]
ref|XP_010690525.1|  PREDICTED: polyadenylate-binding protein 3-l...    202   6e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690526.1|  PREDICTED: polyadenylate-binding protein 2-l...    202   7e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010555595.1|  PREDICTED: polyadenylate-binding protein 2-like    202   8e-61   Tarenaya hassleriana [spider flower]
gb|AHA84276.1|  polyadenylate-binding protein 2                         202   1e-60   Phaseolus vulgaris [French bean]
ref|XP_001752237.1|  predicted protein                                  199   1e-60   
ref|XP_010273013.1|  PREDICTED: polyadenylate-binding protein 2 i...    199   1e-60   
ref|XP_010273012.1|  PREDICTED: polyadenylate-binding protein 2 i...    199   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010109150.1|  Polyadenylate-binding protein 2                    207   2e-60   
pdb|2M70|A  Chain A, Structural Determination Of The Citrus Sinen...    199   2e-60   Citrus sinensis [apfelsine]
ref|XP_011097543.1|  PREDICTED: polyadenylate-binding protein 2 i...    201   2e-60   Sesamum indicum [beniseed]
emb|CDX91567.1|  BnaC02g15930D                                          201   5e-60   
ref|XP_011465382.1|  PREDICTED: polyadenylate-binding protein 2-like    199   1e-59   Fragaria vesca subsp. vesca
gb|KHG28448.1|  Polyadenylate-binding 2                                 198   2e-59   Gossypium arboreum [tree cotton]
ref|XP_010027917.1|  PREDICTED: polyadenylate-binding protein 2 i...    199   2e-59   Eucalyptus grandis [rose gum]
gb|KJB79638.1|  hypothetical protein B456_013G060100                    198   2e-59   Gossypium raimondii
ref|XP_004248796.1|  PREDICTED: polyadenylate-binding protein 2-like    198   2e-59   Solanum lycopersicum
gb|KJB79639.1|  hypothetical protein B456_013G060100                    197   2e-59   Gossypium raimondii
gb|KJB79637.1|  hypothetical protein B456_013G060100                    198   2e-59   Gossypium raimondii
gb|EYU39126.1|  hypothetical protein MIMGU_mgv1a012968mg                197   8e-59   Erythranthe guttata [common monkey flower]
ref|NP_001190512.1|  polyadenylate-binding protein 1                    194   9e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043113.1|  PREDICTED: polyadenylate-binding protein 2-like    196   1e-58   Populus euphratica
ref|XP_006288515.1|  hypothetical protein CARUB_v10001786mg             197   1e-58   
ref|XP_006492630.1|  PREDICTED: polyadenylate-binding protein 2-l...    196   1e-58   Citrus sinensis [apfelsine]
ref|XP_001784990.1|  predicted protein                                  196   2e-58   
ref|XP_004964965.1|  PREDICTED: polyadenylate-binding protein 2-l...    196   2e-58   Setaria italica
ref|XP_006288516.1|  hypothetical protein CARUB_v10001786mg             197   2e-58   
ref|XP_004964966.1|  PREDICTED: polyadenylate-binding protein 2-l...    195   3e-58   Setaria italica
ref|XP_010318196.1|  PREDICTED: polyadenylate-binding protein 2-l...    194   4e-58   
ref|XP_006399527.1|  hypothetical protein EUTSA_v10014635mg             194   5e-58   
ref|XP_011003863.1|  PREDICTED: polyadenylate-binding protein 2-l...    194   6e-58   Populus euphratica
ref|XP_011003864.1|  PREDICTED: polyadenylate-binding protein 2-l...    194   6e-58   Populus euphratica
gb|ACF87534.1|  unknown                                                 194   6e-58   Zea mays [maize]
ref|XP_002436725.1|  hypothetical protein SORBIDRAFT_10g007620          194   7e-58   Sorghum bicolor [broomcorn]
ref|NP_001190511.1|  polyadenylate-binding protein 1                    196   7e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399528.1|  hypothetical protein EUTSA_v10014635mg             194   9e-58   Eutrema salsugineum [saltwater cress]
ref|XP_001766601.1|  predicted protein                                  195   1e-57   
ref|NP_001149957.1|  polyadenylate-binding protein 2                    193   1e-57   
gb|KDO50217.1|  hypothetical protein CISIN_1g029268mg                   192   1e-57   Citrus sinensis [apfelsine]
ref|XP_004964967.1|  PREDICTED: polyadenylate-binding protein 2-l...    193   2e-57   Setaria italica
gb|KDO50216.1|  hypothetical protein CISIN_1g029268mg                   192   2e-57   Citrus sinensis [apfelsine]
gb|ACR34224.1|  unknown                                                 192   4e-57   Zea mays [maize]
ref|XP_002300187.2|  hypothetical protein POPTR_0001s31900g             193   6e-57   
ref|XP_008658656.1|  PREDICTED: polyadenylate-binding protein 2 i...    192   9e-57   Zea mays [maize]
ref|XP_006492629.1|  PREDICTED: polyadenylate-binding protein 2-l...    191   1e-56   Citrus sinensis [apfelsine]
ref|XP_009385630.1|  PREDICTED: polyadenylate-binding protein 2-l...    190   4e-56   
ref|XP_010453061.1|  PREDICTED: polyadenylate-binding protein 2-like    190   6e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009385631.1|  PREDICTED: polyadenylate-binding protein 2-l...    189   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009385628.1|  PREDICTED: polyadenylate-binding protein 2-l...    190   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001152340.1|  polyadenylate-binding protein 2                    187   2e-55   Zea mays [maize]
ref|XP_002273141.1|  PREDICTED: polyadenylate-binding protein 2-l...    186   5e-55   Vitis vinifera
gb|AFW71284.1|  hypothetical protein ZEAMMB73_459562                    187   5e-55   
ref|XP_002988978.1|  hypothetical protein SELMODRAFT_159820             186   5e-55   
dbj|BAD17091.1|  putative poly(A) binding protein                       186   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003570602.1|  PREDICTED: polyadenylate-binding protein 2-like    186   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_004953974.1|  PREDICTED: polyadenylate-binding protein 2-A...    186   2e-54   Setaria italica
ref|XP_006647930.1|  PREDICTED: polyadenylate-binding protein 2-A...    186   2e-54   Oryza brachyantha
ref|NP_001048174.1|  Os02g0757900                                       185   2e-54   
ref|XP_006394055.1|  hypothetical protein EUTSA_v10004890mg             185   3e-54   
ref|XP_011087906.1|  PREDICTED: polyadenylate-binding protein 2-like    184   4e-54   
gb|EMT14995.1|  Polyadenylate-binding protein 2                         184   5e-54   
ref|NP_001132591.1|  uncharacterized protein LOC100194063               184   6e-54   Zea mays [maize]
gb|AFW64407.1|  hypothetical protein ZEAMMB73_935050                    183   6e-54   
ref|NP_001057163.1|  Os06g0219600                                       183   1e-53   
gb|ACG38228.1|  polyadenylate-binding protein 2                         183   2e-53   Zea mays [maize]
ref|NP_001148500.1|  polyadenylate-binding protein 2                    183   2e-53   Zea mays [maize]
gb|EMS52889.1|  Polyadenylate-binding protein 2                         182   2e-53   Triticum urartu
ref|XP_002273112.1|  PREDICTED: polyadenylate-binding protein 3-l...    182   2e-53   Vitis vinifera
emb|CBI34067.3|  unnamed protein product                                182   2e-53   Vitis vinifera
gb|AFW64403.1|  polyadenylate-binding protein 2                         182   2e-53   
gb|EPS71398.1|  hypothetical protein M569_03365                         183   3e-53   Genlisea aurea
dbj|BAK03017.1|  predicted protein                                      182   6e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006655919.1|  PREDICTED: polyadenylate-binding protein 2-like    181   8e-53   Oryza brachyantha
ref|XP_003564078.1|  PREDICTED: polyadenylate-binding protein 2-like    181   1e-52   Brachypodium distachyon [annual false brome]
ref|XP_002975089.1|  hypothetical protein SELMODRAFT_102545             180   4e-52   
gb|AFK33976.1|  unknown                                                 177   8e-52   
emb|CBI33270.3|  unnamed protein product                                176   9e-52   
ref|XP_008646980.1|  PREDICTED: polyadenylate-binding protein 2-like    175   1e-51   
emb|CDP19849.1|  unnamed protein product                                179   1e-51   
gb|KJB17315.1|  hypothetical protein B456_003G040800                    176   1e-51   
gb|KCW56970.1|  hypothetical protein EUGRSUZ_I02641                     177   4e-51   
gb|KJB07917.1|  hypothetical protein B456_001G052500                    175   5e-51   
ref|XP_010519393.1|  PREDICTED: polyadenylate-binding protein 2-l...    174   6e-51   
tpg|DAA46761.1|  TPA: hypothetical protein ZEAMMB73_590191              177   1e-50   
gb|KHG13063.1|  Polyadenylate-binding 2                                 176   1e-50   
gb|KJB51352.1|  hypothetical protein B456_008G213100                    175   1e-50   
ref|XP_006605318.1|  PREDICTED: uncharacterized protein LOC100527...    172   2e-50   
tpg|DAA46760.1|  TPA: hypothetical protein ZEAMMB73_590191              178   2e-50   
ref|XP_008352594.1|  PREDICTED: polyadenylate-binding protein 2-A...    174   3e-50   
ref|XP_011031059.1|  PREDICTED: polyadenylate-binding protein 3-l...    172   4e-50   
ref|XP_011022818.1|  PREDICTED: polyadenylate-binding protein 3-l...    171   5e-50   
ref|XP_006426355.1|  hypothetical protein CICLE_v100264481mg            171   6e-50   
ref|XP_002464918.1|  hypothetical protein SORBIDRAFT_01g028780          174   8e-50   
ref|XP_009606255.1|  PREDICTED: polyadenylate-binding protein 2-like    171   8e-50   
ref|XP_008234993.1|  PREDICTED: polyadenylate-binding protein 2 i...    171   8e-50   
ref|XP_006426354.1|  hypothetical protein CICLE_v100264481mg            170   9e-50   
ref|XP_008343316.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    172   9e-50   
ref|XP_008812705.1|  PREDICTED: polyadenylate-binding protein 2-like    171   1e-49   
ref|XP_006605317.1|  PREDICTED: uncharacterized protein LOC100527...    170   1e-49   
ref|XP_009350740.1|  PREDICTED: polyadenylate-binding protein 2-like    170   2e-49   
ref|XP_006588409.1|  PREDICTED: uncharacterized protein LOC100527...    170   2e-49   
ref|XP_008453810.1|  PREDICTED: polyadenylate-binding protein 2 i...    170   2e-49   
ref|XP_006580259.1|  PREDICTED: polyadenylate-binding protein 2 i...    169   5e-49   
ref|XP_004504813.1|  PREDICTED: polyadenylate-binding protein 2-A...    171   5e-49   
ref|XP_008353927.1|  PREDICTED: polyadenylate-binding protein 2-l...    171   6e-49   
ref|XP_008381987.1|  PREDICTED: polyadenylate-binding protein 2 i...    170   8e-49   
ref|XP_010491700.1|  PREDICTED: polyadenylate-binding protein 2-l...    171   1e-48   
ref|XP_010491699.1|  PREDICTED: polyadenylate-binding protein 2-l...    171   1e-48   
ref|XP_009344453.1|  PREDICTED: polyadenylate-binding protein 2 i...    169   2e-48   
ref|XP_008804767.1|  PREDICTED: polyadenylate-binding protein 2-l...    167   2e-48   
gb|EPS60140.1|  hypothetical protein M569_14665                         167   2e-48   
gb|EMS59552.1|  Polyadenylate-binding protein 2                         171   2e-48   
gb|KCW56971.1|  hypothetical protein EUGRSUZ_I02641                     169   1e-47   
ref|XP_004986800.1|  PREDICTED: polyadenylate-binding protein 2-like    167   2e-47   
gb|KHN06563.1|  Polyadenylate-binding protein 2                         170   3e-47   
ref|XP_006597028.1|  PREDICTED: uncharacterized protein LOC100791...    164   3e-47   
ref|XP_010312633.1|  PREDICTED: polyadenylate-binding protein 2 i...    165   4e-47   
ref|XP_006353218.1|  PREDICTED: polyadenylate-binding protein 2-A...    164   1e-46   
ref|XP_011097544.1|  PREDICTED: polyadenylate-binding protein 3 i...    163   2e-46   
emb|CDY33952.1|  BnaC02g43850D                                          165   2e-46   
ref|NP_001190273.1|  RNA recognition motif-containing protein           162   3e-46   
ref|XP_010318199.1|  PREDICTED: polyadenylate-binding protein 2-l...    162   4e-46   
gb|KDO50215.1|  hypothetical protein CISIN_1g029268mg                   162   2e-45   
gb|KJB79641.1|  hypothetical protein B456_013G060100                    160   2e-45   
ref|XP_001696457.1|  poly(A) binding protein                            157   2e-44   
ref|XP_008790939.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    158   3e-44   
ref|XP_003059453.1|  predicted protein                                  158   5e-44   
ref|XP_010648171.1|  PREDICTED: polyadenylate-binding protein 2-l...    155   5e-44   
ref|XP_008803090.1|  PREDICTED: polyadenylate-binding protein 2-like    155   1e-43   
gb|EMT22397.1|  Polyadenylate-binding protein 2                         159   4e-43   
ref|XP_005848131.1|  hypothetical protein CHLNCDRAFT_13079              153   1e-42   
ref|XP_002946206.1|  hypothetical protein VOLCADRAFT_72471              156   1e-42   
dbj|BAK03362.1|  predicted protein                                      152   2e-42   
ref|XP_005642733.1|  RNA-binding domain-containing protein              152   1e-41   
ref|XP_010235030.1|  PREDICTED: polyadenylate-binding protein 2-like    149   5e-41   
gb|KDN47980.1|  RNA-binding domain-containing protein                   149   6e-41   
gb|KEH42409.1|  RNA recognition motif                                   152   1e-40   
gb|KEH42410.1|  RNA recognition motif                                   152   1e-40   
ref|XP_006423797.1|  hypothetical protein CICLE_v100293173mg            145   2e-40   
gb|EEC80241.1|  hypothetical protein OsI_22184                          149   3e-40   
ref|XP_010422853.1|  PREDICTED: polyadenylate-binding protein 2-like    145   5e-39   
emb|CDI56456.1|  related to poly(a) binding protein II                  145   6e-39   
gb|ETS60884.1|  hypothetical protein PaG_04803                          145   7e-39   
ref|XP_007877442.1|  hypothetical protein PFL1_01741                    145   9e-39   
emb|CBQ71145.1|  related to poly(a) binding protein II                  144   3e-38   
ref|XP_011388696.1|  hypothetical protein UMAG_02401                    143   3e-38   
emb|CCF54292.1|  related to poly(a) binding protein II                  143   4e-38   
ref|XP_010491701.1|  PREDICTED: polyadenylate-binding protein 2-l...    141   4e-38   
gb|EST05917.1|  hypothetical protein PSEUBRA_SCAF4g05044                143   4e-38   
gb|KIY97319.1|  Polyadenylate-binding protein 2                         143   5e-38   
dbj|GAK64008.1|  RNP domain protein                                     144   1e-37   
gb|KID97040.1|  Nucleotide-binding, alpha-beta plait                    141   2e-37   
ref|XP_001732185.1|  hypothetical protein MGL_0778                      141   3e-37   
gb|KEH41350.1|  RNA recognition motif                                   139   4e-37   
ref|XP_001264816.1|  RNP domain protein                                 140   5e-37   
gb|EYE92492.1|  RNA-binding domain-containing protein                   140   5e-37   
ref|XP_002500865.1|  predicted protein                                  140   6e-37   
ref|XP_007816217.1|  RNA recognition motif domain protein               140   7e-37   
ref|XP_001269310.1|  RNP domain protein                                 139   7e-37   
gb|KID72233.1|  Nucleotide-binding, alpha-beta plait                    140   7e-37   
ref|XP_007814073.1|  putative rrm-type rna binding protein              140   7e-37   
gb|EHK41278.1|  hypothetical protein TRIATDRAFT_169914                  139   7e-37   
ref|XP_006963218.1|  predicted protein                                  139   7e-37   
gb|KIN06582.1|  hypothetical protein OIDMADRAFT_17387                   139   8e-37   
gb|KFY15058.1|  hypothetical protein V492_02252                         139   9e-37   
gb|EHK16606.1|  hypothetical protein TRIVIDRAFT_19040                   139   9e-37   
gb|KFY71846.1|  hypothetical protein V499_07986                         139   1e-36   
ref|XP_658944.1|  hypothetical protein AN1340.2                         139   1e-36   
gb|KDB12677.1|  putative rrm-type rna binding protein                   139   1e-36   
gb|EPS32063.1|  hypothetical protein PDE_07022                          139   1e-36   
gb|ETS05648.1|  RNA-binding domain-containing protein                   139   1e-36   
ref|XP_003050726.1|  hypothetical protein NECHADRAFT_40692              138   1e-36   
ref|XP_752316.1|  RNP domain protein                                    139   1e-36   
gb|EWG40618.1|  hypothetical protein FVEG_02944                         138   1e-36   
gb|KHN96368.1|  Nucleotide-binding, alpha-beta plait                    139   2e-36   
gb|EGU12501.1|  Polyadenylate-binding protein 2                         140   2e-36   
gb|EMS25054.1|  polyadenylate-binding protein 2                         140   2e-36   
gb|EWY90483.1|  hypothetical protein FOYG_07986                         137   2e-36   
gb|KFY23862.1|  hypothetical protein V493_05584                         138   2e-36   
gb|KFY82085.1|  hypothetical protein V500_10835                         138   2e-36   
dbj|GAA87517.1|  RNP domain protein                                     138   2e-36   
gb|ELR06322.1|  hypothetical protein GMDG_07913                         139   2e-36   
ref|XP_002341352.1|  RNP domain protein                                 138   3e-36   
ref|XP_001727864.1|  polyadenylate-binding protein 2                    138   3e-36   
gb|KFA62833.1|  hypothetical protein S40285_03795                       138   3e-36   
gb|KEY69986.1|  hypothetical protein S7711_04004                        138   3e-36   
ref|XP_011114836.1|  hypothetical protein H072_9232                     138   3e-36   
gb|EQL03995.1|  Nucleotide-binding, alpha-beta plait                    138   3e-36   
gb|KFH40681.1|  Polyadenylate-binding protein-like protein              138   3e-36   
gb|EXL56557.1|  hypothetical protein FOCG_04128                         137   3e-36   
gb|KFY49971.1|  hypothetical protein V496_09680                         139   3e-36   
ref|XP_011126610.1|  hypothetical protein AOL_s00188g59                 138   3e-36   
ref|XP_002144201.1|  RNP domain protein                                 137   4e-36   
emb|CEJ88515.1|  Putative Polyadenylate-binding protein 2               140   4e-36   
ref|XP_001392222.1|  polyadenylate-binding protein 2                    137   4e-36   
gb|EHA17785.1|  hypothetical protein ASPNIDRAFT_55885                   137   5e-36   
ref|NP_595794.1|  poly(A) binding protein Pab2                          136   6e-36   
ref|XP_003715472.1|  polyadenylate-binding protein 2                    137   6e-36   
gb|EQB57479.1|  RNA recognition domain-containing protein               137   6e-36   
ref|XP_002560647.1|  Pc16g02770                                         137   7e-36   
gb|EWG40616.1|  hypothetical protein FVEG_02944                         137   7e-36   
gb|EKV12642.1|  hypothetical protein PDIG_42430                         137   7e-36   
ref|XP_007914907.1|  putative polyadenylate-binding protein 2 pro...    137   7e-36   
ref|XP_004348410.1|  RNP domain-containing protein                      138   8e-36   
emb|CDM30120.1|  Nucleotide-binding, alpha-beta plait                   137   8e-36   
emb|CCT68449.1|  probable RRM-type RNA binding protein                  137   8e-36   
gb|EGU87076.1|  hypothetical protein FOXB_02470                         137   8e-36   
gb|KGO68009.1|  Nucleotide-binding, alpha-beta plait                    137   9e-36   
ref|XP_007275489.1|  rnp domain protein                                 137   9e-36   
gb|KIY94017.1|  Polyadenylate-binding protein 2                         138   9e-36   
ref|XP_007595402.1|  RNA recognition domain-containing protein          137   9e-36   
gb|KIL96308.1|  hypothetical protein FAVG1_01052                        137   1e-35   
gb|KIV88706.1|  hypothetical protein PV10_08364                         137   1e-35   
gb|EXL56554.1|  hypothetical protein FOCG_04128                         137   1e-35   
gb|ELQ32355.1|  polyadenylate-binding protein 2                         137   1e-35   
gb|EYB28785.1|  hypothetical protein FG05_10271                         137   1e-35   
ref|XP_009254994.1|  hypothetical protein FPSE_03600                    137   1e-35   
ref|XP_001554468.1|  hypothetical protein BC1G_07056                    136   1e-35   
emb|CEF98397.1|  Nucleotide-binding, alpha-beta plait                   137   1e-35   
gb|EPX74418.1|  poly(A) binding protein Pab2                            135   1e-35   
ref|XP_011319224.1|  polyadenylate-binding protein 2                    137   1e-35   
gb|KGO35980.1|  Nucleotide-binding, alpha-beta plait                    136   1e-35   
ref|XP_002627705.1|  RNP domain-containing protein                      136   2e-35   
ref|XP_007295841.1|  polyadenylate-binding protein 2                    136   2e-35   
ref|XP_002794591.1|  hypothetical protein PAAG_03136                    135   2e-35   
emb|CCF35443.1|  RNA recognition domain-containing protein              136   2e-35   
gb|AFR93468.1|  polyadenylate-binding protein 2                         136   2e-35   
gb|EFQ35020.1|  RNA recognition domain-containing protein               136   2e-35   
gb|KDN61321.1|  putative RNA recognition domain-containing protein      136   2e-35   
gb|EPE10045.1|  polyadenylate-binding protein 2                         136   2e-35   
gb|EER45291.1|  RNP domain-containing protein                           135   2e-35   
gb|EGD94005.1|  hypothetical protein TESG_01534                         135   2e-35   
gb|EFW99173.1|  rnp domain containing protein                           135   2e-35   
ref|XP_569037.1|  poly(A) binding protein                               136   2e-35   
gb|ESZ97421.1|  RNP domain-containing protein                           135   3e-35   
ref|XP_007003991.1|  hypothetical protein TREMEDRAFT_43661              135   3e-35   
emb|CCE29353.1|  probable RRM-type RNA binding protein                  135   3e-35   
ref|XP_007839899.1|  hypothetical protein PFICI_13127                   135   3e-35   
ref|XP_001418487.1|  predicted protein                                  134   3e-35   
ref|XP_007798515.1|  putative polyadenylate-binding protein 2 pro...    135   4e-35   
gb|ENH81968.1|  polyadenylate-binding protein 2                         135   4e-35   
gb|ERT01824.1|  hypothetical protein HMPREF1624_00118                   135   4e-35   
gb|KEZ45213.1|  hypothetical protein SAPIO_CDS2677                      135   4e-35   
gb|KIV99297.1|  hypothetical protein PV09_09064                         135   4e-35   
ref|XP_002842152.1|  hypothetical protein                               135   5e-35   
gb|ERZ96470.1|  hypothetical protein GLOINDRAFT_340629                  135   5e-35   
gb|EXX59092.1|  Sgn1p                                                   135   5e-35   
ref|XP_003344835.1|  hypothetical protein SMAC_06118                    135   5e-35   
ref|XP_011394887.1|  polyadenylate-binding protein 2                    135   6e-35   
gb|EGZ67999.1|  RNA-binding domain-containing protein                   135   6e-35   
gb|KGB79661.1|  poly(A) binding protein                                 135   6e-35   
gb|EPY54217.1|  poly(A) binding protein Pab2                            134   7e-35   
ref|XP_002585092.1|  polyadenylate-binding protein 2                    134   7e-35   
ref|XP_009854497.1|  hypothetical protein NEUTE1DRAFT_69316             135   7e-35   
gb|KHE86315.1|  RNA-binding domain-containing protein                   135   7e-35   
ref|XP_003070263.1|  RNA recognition motif containing protein           134   8e-35   
gb|KIR85470.1|  polyadenylate-binding protein 2                         135   8e-35   
ref|XP_001243223.1|  hypothetical protein CIMG_07119                    134   8e-35   
gb|KIR46635.1|  polyadenylate-binding protein 2                         135   8e-35   
ref|XP_003191185.1|  poly(A) binding protein                            135   8e-35   
gb|KIR79983.1|  polyadenylate-binding protein 2                         135   9e-35   
gb|KIR54186.1|  polyadenylate-binding protein 2                         135   9e-35   
ref|XP_006681215.1|  hypothetical protein BATDEDRAFT_91010              134   1e-34   
ref|XP_003664507.1|  hypothetical protein MYCTH_2307416                 134   1e-34   
gb|KID85880.1|  Nucleotide-binding, alpha-beta plait                    134   1e-34   
gb|EEH41573.2|  hypothetical protein PAAG_03136                         135   1e-34   
ref|XP_007581018.1|  putative rnp domain protein                        133   1e-34   
ref|XP_004345901.1|  RNA recognition motif domain containing protein    133   2e-34   
emb|CCG84821.1|  protein of unknown function                            133   2e-34   
gb|EMR89231.1|  putative polyadenylate-binding protein 2 protein        136   2e-34   
gb|EKG21444.1|  hypothetical protein MPH_01242                          133   3e-34   
ref|XP_007337763.1|  RNA-binding domain-containing protein              132   4e-34   
gb|KDE03727.1|  hypothetical protein MVLG_05797                         133   4e-34   
ref|XP_504024.2|  YALI0E16500p                                          132   5e-34   
dbj|GAM82894.1|  hypothetical protein ANO11243_008800                   132   5e-34   
gb|KFZ16430.1|  hypothetical protein V502_05098                         134   5e-34   
ref|XP_006694990.1|  putative poly(A) binding protein                   132   5e-34   
ref|XP_007925064.1|  hypothetical protein MYCFIDRAFT_122613             132   6e-34   
ref|XP_007778127.1|  hypothetical protein W97_02035                     132   6e-34   
ref|XP_003650887.1|  hypothetical protein THITE_2110808                 132   7e-34   
ref|XP_008368046.1|  PREDICTED: uncharacterized protein LOC103431649    131   8e-34   
ref|XP_008595140.1|  RNA recognition domain-containing protein          131   8e-34   
ref|XP_001226583.1|  hypothetical protein CHGG_08656                    133   9e-34   
ref|XP_009216294.1|  polyadenylate-binding protein 2                    132   9e-34   
emb|CCX34955.1|  Similar to Polyadenylate-binding protein 2; acc....    132   1e-33   
gb|KFY66793.1|  hypothetical protein V497_00695                         139   1e-33   
ref|XP_008034922.1|  polyadenylate-binding protein 2                    131   1e-33   
ref|XP_006666314.1|  RNP domain-containing protein                      131   1e-33   
gb|KFZ01785.1|  hypothetical protein V501_09799                         140   1e-33   
ref|XP_007364279.1|  RNA-binding domain-containing protein              130   2e-33   
ref|XP_003848243.1|  hypothetical protein MYCGRDRAFT_77177              131   2e-33   
ref|XP_003008784.1|  polyadenylate-binding protein                      131   2e-33   
ref|XP_009649746.1|  polyadenylate-binding protein                      130   2e-33   
gb|KHJ35028.1|  putative rnp domain-containing protein                  130   3e-33   
gb|KGQ04114.1|  Polyadenylate-binding protein 2                         132   4e-33   
emb|CDH52264.1|  polyadenylate-binding protein 2                        130   4e-33   



>ref|XP_009631161.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana tomentosiformis]
 ref|XP_009764085.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=224

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/125 (93%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP A SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGSAQDPTA-SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  132

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVEVE +QNALLLNESELHGRQLKVSAKRTNVPG+KQFRGRRFNPYAG
Sbjct  133  KFGQPKGYAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNVPGLKQFRGRRFNPYAG  192

Query  381  FRSRR  367
            FR RR
Sbjct  193  FRPRR  197



>ref|XP_004235203.1| PREDICTED: polyadenylate-binding protein 2 [Solanum lycopersicum]
Length=224

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP A SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGSAQDPTA-SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  132

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVEVE +QNALLLNESELHGR+LKVSAKRTNVPGMKQFRGRRFNPYAG
Sbjct  133  KFGQPKGYAYVEFVEVEAVQNALLLNESELHGRRLKVSAKRTNVPGMKQFRGRRFNPYAG  192

Query  381  FRSRR  367
            +R RR
Sbjct  193  YRPRR  197



>ref|XP_006358184.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum tuberosum]
Length=224

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP A SASQAEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGSAQDPTA-SASQAEKEEVDGRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  132

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE+E +QNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG
Sbjct  133  KFGQPKGYAYVEFVEMEAVQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  192

Query  381  FRSRR  367
            +R RR
Sbjct  193  YRPRR  197



>gb|KDP22495.1| hypothetical protein JCGZ_26326 [Jatropha curcas]
Length=223

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGAVQDSSSASATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  130  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYFG  189

Query  381  FRSRR  367
            FRSRR
Sbjct  190  FRSRR  194



>ref|XP_002511041.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF51643.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=231

 Score =   233 bits (595),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  80   EKEMGAVQDSSSGSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  139

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY+G
Sbjct  140  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYSG  199

Query  381  FRSRR  367
            FRSRR
Sbjct  200  FRSRR  204



>ref|XP_010933557.1| PREDICTED: polyadenylate-binding protein 2-like [Elaeis guineensis]
Length=222

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++A+A+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDSSSAAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVEV+ +QNALLLNESELHGRQLKV AKRTN+PGMKQ+RGRR NPY  
Sbjct  129  KFGQPKGYAYVEFVEVDAVQNALLLNESELHGRQLKVCAKRTNIPGMKQYRGRRPNPYTA  188

Query  381  FRSRR  367
            FRSRR
Sbjct  189  FRSRR  193



>ref|XP_010269828.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=231

 Score =   231 bits (589),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP++A+A+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGIVQDPSSAAATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE + +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  138  KFGQPKGFAYVEFVETDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYLG  197

Query  381  FRSRR  367
            FR RR
Sbjct  198  FRGRR  202



>emb|CDP01496.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ASQA KEEVD+RSI+VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAASQANKEEVDSRSIFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV AKRTNVPGMKQ+RGRRFNPY G
Sbjct  128  KFGQPKGFAYVEFVEQEAVQEALLLNESELHGRQLKVMAKRTNVPGMKQYRGRRFNPYLG  187

Query  381  FRSRR  367
            +RSRR
Sbjct  188  YRSRR  192



>ref|XP_010274505.1| PREDICTED: polyadenylate-binding protein 2 [Nelumbo nucifera]
Length=231

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP++A+A QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  77   EKEMGAVQDPSSAAAIQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEFVE + +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  137  KYGQPKGFAYVEFVETDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYLG  196

Query  381  FRSRR  367
            FR RR
Sbjct  197  FRGRR  201



>ref|XP_004307764.1| PREDICTED: polyadenylate-binding protein 1 [Fragaria vesca subsp. 
vesca]
Length=219

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDPN  SASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPNGGSASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNAL+LNESELHGRQLKVSAKRTNVPG+KQ+RGRR NP+  
Sbjct  128  KFGQPKGFAYVEFVEVDAVQNALILNESELHGRQLKVSAKRTNVPGLKQYRGRRPNPF--  185

Query  381  FRSRR  367
            FRSRR
Sbjct  186  FRSRR  190



>ref|XP_009363742.1| PREDICTED: polyadenylate-binding protein 2 [Pyrus x bretschneideri]
Length=221

 Score =   229 bits (583),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP++ SASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGAVQDPSSGSASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTNVPG+KQ+RGRR NP+  
Sbjct  130  KFGQPKGFAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNVPGLKQYRGRRPNPF--  187

Query  381  FRSRR  367
            FRSRR
Sbjct  188  FRSRR  192



>ref|XP_011003544.1| PREDICTED: polyadenylate-binding protein 1-like [Populus euphratica]
Length=226

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ IQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR +PY G
Sbjct  135  KFGQPKGFAYVEFVEVDAIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRPSPY-G  193

Query  381  FRSRR  367
            FRSRR
Sbjct  194  FRSRR  198



>ref|XP_007038220.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY22721.1| RNA-binding family protein [Theobroma cacao]
Length=230

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKEMGAVQDSSSASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY  
Sbjct  139  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPY--  196

Query  381  FRSRR  367
            FRSRR
Sbjct  197  FRSRR  201



>emb|CAN77560.1| hypothetical protein VITISV_031100 [Vitis vinifera]
Length=175

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  23   EKEMGAVQDSSSASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  82

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NP+ G
Sbjct  83   KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPF-G  141

Query  381  FRSRR  367
            FR RR
Sbjct  142  FRGRR  146



>gb|ACN41220.1| unknown [Picea sitchensis]
Length=201

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP A++ASQA KEE D RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  50   EKEMGAVQDPAASAASQATKEEADTRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  109

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFN-PYA  385
            KFGQPKGYAYVEF+E E +QNA+LLNESELHGRQLKV+AKRTNVPGMKQFRGRRF+ PY 
Sbjct  110  KFGQPKGYAYVEFLEAEAVQNAILLNESELHGRQLKVTAKRTNVPGMKQFRGRRFSAPYM  169

Query  384  GFRSRR  367
            G+R  R
Sbjct  170  GYRPWR  175



>gb|ABK21856.1| unknown [Picea sitchensis]
Length=215

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP A++ASQA KEE D RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  64   EKEMGAVQDPAASAASQATKEEADTRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFN-PYA  385
            KFGQPKGYAYVEF+E E +QNA+LLNESELHGRQLKV+AKRTNVPGMKQFRGRRF+ PY 
Sbjct  124  KFGQPKGYAYVEFLEAEAVQNAILLNESELHGRQLKVTAKRTNVPGMKQFRGRRFSAPYM  183

Query  384  GFRSRR  367
            G+R  R
Sbjct  184  GYRPWR  189



>ref|XP_002279148.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
Length=226

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGAVQDSSSASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  133

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NP+ G
Sbjct  134  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPF-G  192

Query  381  FRSRR  367
            FR RR
Sbjct  193  FRGRR  197



>ref|XP_006376950.1| hypothetical protein POPTR_0012s11480g [Populus trichocarpa]
 gb|ERP54747.1| hypothetical protein POPTR_0012s11480g [Populus trichocarpa]
Length=226

 Score =   226 bits (575),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ IQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR +PY G
Sbjct  135  KFGQPKGFAYVEFVEVDAIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRPSPY-G  193

Query  381  FRSRR  367
             RSRR
Sbjct  194  LRSRR  198



>gb|KJB19595.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=216

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NP+  
Sbjct  139  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPF--  196

Query  381  FRSRR  367
            FRSRR
Sbjct  197  FRSRR  201



>gb|KJB07918.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
Length=214

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD + ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  77   EKEMGAVQDSSGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTNVPGMKQ+RGRR NPY  
Sbjct  137  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNVPGMKQYRGRRPNPY--  194

Query  381  FRSRR  367
            FRSRR
Sbjct  195  FRSRR  199



>ref|XP_010062822.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW90904.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=229

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V D ++ SA+ AEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  81   EKEMGAVPDSSSTSATMAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  140

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  141  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPY-G  199

Query  381  FRSRR  367
            FRSRR
Sbjct  200  FRSRR  204



>gb|KCW90905.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=232

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V D ++ SA+ AEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  81   EKEMGAVPDSSSTSATMAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  140

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  141  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPY-G  199

Query  381  FRSRR  367
            FRSRR
Sbjct  200  FRSRR  204



>ref|XP_010062812.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90906.1| hypothetical protein EUGRSUZ_A02940 [Eucalyptus grandis]
Length=233

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V D ++ SA+ AEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  81   EKEMGAVPDSSSTSATMAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  140

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  141  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPY-G  199

Query  381  FRSRR  367
            FRSRR
Sbjct  200  FRSRR  204



>ref|XP_008234027.1| PREDICTED: polyadenylate-binding protein 2 [Prunus mume]
Length=219

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDSSSGSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+  
Sbjct  128  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF--  185

Query  381  FRSRR  367
            FRSRR
Sbjct  186  FRSRR  190



>ref|XP_008364853.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=221

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGAVQDTSXGSASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTNVPG+KQ+RGRR NP+  
Sbjct  130  KFGQPKGFAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNVPGLKQYRGRRPNPF--  187

Query  381  FRSRR  367
            FRSRR
Sbjct  188  FRSRR  192



>ref|XP_007218817.1| hypothetical protein PRUPE_ppa010052mg [Prunus persica]
 gb|EMJ20016.1| hypothetical protein PRUPE_ppa010052mg [Prunus persica]
Length=266

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  115  EKEMGAVQDSSSGSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  174

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+  
Sbjct  175  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF--  232

Query  381  FRSRR  367
            FRSRR
Sbjct  233  FRSRR  237



>ref|XP_011040326.1| PREDICTED: polyadenylate-binding protein 1 isoform X1 [Populus 
euphratica]
Length=226

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR +PY G
Sbjct  135  KFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPY-G  193

Query  381  FRSRR  367
            FRSRR
Sbjct  194  FRSRR  198



>ref|XP_011040327.1| PREDICTED: polyadenylate-binding protein 1 isoform X2 [Populus 
euphratica]
Length=225

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR +PY G
Sbjct  135  KFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPY-G  193

Query  381  FRSRR  367
            FRSRR
Sbjct  194  FRSRR  198



>ref|XP_011076455.1| PREDICTED: polyadenylate-binding protein 1 isoform X1 [Sesamum 
indicum]
Length=221

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/122 (87%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QD   ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGATQDSTGASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G
Sbjct  130  KYGQPKGFAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYFG  189

Query  381  FR  376
             R
Sbjct  190  TR  191



>gb|KJB19594.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=230

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NP+  
Sbjct  139  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPF--  196

Query  381  FRSRR  367
            FRSRR
Sbjct  197  FRSRR  201



>gb|KJB07914.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
 gb|KJB07915.1| hypothetical protein B456_001G052500 [Gossypium raimondii]
Length=228

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD + ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  77   EKEMGAVQDSSGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTNVPGMKQ+RGRR NPY  
Sbjct  137  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNVPGMKQYRGRRPNPY--  194

Query  381  FRSRR  367
            FRSRR
Sbjct  195  FRSRR  199



>ref|XP_010937392.1| PREDICTED: polyadenylate-binding protein 2 isoform X3 [Elaeis 
guineensis]
Length=221

 Score =   223 bits (569),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTN+PGMKQ+R RRFNPY+G
Sbjct  128  KFGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVCAKRTNIPGMKQYRPRRFNPYSG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_010937393.1| PREDICTED: polyadenylate-binding protein 2 isoform X4 [Elaeis 
guineensis]
Length=219

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  66   EKEMGAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  125

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTN+PGMKQ+R RRFNPY+G
Sbjct  126  KFGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVCAKRTNIPGMKQYRPRRFNPYSG  185

Query  381  FRSRR  367
            +R RR
Sbjct  186  YRFRR  190



>ref|XP_008453840.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cucumis 
melo]
Length=229

 Score =   223 bits (568),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+ G
Sbjct  138  KFGHPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF-G  196

Query  381  FRSRR  367
            FR RR
Sbjct  197  FRGRR  201



>gb|KHG12327.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=228

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  77   EKEMGAVQDSSGTSATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTNVPGMKQ+RGRR NPY  
Sbjct  137  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNVPGMKQYRGRRPNPY--  194

Query  381  FRSRR  367
            FRSRR
Sbjct  195  FRSRR  199



>ref|XP_008777640.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=221

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTN+PGMKQ+R RRFNPY+G
Sbjct  128  KFGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVCAKRTNLPGMKQYRPRRFNPYSG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_004146890.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2-like [Cucumis sativus]
Length=237

 Score =   223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  86   EKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  145

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+ G
Sbjct  146  KFGHPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF-G  204

Query  381  FRSRR  367
            FR RR
Sbjct  205  FRGRR  209



>ref|XP_004166616.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN53187.1| hypothetical protein Csa_4G025170 [Cucumis sativus]
Length=229

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+ G
Sbjct  138  KFGHPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF-G  196

Query  381  FRSRR  367
            FR RR
Sbjct  197  FRGRR  201



>ref|XP_002511038.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF51640.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=234

 Score =   223 bits (567),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = -2

Query  711  NAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAY  532
            ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG+AY
Sbjct  106  SSGSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAY  165

Query  531  VEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            VEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY+GFRSRR
Sbjct  166  VEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYSGFRSRR  220



>ref|XP_006437033.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|ESR50273.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|KDO57709.1| hypothetical protein CISIN_1g027515mg [Citrus sinensis]
Length=222

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  85   EKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  144

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTN+PGMKQFRGRR N + G
Sbjct  145  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTF-G  203

Query  381  FRSRR  367
            FR RR
Sbjct  204  FRGRR  208



>ref|XP_006374587.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|ERP52384.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=226

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQDSPGASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  134

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR +PY G
Sbjct  135  KFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPY-G  193

Query  381  FRSRR  367
            FRS+R
Sbjct  194  FRSQR  198



>ref|XP_008786202.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=222

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD + A+A+Q EKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDSSGAAATQVEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVEV+ +QNALLLNESELHGRQLKV AKRTNVPGMKQ+RGRR NPY  
Sbjct  129  KFGQPKGYAYVEFVEVDAVQNALLLNESELHGRQLKVCAKRTNVPGMKQYRGRRPNPYTA  188

Query  381  F  379
            F
Sbjct  189  F  189



>ref|XP_006828070.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda]
 gb|ERM95486.1| hypothetical protein AMTR_s00008p00267630 [Amborella trichopoda]
Length=220

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP + +A+QA +EE D RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  67   EKEMGAVQDPASVAAAQASREEADNRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE+E +QNALLLNESELHGRQLKV AKRTNVPGMKQFR RRFNPY  
Sbjct  127  KFGQPKGFAYVEFVELEAVQNALLLNESELHGRQLKVLAKRTNVPGMKQFRPRRFNPYLA  186

Query  381  FRSRR  367
            +RSRR
Sbjct  187  YRSRR  191



>ref|NP_001275811.1| poly(A)-binding protein 1 [Citrus sinensis]
 gb|AEN74948.1| poly(A)-binding protein 1 [Citrus sinensis]
Length=234

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  83   EKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  142

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTN+PGMKQFRGRR N + G
Sbjct  143  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTF-G  201

Query  381  FRSRR  367
            FR RR
Sbjct  202  FRGRR  206



>ref|XP_009362727.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=222

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  71   EKEMGAVQDSSSGSASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  130

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTNVPG+KQ+RGRR +P++ 
Sbjct  131  KFGQPKGFAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNVPGLKQYRGRRPSPFS-  189

Query  381  FRSRR  367
             RSRR
Sbjct  190  -RSRR  193



>ref|XP_007205858.1| hypothetical protein PRUPE_ppa011157mg [Prunus persica]
 ref|XP_008234985.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Prunus 
mume]
 gb|EMJ07057.1| hypothetical protein PRUPE_ppa011157mg [Prunus persica]
Length=221

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP A +ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAAVAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFLETEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_008353926.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Malus 
domestica]
Length=219

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFVETESVQEALXLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_003635560.2| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
Length=221

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ +QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAVTQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTNVPGMKQFR RRFNPY G
Sbjct  128  KYGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVLAKRTNVPGMKQFRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_002531675.1| poly-A binding protein, putative [Ricinus communis]
 gb|EEF30719.1| poly-A binding protein, putative [Ricinus communis]
Length=218

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDPASAAANQANKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE IQ ALLLNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  125  KFGQPKGFAYVEFLEVEAIQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  184

Query  381  FRSRR  367
            +R RR
Sbjct  185  YRFRR  189



>ref|XP_006485035.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Citrus 
sinensis]
Length=234

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  85   EKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  144

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTN+PGMKQFRGRR N + G
Sbjct  145  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTF-G  203

Query  381  FRSRR  367
            FR RR
Sbjct  204  FRGRR  208



>ref|XP_008353925.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Malus 
domestica]
Length=221

 Score =   221 bits (562),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFVETESVQEALXLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|KHN30707.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=214

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDSSGTSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  125  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  181

Query  381  FRSRR  367
            FRSRR
Sbjct  182  FRSRR  186



>ref|XP_010917314.1| PREDICTED: polyadenylate-binding protein 2-like [Elaeis guineensis]
Length=223

 Score =   220 bits (561),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL LNESELHGRQ+KVS KRTNVPGMKQFR RRFNPY G
Sbjct  130  KFGQPKGFAYVEFLETEAVQEALQLNESELHGRQIKVSPKRTNVPGMKQFRPRRFNPYTG  189

Query  381  FRSR  370
            +R R
Sbjct  190  YRFR  193



>ref|XP_010523297.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=199

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP + +A+QA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  46   EKEMGAVQDPASMAANQASKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  105

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  106  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  165

Query  381  FRSRR  367
            +R RR
Sbjct  166  YRVRR  170



>ref|XP_006437034.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
 gb|ESR50274.1| hypothetical protein CICLE_v10032621mg [Citrus clementina]
Length=236

 Score =   221 bits (562),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  85   EKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  144

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTN+PGMKQFRGRR N + G
Sbjct  145  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPGMKQFRGRRPNTF-G  203

Query  381  FRSRR  367
            FR RR
Sbjct  204  FRGRR  208



>gb|KJB17316.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=176

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  23   EKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  82

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  83   KYGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVMPKRTNVPGMKQYRPRRFNPYMG  142

Query  381  FRSRR  367
            +RSRR
Sbjct  143  YRSRR  147



>ref|XP_010267253.1| PREDICTED: polyadenylate-binding protein 2 [Nelumbo nucifera]
Length=221

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA +EE D+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAATQASREEADSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEFVE+E +Q ALLLNESELHGRQLKV AKRTN+PGMKQFR RRFNPY G
Sbjct  128  KFGHPKGFAYVEFVEIEAVQEALLLNESELHGRQLKVLAKRTNIPGMKQFRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_007144150.1| hypothetical protein PHAVU_007G133000g [Phaseolus vulgaris]
 gb|ESW16144.1| hypothetical protein PHAVU_007G133000g [Phaseolus vulgaris]
Length=214

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDSSGPSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+ GRR  P  G
Sbjct  125  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYYGRR--P-TG  181

Query  381  FRSRR  367
            FRSRR
Sbjct  182  FRSRR  186



>ref|XP_009344452.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFVETESVQEALGLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|KJB17317.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=206

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KYGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVMPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +RSRR
Sbjct  188  YRSRR  192



>ref|XP_009344451.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=221

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAIAAASQANKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFVETESVQEALGLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_008381986.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Malus 
domestica]
Length=220

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQA +EEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAIAAASQANREEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KFGQPKGFAYVEFVETEAVQEALGLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|KJB17319.1| hypothetical protein B456_003G040800 [Gossypium raimondii]
Length=221

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KYGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVMPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +RSRR
Sbjct  188  YRSRR  192



>gb|KHG00394.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=221

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAGATANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  128  KYGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVMPKRTNVPGMKQYRPRRFNPYMG  187

Query  381  FRSRR  367
            +RSRR
Sbjct  188  YRSRR  192



>ref|XP_003608452.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES90649.1| polyadenylate-binding protein II [Medicago truncatula]
Length=199

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  ASASQ  +EEVDARSI+VGNVDYACTPE+VQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPANASASQINREEVDARSIFVGNVDYACTPEDVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEFVEVE +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY 
Sbjct  103  KFGQPKGYAYVEFVEVEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYM  162

Query  384  GFRSR  370
            GFR R
Sbjct  163  GFRGR  167



>ref|XP_004495250.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=216

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD + +SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDSSGSSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNAL+LNE+ELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  129  KFGQPKGFAYVEFVEVDAVQNALILNETELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  185

Query  381  FRSRR  367
            FR+RR
Sbjct  186  FRARR  190



>ref|XP_008453839.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=230

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 2/126 (2%)
 Frame = -2

Query  741  EKEMTGVQ-DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQ D ++ SA+QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILT
Sbjct  78   EKEMGAVQEDSSSTSATQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  137

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DKFG PKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NP+ 
Sbjct  138  DKFGHPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPF-  196

Query  384  GFRSRR  367
            GFR RR
Sbjct  197  GFRGRR  202



>ref|XP_004495249.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
Length=218

 Score =   218 bits (555),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 115/125 (92%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD + +SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDSSGSSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNAL+LNE+ELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  129  KFGQPKGFAYVEFVEVDAVQNALILNETELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  185

Query  381  FRSRR  367
            FR+RR
Sbjct  186  FRARR  190



>gb|KJB51353.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=213

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGR  NPY  
Sbjct  138  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRPSNPY--  195

Query  381  FRSRR  367
            FRSRR
Sbjct  196  FRSRR  200



>ref|XP_004137160.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=196

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  43   EKEMSSVQDPASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+ G
Sbjct  103  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPFMG  162

Query  381  FRSR  370
             RSR
Sbjct  163  ARSR  166



>gb|ACU17272.1| unknown [Glycine max]
Length=183

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 111/122 (91%), Gaps = 3/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDSSGTSATQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  125  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  181

Query  381  FR  376
            FR
Sbjct  182  FR  183



>ref|XP_008462875.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cucumis 
melo]
Length=197

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  44   EKEMSSVQDPASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  103

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+ G
Sbjct  104  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPFMG  163

Query  381  FRSR  370
             RSR
Sbjct  164  ARSR  167



>gb|KGN53719.1| hypothetical protein Csa_4G110060 [Cucumis sativus]
Length=197

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  44   EKEMSSVQDPASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  103

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+ G
Sbjct  104  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPFMG  163

Query  381  FRSR  370
             RSR
Sbjct  164  ARSR  167



>gb|KJB51351.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=217

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGR  NPY  
Sbjct  138  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRPSNPY--  195

Query  381  FRSRR  367
            FRSRR
Sbjct  196  FRSRR  200



>ref|XP_009404041.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=214

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  61   EKEMGAAQDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  120

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E+E +Q+AL LNESELHGRQ+KV+AKRTNVPGMKQF  RRFNPY G
Sbjct  121  KFGQPKGFAYVEFLELEAVQDALQLNESELHGRQIKVAAKRTNVPGMKQFHPRRFNPYMG  180

Query  381  FRSRR  367
            +  RR
Sbjct  181  YPYRR  185



>ref|XP_009404040.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 112/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  63   EKEMGAAQDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  122

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E+E +Q+AL LNESELHGRQ+KV+AKRTNVPGMKQF  RRFNPY G
Sbjct  123  KFGQPKGFAYVEFLELEAVQDALQLNESELHGRQIKVAAKRTNVPGMKQFHPRRFNPYMG  182

Query  381  FRSRR  367
            +  RR
Sbjct  183  YPYRR  187



>ref|XP_010094140.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB55273.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=197

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQ+P+ A+ +QA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQEPSTAAGTQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVEVE +Q A+LLNESELHGRQLKVSAKRTN+PGMKQ+R RR NPY G
Sbjct  103  KFGQPKGYAYVEFVEVEAVQEAILLNESELHGRQLKVSAKRTNIPGMKQYRPRRPNPYMG  162

Query  381  FRSR  370
            FR R
Sbjct  163  FRGR  166



>ref|XP_002306300.1| hypothetical protein POPTR_0005s07440g [Populus trichocarpa]
 gb|EEE93296.1| hypothetical protein POPTR_0005s07440g [Populus trichocarpa]
Length=218

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDPATAAANQANREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+R RR NPY G
Sbjct  125  KFGQPKGFAYVEFLEVEAVQEALALNESELHGRQLKVSPKRTNVPGMKQYRPRRINPYMG  184

Query  381  FRSRR  367
            +R RR
Sbjct  185  YRFRR  189



>ref|XP_011031058.1| PREDICTED: polyadenylate-binding protein 3-like isoform X1 [Populus 
euphratica]
Length=218

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDPATAAANQANREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+R RR NPY G
Sbjct  125  KFGQPKGFAYVEFLEVEAVQEALALNESELHGRQLKVSPKRTNVPGMKQYRPRRINPYMG  184

Query  381  FRSRR  367
            +R RR
Sbjct  185  YRFRR  189



>gb|AFK38116.1| unknown [Medicago truncatula]
Length=199

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  +QDP  ASASQ  +EEVDARSI+VGNVDYACTPE+VQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSIQDPANASASQINREEVDARSIFVGNVDYACTPEDVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEFVEVE  Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY 
Sbjct  103  KFGQPKGYAYVEFVEVEAAQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYM  162

Query  384  GFRSR  370
            GFR R
Sbjct  163  GFRGR  167



>ref|NP_001237617.1| uncharacterized protein LOC100527545 [Glycine max]
 gb|ACU16641.1| unknown [Glycine max]
Length=214

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 114/125 (91%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V+D +  SA+Q E+EEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVRDSSGTSATQVEREEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+ GRR  P AG
Sbjct  125  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYFGRR--P-AG  181

Query  381  FRSRR  367
            FRSRR
Sbjct  182  FRSRR  186



>ref|XP_008462873.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=202

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  44   EKEMSSVQDPASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  103

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+ G
Sbjct  104  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPFMG  163

Query  381  FRSR  370
             RSR
Sbjct  164  ARSR  167



>gb|KJB51354.1| hypothetical protein B456_008G213100 [Gossypium raimondii]
Length=227

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGR  NPY  
Sbjct  138  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRPSNPY--  195

Query  381  FRSRR  367
            FRSRR
Sbjct  196  FRSRR  200



>ref|XP_004504815.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X4 
[Cicer arietinum]
Length=199

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQ  +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPANAAASQINREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEFVEVE +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY 
Sbjct  103  KFGQPKGYAYVEFVEVEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYM  162

Query  384  GFRSR  370
            GFR R
Sbjct  163  GFRGR  167



>ref|XP_004504816.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X5 
[Cicer arietinum]
Length=197

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQ  +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI TD
Sbjct  41   EKEMGSVQDPANAAASQINREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTD  100

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEFVEVE +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY 
Sbjct  101  KFGQPKGYAYVEFVEVEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYM  160

Query  384  GFRSR  370
            GFR R
Sbjct  161  GFRGR  165



>ref|NP_001235474.1| uncharacterized protein LOC100527139 [Glycine max]
 gb|ACU16186.1| unknown [Glycine max]
Length=214

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 112/125 (90%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD +  SA+QAEKEEVDAR IYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVQDSSGTSATQAEKEEVDARPIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF E++ +QNALLLNESELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  125  KFGQPKGFAYVEFAEIDAVQNALLLNESELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  181

Query  381  FRSRR  367
            FRSRR
Sbjct  182  FRSRR  186



>gb|KHG11684.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=227

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/125 (86%), Positives = 117/125 (94%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGAVQDSSSASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGR  NPY  
Sbjct  138  KFGQPKGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRPSNPY--  195

Query  381  FRSRR  367
            FRSRR
Sbjct  196  FRSRR  200



>ref|XP_004504812.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X1 
[Cicer arietinum]
Length=235

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+ASQ  +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI TD
Sbjct  79   EKEMGSVQDPANAAASQINREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEFVEVE +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY 
Sbjct  139  KFGQPKGYAYVEFVEVEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYM  198

Query  384  GFRSR  370
            GFR R
Sbjct  199  GFRGR  203



>ref|XP_010519384.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Tarenaya 
hassleriana]
Length=221

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V DP   +A+QA KEEVD+RS++VGNVDYACTPEEVQQHFQ+CGTVNRVTILTD
Sbjct  68   EKEMGAVPDPAGMAANQASKEEVDSRSVFVGNVDYACTPEEVQQHFQACGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPGMKQ+RGR+FNPY G
Sbjct  128  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMPKRTNVPGMKQYRGRQFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_008804765.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Phoenix 
dactylifera]
Length=223

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q A+ LNESELHGRQ+KVS KRTNVPGMKQFR RRF+PY G
Sbjct  130  KFGQPKGFAYVEFLETEAVQEAIQLNESELHGRQIKVSPKRTNVPGMKQFRPRRFSPYMG  189

Query  381  FRSR  370
            +R R
Sbjct  190  YRFR  193



>ref|XP_008804766.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Phoenix 
dactylifera]
Length=221

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 113/124 (91%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+A+QA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMSAVQDPASAAATQASREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q A+ LNESELHGRQ+KVS KRTNVPGMKQFR RRF+PY G
Sbjct  128  KFGQPKGFAYVEFLETEAVQEAIQLNESELHGRQIKVSPKRTNVPGMKQFRPRRFSPYMG  187

Query  381  FRSR  370
            +R R
Sbjct  188  YRFR  191



>ref|XP_002321779.2| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|EEF05906.2| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=222

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQ    ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQ---GASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  131

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR +PY G
Sbjct  132  KFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPY-G  190

Query  381  FRSRR  367
            FRS+R
Sbjct  191  FRSQR  195



>ref|XP_006374586.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
 gb|ERP52383.1| hypothetical protein POPTR_0015s12230g [Populus trichocarpa]
Length=223

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQ    ASA+QAEKEEVD+RSIYVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  75   EKEMGAVQ---GASATQAEKEEVDSRSIYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  131

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR +PY G
Sbjct  132  KFGQPKGFAYVEFIEVDAVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPSPY-G  190

Query  381  FRSRR  367
            FRS+R
Sbjct  191  FRSQR  195



>ref|XP_011022817.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Populus 
euphratica]
Length=218

 Score =   215 bits (548),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V DP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVPDPASAAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+R R FNPY G
Sbjct  125  KFGQPKGFAYVEFVEVEAVQEALALNESELHGRQLKVSPKRTNVPGMKQYRARSFNPYMG  184

Query  381  FRSRR  367
             R RR
Sbjct  185  NRFRR  189



>ref|XP_004146877.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=212

 Score =   215 bits (547),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP   SASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  61   EKEMGAVQDPAGTSASQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  120

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RR+NPY G
Sbjct  121  KFGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQYRARRYNPYVG  180

Query  381  FR  376
            FR
Sbjct  181  FR  182



>ref|XP_007148398.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris]
 gb|ESW20392.1| hypothetical protein PHAVU_006G205100g [Phaseolus vulgaris]
Length=195

 Score =   214 bits (545),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  ASASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  41   EKEMGSVQDPATASASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  100

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA-  385
            KFGQPKGYAYVEF+EVE +Q AL LNESELHGRQLKV+AKRTNVPGMKQ+R R+ NPYA 
Sbjct  101  KFGQPKGYAYVEFLEVEAVQEALSLNESELHGRQLKVTAKRTNVPGMKQYRSRQSNPYAG  160

Query  384  GFRSR  370
            GFR R
Sbjct  161  GFRGR  165



>ref|XP_004168611.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=196

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQDP +A+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  43   EKEMSSVQDPASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+A RTN+PGMKQ+R RR NP+ G
Sbjct  103  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAMRTNIPGMKQYRPRRSNPFMG  162

Query  381  FRSR  370
             RSR
Sbjct  163  ARSR  166



>gb|KGN53209.1| hypothetical protein Csa_4G026860 [Cucumis sativus]
Length=234

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP   SASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  83   EKEMGAVQDPAGTSASQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  142

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RR+NPY G
Sbjct  143  KFGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQYRARRYNPYVG  202

Query  381  FR  376
            FR
Sbjct  203  FR  204



>ref|NP_201329.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 sp|Q9FJN9.1|PABN2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=AtPabN2; 
Short=AtPabN3; Short=Poly(A)-binding protein 2; AltName: Full=Nuclear 
poly(A)-binding protein 2; AltName: Full=Poly(A)-binding 
protein II; Short=PABII [Arabidopsis thaliana]
 gb|AAK62429.1|AF386984_1 poly(A)-binding protein II-like [Arabidopsis thaliana]
 dbj|BAB11662.1| poly(A)-binding protein II-like [Arabidopsis thaliana]
 gb|AAN15337.1| poly(A)-binding protein II-like [Arabidopsis thaliana]
 gb|AED98030.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=220

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEM-GAQDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVLQKRTNVPGLKQFRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_006394056.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
 gb|ESQ31342.1| hypothetical protein EUTSA_v10004890mg [Eutrema salsugineum]
Length=220

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  68   EKEM-GAQDPATIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE IQ AL LNESELHGRQLKV  KRTNVPG+KQ+RGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAIQEALQLNESELHGRQLKVLPKRTNVPGLKQYRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_002866661.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42920.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=220

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEM-GAQDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVLQKRTNVPGLKQFRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_006279497.1| hypothetical protein CARUB_v10027046mg, partial [Capsella rubella]
 gb|EOA12395.1| hypothetical protein CARUB_v10027046mg, partial [Capsella rubella]
Length=233

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  81   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  139

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  140  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  199

Query  381  FRSRR  367
            +R RR
Sbjct  200  YRFRR  204



>gb|AFK33591.1| unknown [Medicago truncatula]
Length=179

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  +S SQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  45   EKEMGAVQDPAGSSVSQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  104

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE + +QNAL+LNE+ELHGRQLKVSAKRTNVPG+KQ+ GRR    AG
Sbjct  105  KFGQPKGFAYVEFVEADAVQNALILNETELHGRQLKVSAKRTNVPGLKQY-GRR---PAG  160

Query  381  FRSRR  367
            FR RR
Sbjct  161  FRGRR  165



>ref|XP_010444551.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=220

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_010463257.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=220

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_011084771.1| PREDICTED: polyadenylate-binding protein 1-like [Sesamum indicum]
Length=228

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGV--QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTIL  568
            EKE+ G   +D   ASA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTIL
Sbjct  75   EKEIGGAAPEDSTGASAAQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTIL  134

Query  567  TDKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            TDK+GQPKG+AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY
Sbjct  135  TDKYGQPKGFAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPY  194

Query  387  AG  382
             G
Sbjct  195  FG  196



>gb|ACJ85460.1| unknown [Medicago truncatula]
 gb|AFK49250.1| unknown [Medicago truncatula]
Length=217

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  +S SQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDPAGSSVSQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE + +QNAL+LNE+ELHGRQLKVSAKRTNVPG+KQ+ GRR  P AG
Sbjct  129  KFGQPKGFAYVEFVEADAVQNALILNETELHGRQLKVSAKRTNVPGLKQY-GRR--P-AG  184

Query  381  FRSRR  367
            FR RR
Sbjct  185  FRGRR  189



>ref|XP_010444550.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
Length=221

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  69   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  128  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>ref|XP_002323754.1| hypothetical protein POPTR_0017s07850g [Populus trichocarpa]
 gb|EEF03887.1| hypothetical protein POPTR_0017s07850g [Populus trichocarpa]
Length=199

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNA-ASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP+A A+ASQA KEEVD+RS++VGNVDYACTPEEVQQHFQ+CGTVNRVTI +
Sbjct  45   EKEMGSVQDPSASATASQANKEEVDSRSVFVGNVDYACTPEEVQQHFQACGTVNRVTIRS  104

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR +PY 
Sbjct  105  DKYGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRARRPSPYM  164

Query  384  GFRSR  370
            GF  R
Sbjct  165  GFPPR  169



>ref|XP_004164242.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
Length=212

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM  VQDP   SASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTDK
Sbjct  62   KEMGAVQDPAGTSASQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  121

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGF  379
            FGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RR+NPY GF
Sbjct  122  FGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQYRARRYNPYVGF  181

Query  378  R  376
            R
Sbjct  182  R  182



>ref|XP_008453809.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Cucumis 
melo]
Length=212

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP   SA QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  61   EKEMGAVQDPAGTSAGQAGKEETDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  120

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQ+R RR+NPY G
Sbjct  121  KFGQPKGFAYVEFLEAEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQYRARRYNPYVG  180

Query  381  FR  376
            FR
Sbjct  181  FR  182



>ref|NP_001288928.1| polyadenylate-binding protein 2 [Brassica rapa]
 gb|ABL97957.1| poly(A)-binding protein II-like [Brassica rapa]
 emb|CDY08805.1| BnaA06g24190D [Brassica napus]
Length=220

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  68   EKEM-GAQDPATLAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE IQ AL LNESELHGRQLKV  KRTNVPG+KQ RGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAIQEALQLNESELHGRQLKVLPKRTNVPGLKQHRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>gb|KFK28208.1| hypothetical protein AALP_AA8G486500 [Arabis alpina]
Length=220

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEM-GAQDPATIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE IQ AL LNESELHGRQLKV  KRTNVPG+KQFRGRR NPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAIQEALQLNESELHGRQLKVLPKRTNVPGLKQFRGRRLNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_010937391.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Elaeis 
guineensis]
Length=233

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 116/139 (83%), Gaps = 14/139 (10%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGN--------------VDYACTPEEVQQHF  604
            EKEM  VQDP +A+A+QA +EEVD+RS++VGN              VDYACTPEEVQQHF
Sbjct  66   EKEMGAVQDPASAAATQASREEVDSRSVFVGNITMNSCVTLGLIHDVDYACTPEEVQQHF  125

Query  603  QSCGTVNRVTILTDKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPG  424
            QSCGTVNRVTILTDKFGQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTN+PG
Sbjct  126  QSCGTVNRVTILTDKFGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVCAKRTNIPG  185

Query  423  MKQFRGRRFNPYAGFRSRR  367
            MKQ+R RRFNPY+G+R RR
Sbjct  186  MKQYRPRRFNPYSGYRFRR  204



>ref|XP_010937390.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Elaeis 
guineensis]
Length=235

 Score =   213 bits (543),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/139 (73%), Positives = 116/139 (83%), Gaps = 14/139 (10%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGN--------------VDYACTPEEVQQHF  604
            EKEM  VQDP +A+A+QA +EEVD+RS++VGN              VDYACTPEEVQQHF
Sbjct  68   EKEMGAVQDPASAAATQASREEVDSRSVFVGNITMNSCVTLGLIHDVDYACTPEEVQQHF  127

Query  603  QSCGTVNRVTILTDKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPG  424
            QSCGTVNRVTILTDKFGQPKG+AYVEF+EVE +Q ALLLNESELHGRQLKV AKRTN+PG
Sbjct  128  QSCGTVNRVTILTDKFGQPKGFAYVEFLEVEAVQEALLLNESELHGRQLKVCAKRTNIPG  187

Query  423  MKQFRGRRFNPYAGFRSRR  367
            MKQ+R RRFNPY+G+R RR
Sbjct  188  MKQYRPRRFNPYSGYRFRR  206



>ref|XP_004504101.1| PREDICTED: polyadenylate-binding protein 2-A-like [Cicer arietinum]
Length=221

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP A +ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEIGSVQDPAAVAASQANKEETDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLL ESELHGRQLKV  KRTNVPGMKQ+R RRFNPY  
Sbjct  128  KFGQPKGFAYVEFVETEAVQEALLLTESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMA  187

Query  381  FRSRR  367
            +  RR
Sbjct  188  YGFRR  192



>ref|XP_011076456.1| PREDICTED: polyadenylate-binding protein 1 isoform X2 [Sesamum 
indicum]
Length=157

 Score =   210 bits (535),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  708  AASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAYV  529
             ASASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK+GQPKG+AYV
Sbjct  17   GASASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKYGQPKGFAYV  76

Query  528  EFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            EFVEVE +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NPY G R
Sbjct  77   EFVEVEAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPYFGTR  127



>ref|XP_002309968.1| hypothetical protein POPTR_0007s05140g [Populus trichocarpa]
 gb|EEE90418.1| hypothetical protein POPTR_0007s05140g [Populus trichocarpa]
Length=218

 Score =   213 bits (541),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V DP +A+A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAVPDPASAAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+  R FNPY G
Sbjct  125  KFGQPKGFAYVEFVEVEAVQEALALNESELHGRQLKVSPKRTNVPGMKQYHPRSFNPYMG  184

Query  381  FRSRR  367
             R RR
Sbjct  185  NRFRR  189



>emb|CDY37814.1| BnaAnng04750D [Brassica napus]
Length=156

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M G QDP   +A QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  6    EKDM-GPQDPATMAADQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  64

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ ALLLNESELHGRQLKV  KRTNVPG+KQ RGRRFNPY G
Sbjct  65   KFGQPKGFAYVEFVEAEAIQEALLLNESELHGRQLKVLPKRTNVPGLKQHRGRRFNPYMG  124

Query  381  FR  376
            FR
Sbjct  125  FR  126



>ref|XP_008392810.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=147

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 2/118 (2%)
 Frame = -2

Query  720  QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  541
            +D ++ SASQAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG
Sbjct  3    RDSSSGSASQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  62

Query  540  YAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            +AYVEFVEVE +QNALLLNESELHGRQLKVSAKRTNVPG+KQ+RGRR +P++  RSRR
Sbjct  63   FAYVEFVEVEAVQNALLLNESELHGRQLKVSAKRTNVPGLKQYRGRRPSPFS--RSRR  118



>ref|XP_009624759.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=196

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 1/124 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+A+QA +EEVDARSI+VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  43   EKEMGSVQDP-AAAANQANREEVDARSIFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q ALLLNESELHGRQLKVSAKRTNVPGMK +R RR NPY G
Sbjct  102  KFGQPKGYAYVEFLETEAVQEALLLNESELHGRQLKVSAKRTNVPGMKPYRARRPNPYMG  161

Query  381  FRSR  370
            FR R
Sbjct  162  FRGR  165



>gb|KJB19596.1| hypothetical protein B456_003G110600 [Gossypium raimondii]
Length=227

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD   ASA+QAEKEEVD+RSIYV   DYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKEMGAVQDSPGASATQAEKEEVDSRSIYV---DYACTPEEVQQHFQSCGTVNRVTILTD  135

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR NP+  
Sbjct  136  KFGQPKGFAYVEFVEVDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRRPNPF--  193

Query  381  FRSRR  367
            FRSRR
Sbjct  194  FRSRR  198



>ref|XP_006466250.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
Length=218

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP   +A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAAQDPANVAANQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E++ +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  125  KFGQPKGFAYVEFLEIDAVQEALQLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  184

Query  381  FRSRR  367
            +R RR
Sbjct  185  YRGRR  189



>ref|XP_010318203.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
 ref|XP_010318204.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=150

 Score =   210 bits (534),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  705  ASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAYVE  526
            ASA+QAEKEEVD+RSIYVGNVDYAC P EV+ HFQSCGTVNRVTILTDK GQPKG+AYVE
Sbjct  25   ASATQAEKEEVDSRSIYVGNVDYACLPGEVKLHFQSCGTVNRVTILTDKLGQPKGFAYVE  84

Query  525  FVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            F E E +QNALLLNESELHGR+LKVSAKRTNVPGMKQFRGRRFNPYAGFR RR
Sbjct  85   FFEREAVQNALLLNESELHGRKLKVSAKRTNVPGMKQFRGRRFNPYAGFRPRR  137



>emb|CDY55162.1| BnaCnng28280D [Brassica napus]
Length=220

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 111/125 (89%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP   +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  68   EKEM-GAQDPATLAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEV+ IQ AL LNESELHGRQLKV  KRTNVPG+KQ RGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVDAIQEALQLNESELHGRQLKVLPKRTNVPGLKQHRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|NP_001239931.1| uncharacterized protein LOC100791351 [Glycine max]
 gb|ACU24298.1| unknown [Glycine max]
 gb|KHN33536.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=197

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 2/126 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP  ASASQA KEE+D+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  42   EKEMGSAQDPANASASQANKEEIDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPY-  388
            KFGQPKGYAYVEF+EVE +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR  NPY 
Sbjct  102  KFGQPKGYAYVEFLEVEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRTINPYM  161

Query  387  AGFRSR  370
             GFR R
Sbjct  162  GGFRGR  167



>gb|KDO60716.1| hypothetical protein CISIN_1g041633mg [Citrus sinensis]
Length=237

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP   +A+QA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  65   EKEMGAAQDPANVAANQASKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  124

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E++ +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY G
Sbjct  125  KFGQPKGFAYVEFLEIDAVQEALQLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMG  184

Query  381  FRSRR  367
            +R RR
Sbjct  185  YRGRR  189



>ref|XP_009130503.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
Length=212

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M G QDP   +A QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  62   EKDM-GPQDPATMAADQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  120

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ ALLLNESELHGRQLKV  KRTNVPG+KQ RGRRFNPY G
Sbjct  121  KFGQPKGFAYVEFVEAEAIQEALLLNESELHGRQLKVLPKRTNVPGLKQHRGRRFNPYMG  180

Query  381  FR  376
            FR
Sbjct  181  FR  182



>gb|AFK45960.1| unknown [Lotus japonicus]
Length=171

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M  VQD   +SA+QAEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  23   EKDMGAVQD-AGSSATQAEKEEVDGRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  81

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +QNA++LNESELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  82   KFGQPKGFAYVEFVEAEAVQNAVMLNESELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  138

Query  381  FRSRR  367
            FRSRR
Sbjct  139  FRSRR  143



>ref|XP_003590723.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|ACJ84474.1| unknown [Medicago truncatula]
 gb|AES60974.1| polyadenylate-binding protein II [Medicago truncatula]
Length=187

 Score =   210 bits (535),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 4/122 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  +S SQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAVQDPAGSSVSQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE + +QNAL+LNE+ELHGRQLKVSAKRTNVPG+KQ+ GRR    AG
Sbjct  129  KFGQPKGFAYVEFVEADAVQNALILNETELHGRQLKVSAKRTNVPGLKQY-GRR---PAG  184

Query  381  FR  376
            FR
Sbjct  185  FR  186



>ref|XP_007047889.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
 gb|EOX92046.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 2 [Theobroma 
cacao]
Length=215

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEMGAVQDPAGAAANQASREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E IQ AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFN Y G
Sbjct  122  KYGQPKGFAYVEFLEAEAIQEALVLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNAYMG  181

Query  381  FRSRR  367
            +R RR
Sbjct  182  YRFRR  186



>ref|XP_002983261.1| hypothetical protein SELMODRAFT_117870 [Selaginella moellendorffii]
 gb|EFJ15603.1| hypothetical protein SELMODRAFT_117870 [Selaginella moellendorffii]
Length=219

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QD NAAS  QA KEE DARS+YVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGASQDANAAS--QAGKEEADARSVYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  125

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +QNA+LLNESELHGR LKVSAKRTNVPGMKQ+RGRRF+P   
Sbjct  126  KFGQPKGYAYVEFLEGEAVQNAILLNESELHGRPLKVSAKRTNVPGMKQYRGRRFDPSYA  185

Query  381  FRSRR  367
            + +RR
Sbjct  186  YMTRR  190



>ref|XP_007159120.1| hypothetical protein PHAVU_002G210300g [Phaseolus vulgaris]
 gb|ESW31114.1| hypothetical protein PHAVU_002G210300g [Phaseolus vulgaris]
Length=198

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQ P  A++SQ  KEEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  45   EKEMGSVQAPAPAASSQNNKEEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  104

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAY+EF+EV+ +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NPY G
Sbjct  105  KFGQPKGYAYIEFLEVQAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRPNPYQG  164

Query  381  FRSR  370
            FR R
Sbjct  165  FRGR  168



>ref|XP_007047888.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92045.1| RNA-binding (RRM/RBD/RNP motifs) family protein isoform 1 [Theobroma 
cacao]
Length=221

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A+A+QA +EE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPAGAAANQASREEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKG+AYVEF+E E IQ AL+LNESELHGRQLKV  KRTNVPGMKQ+R RRFN Y G
Sbjct  128  KYGQPKGFAYVEFLEAEAIQEALVLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNAYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|EYU20156.1| hypothetical protein MIMGU_mgv1a008942mg [Erythranthe guttata]
Length=357

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/123 (86%), Positives = 111/123 (90%), Gaps = 1/123 (1%)
 Frame = -2

Query  741  EKEMTGVQ-DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM   Q D    SA+QAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT
Sbjct  205  EKEMVSNQEDSTGGSANQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  264

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DKFGQPKG+AYVEFVEVE +QNA+LLNESELHGRQLKVSAKRTNVPGMKQ+RGRR NPY 
Sbjct  265  DKFGQPKGFAYVEFVEVESVQNAVLLNESELHGRQLKVSAKRTNVPGMKQYRGRRPNPYF  324

Query  384  GFR  376
            G R
Sbjct  325  GSR  327



>gb|AFK37484.1| unknown [Lotus japonicus]
Length=200

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  V DP  ASASQ  +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  46   EKEMGSVPDPANASASQTNREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  105

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+EVE +Q AL LNESELHGRQLKVS KRTNVPGMKQFR R  NPY G
Sbjct  106  KFGQPKGYAYVEFLEVEAVQEALALNESELHGRQLKVSGKRTNVPGMKQFRPRAPNPYMG  165

Query  381  FRSR  370
            FR R
Sbjct  166  FRGR  169



>ref|XP_006838494.1| hypothetical protein AMTR_s00002p00165660 [Amborella trichopoda]
 gb|ERN01063.1| hypothetical protein AMTR_s00002p00165660 [Amborella trichopoda]
Length=205

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  ++A+QA KEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGVVQDP--SNATQASKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EV+ +QNA+LLNESELH RQLKVSAKRTN+PGMKQ+RGRR NP   
Sbjct  128  KFGQPKGFAYVEFLEVDAVQNAVLLNESELHSRQLKVSAKRTNIPGMKQYRGRRPNPLIA  187

Query  381  FRSRR  367
             R RR
Sbjct  188  SRIRR  192



>ref|XP_010484391.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=220

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  68   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL  NESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  127  KFGQPKGFAYVEFVEVEAVQEALQRNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  186

Query  381  FRSRR  367
            +R RR
Sbjct  187  YRFRR  191



>ref|XP_010484390.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
Length=221

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QDP + +A+QA KEEVDARS++VGNVDYACTPEEVQQHFQ+CGTV+RVTILTD
Sbjct  69   EKEMGG-QDPASIAANQAGKEEVDARSVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL  NESELHGRQLKV  KRTNVPG+KQFRGRRFNPY G
Sbjct  128  KFGQPKGFAYVEFVEVEAVQEALQRNESELHGRQLKVMQKRTNVPGLKQFRGRRFNPYMG  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|AGV54499.1| RNA binding/nucleic acid binding [Phaseolus vulgaris]
Length=215

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEIGSVQDPANAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q A+LLNESELHGRQLKV  KRTNVPGMKQ R RRFNPY  
Sbjct  122  KFGQPKGFAYVEFVEVEAVQEAILLNESELHGRQLKVLPKRTNVPGMKQHRPRRFNPYMA  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>ref|XP_010680512.1| PREDICTED: polyadenylate-binding protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=220

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 107/125 (86%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A A  A KEEVD+RS++VGNVDYACTPEEVQQHFQ CGTVNRVTILTD
Sbjct  68   EKEMGAVQDPVTA-AEMANKEEVDSRSVFVGNVDYACTPEEVQQHFQGCGTVNRVTILTD  126

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ AL LNESELHGRQLKV  KRTNVPGMKQFR RRFNPY  
Sbjct  127  KFGQPKGFAYVEFVEQEAIQQALQLNESELHGRQLKVLPKRTNVPGMKQFRARRFNPYTP  186

Query  381  FRSRR  367
            FRSRR
Sbjct  187  FRSRR  191



>ref|XP_010030027.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
Length=195

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E+EM  VQDP  A+ASQA KEE+D+RSI+VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EREMGSVQDPANAAASQANKEEIDSRSIFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQ+R RR NP+ G
Sbjct  103  KYGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQYRPRRPNPFMG  162

Query  381  FRSR  370
             R R
Sbjct  163  GRFR  166



>ref|XP_004143458.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 ref|XP_004160130.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN48735.1| hypothetical protein Csa_6G499790 [Cucumis sativus]
Length=212

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  ++ SQ  KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  58   EKEMGAVQDPAGSAVSQESKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  117

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEFVE E IQ ALLLNE+ELHGRQLKV  KRTNVPGMKQ+  +R+NPY G
Sbjct  118  KFGHPKGFAYVEFVEAEAIQEALLLNETELHGRQLKVQQKRTNVPGMKQYFPQRYNPYMG  177

Query  381  FRSRR  367
            +RSRR
Sbjct  178  YRSRR  182



>ref|XP_007159717.1| hypothetical protein PHAVU_002G261500g [Phaseolus vulgaris]
 gb|ESW31711.1| hypothetical protein PHAVU_002G261500g [Phaseolus vulgaris]
Length=215

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEIGSVQDPVNAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q A+LLNESELHGRQLKV  KRTNVPGMKQ R RRFNPY  
Sbjct  122  KFGQPKGFAYVEFVEVEAVQEAILLNESELHGRQLKVLPKRTNVPGMKQHRPRRFNPYMA  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>gb|ACU19123.1| unknown [Glycine max]
Length=205

 Score =   210 bits (534),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            +KE+  VQDP  ++ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   DKEIGSVQDPANSAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY  
Sbjct  122  KFGQPKGFAYVEFVEAEAVQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMA  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>ref|XP_006358185.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Solanum 
tuberosum]
Length=164

 Score =   208 bits (530),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -2

Query  738  KEMTGVQDPN--AASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            + +  + +P     SA+QAEKEEVD+RSIYVGNVDYAC P EV+QHFQ+CGTVNRVTILT
Sbjct  12   RSLWAIPEPKNPTGSATQAEKEEVDSRSIYVGNVDYACLPGEVKQHFQACGTVNRVTILT  71

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK GQPKG+AYVEF E+E +QNALLLNESELHGR+LKVSAKRTNVPGMKQFRGRRFNPYA
Sbjct  72   DKLGQPKGFAYVEFFEIEAVQNALLLNESELHGRKLKVSAKRTNVPGMKQFRGRRFNPYA  131

Query  384  GFRSRR  367
             FR RR
Sbjct  132  EFRPRR  137



>ref|XP_010676727.1| PREDICTED: polyadenylate-binding protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E+EM   ++  +A+ +QAEKEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EQEMGIPEESTSANPTQAEKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  129

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            +FGQPKG+AYVEFVE+E +Q+ALLLNE+ELHGRQLKVS KRTNVPGMKQFRGRR NPY G
Sbjct  130  RFGQPKGFAYVEFVELEAVQHALLLNETELHGRQLKVSVKRTNVPGMKQFRGRRPNPYGG  189

Query  381  FRSRR  367
             RSRR
Sbjct  190  -RSRR  193



>ref|XP_010536563.1| PREDICTED: polyadenylate-binding protein 2 [Tarenaya hassleriana]
Length=227

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 111/122 (91%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QD ++AS S AEKEEVD+RSIYVGNVDYACTPEEVQ+HFQSCGTVNRVTILTD
Sbjct  79   EKEMGSGQDSSSASPSLAEKEEVDSRSIYVGNVDYACTPEEVQEHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QNAL+LNESELHGRQLKVSAKRTNVPGM+Q+RGRR F P  
Sbjct  139  KFGQPKGFAYVEFVEVEAVQNALVLNESELHGRQLKVSAKRTNVPGMRQYRGRRPFRPMR  198

Query  384  GF  379
            GF
Sbjct  199  GF  200



>ref|NP_001240115.1| uncharacterized protein LOC100784473 [Glycine max]
 gb|ACU18324.1| unknown [Glycine max]
 gb|KHN26757.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=197

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 1/121 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  ASASQA KEE+D+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  42   EKEMGSVQDPANASASQANKEEIDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKGYAYVEF+EVE +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR  NPY 
Sbjct  102  KFGQPKGYAYVEFLEVEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSTNPYM  161

Query  384  G  382
            G
Sbjct  162  G  162



>ref|XP_002961293.1| hypothetical protein SELMODRAFT_74095 [Selaginella moellendorffii]
 gb|EFJ38832.1| hypothetical protein SELMODRAFT_74095 [Selaginella moellendorffii]
Length=221

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QD NAAS  QA KEE DARS+YVGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  70   EKEMGAGQDANAAS--QAGKEEADARSVYVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +QNA+LLNESELHGR LKVSAKRTNVPGMKQ+RGRRF+P   
Sbjct  128  KFGQPKGYAYVEFLEGEAVQNAILLNESELHGRPLKVSAKRTNVPGMKQYRGRRFDPSYA  187

Query  381  FRSRR  367
            + +RR
Sbjct  188  YMTRR  192



>gb|KHN29042.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=212

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV  KRTNVPGMKQ+R R FNPY  
Sbjct  122  KFGQPKGFAYVEFVEAEAVQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPRCFNPYMA  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>emb|CDP20626.1| unnamed protein product [Coffea canephora]
Length=196

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  43   EKEMGAVQDPAAAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q ALLLNESELHGRQLKVSAKRTNVPGMKQFR RR +PY G
Sbjct  103  KFGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVSAKRTNVPGMKQFRPRRPSPYMG  162

Query  381  FRSR  370
            FR R
Sbjct  163  FRGR  166



>ref|XP_003525045.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Glycine 
max]
Length=215

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            +KE+  VQDP  ++ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   DKEIGSVQDPANSAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY  
Sbjct  122  KFGQPKGFAYVEFVEAEAVQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMA  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>ref|XP_006585263.1| PREDICTED: polyadenylate-binding protein 2-A [Glycine max]
Length=218

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV  KRTNVPGMKQ+R R FNPY  
Sbjct  128  KFGQPKGFAYVEFVEAEAVQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPRCFNPYMA  187

Query  381  FRSRR  367
            +  RR
Sbjct  188  YGFRR  192



>ref|XP_002525843.1| poly-A binding protein, putative [Ricinus communis]
 gb|EEF36537.1| poly-A binding protein, putative [Ricinus communis]
Length=198

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 1/124 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP AA ASQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNR+TI TD
Sbjct  46   EKEMGSSQDPTAA-ASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRITIRTD  104

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR NPY G
Sbjct  105  KYGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPNPYMG  164

Query  381  FRSR  370
            F  R
Sbjct  165  FAPR  168



>gb|AFK45716.1| unknown [Lotus japonicus]
Length=218

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 112/125 (90%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M  VQD   +SA+QAEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKDMGAVQD-AGSSATQAEKEEVDGRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +QNA++LNESELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  128  KFGQPKGFAYVEFVEAEAVQNAVMLNESELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  184

Query  381  FRSRR  367
            FRSRR
Sbjct  185  FRSRR  189



>ref|XP_009404038.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=224

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 8/133 (6%)
 Frame = -2

Query  741  EKEMTGVQ--------DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV  586
            EKEM   Q        DP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV
Sbjct  63   EKEMGAAQGPISSPSLDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTV  122

Query  585  NRVTILTDKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRG  406
            NRVTILTDKFGQPKG+AYVEF+E+E +Q+AL LNESELHGRQ+KV+AKRTNVPGMKQF  
Sbjct  123  NRVTILTDKFGQPKGFAYVEFLELEAVQDALQLNESELHGRQIKVAAKRTNVPGMKQFHP  182

Query  405  RRFNPYAGFRSRR  367
            RRFNPY G+  RR
Sbjct  183  RRFNPYMGYPYRR  195



>ref|XP_009404039.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=222

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 112/133 (84%), Gaps = 8/133 (6%)
 Frame = -2

Query  741  EKEMTGVQ--------DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTV  586
            EKEM   Q        DP  ++A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV
Sbjct  61   EKEMGAAQGPISSPSLDPAGSAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTV  120

Query  585  NRVTILTDKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRG  406
            NRVTILTDKFGQPKG+AYVEF+E+E +Q+AL LNESELHGRQ+KV+AKRTNVPGMKQF  
Sbjct  121  NRVTILTDKFGQPKGFAYVEFLELEAVQDALQLNESELHGRQIKVAAKRTNVPGMKQFHP  180

Query  405  RRFNPYAGFRSRR  367
            RRFNPY G+  RR
Sbjct  181  RRFNPYMGYPYRR  193



>gb|ACJ84516.1| unknown [Medicago truncatula]
 gb|AFK38775.1| unknown [Medicago truncatula]
 gb|KEH20798.1| polyadenylate-binding protein II [Medicago truncatula]
Length=216

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP + +ASQ  KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  63   EKEIGSVQDPASVAASQENKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  122

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLL+ESELHGRQLKV  KRTNVPGMKQ+R RRFNPY  
Sbjct  123  KFGQPKGFAYVEFVETEAVQEALLLSESELHGRQLKVLPKRTNVPGMKQYRPRRFNPYMA  182

Query  381  FRSRR  367
            +  RR
Sbjct  183  YGFRR  187



>gb|KFK25338.1| hypothetical protein AALP_AA8G099700 [Arabis alpina]
Length=217

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +  A+Q EKEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKEMGAVQDPASTGANQVEKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSMG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRYRR  188



>gb|EYU23964.1| hypothetical protein MIMGU_mgv1a013628mg [Erythranthe guttata]
Length=215

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP +A+AS A KEEVD+RS+YVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEMGAAQDPASAAASAASKEEVDSRSVYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E IQ AL LNESELHGRQLKV AKRTNVPGMKQFRGRRFNPY  
Sbjct  122  KFGQPKGFAYVEFLEQEAIQEALQLNESELHGRQLKVMAKRTNVPGMKQFRGRRFNPYLS  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>gb|KCW56969.1| hypothetical protein EUGRSUZ_I02641 [Eucalyptus grandis]
Length=229

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E+EM  VQDP  A+ASQA KEE+D+RSI+VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  77   EREMGSVQDPANAAASQANKEEIDSRSIFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQ+R RR NP+ G
Sbjct  137  KYGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQYRPRRPNPFMG  196

Query  381  FRSR  370
             R R
Sbjct  197  GRFR  200



>gb|KJB47020.1| hypothetical protein B456_008G016100 [Gossypium raimondii]
Length=194

 Score =   208 bits (529),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+ SQA +EEVD+RSI+VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPAAAATSQANREEVDSRSIFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  KYGQPKGYAYVEFLEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  160



>ref|XP_006353217.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X1 
[Solanum tuberosum]
Length=218

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP + +ASQ  +EEVD+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRVTILTD
Sbjct  64   EKEMGSVQDPASTAASQENREEVDSRSIFVGNVDYACTPEEVQQHFQACGTVNRVTILTD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY-A  385
            KFGQPKG+AYVEF+E E IQ AL LNESELHGRQLKV  KRTNVPGMKQFR  RFNPY  
Sbjct  124  KFGQPKGFAYVEFIEQEAIQEALQLNESELHGRQLKVVPKRTNVPGMKQFRPGRFNPYLG  183

Query  384  GFRSRR  367
            G RSRR
Sbjct  184  GHRSRR  189



>gb|ACU24426.1| unknown [Glycine max]
Length=218

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKE+  VQDP  A+ASQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEIGSVQDPANAAASQANKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +Q ALLLNESELHGRQLKV  KRTNVPGMKQ+R   FNPY  
Sbjct  128  KFGQPKGFAYVEFVEAEAVQEALLLNESELHGRQLKVLPKRTNVPGMKQYRPSCFNPYMA  187

Query  381  FRSRR  367
            +  RR
Sbjct  188  YGFRR  192



>ref|XP_011092432.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Sesamum 
indicum]
Length=177

 Score =   207 bits (526),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E+EM  VQDP AA+A+Q  +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI T+
Sbjct  23   EQEMGAVQDPAAAAANQTNREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTN  82

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E ++ A+LLNESELHGRQLKVSAKRTNVPGMKQFR RR NPY G
Sbjct  83   KYGQPKGYAYVEFLEPEAVEQAILLNESELHGRQLKVSAKRTNVPGMKQFRPRRSNPYMG  142

Query  381  FRSR  370
            FRSR
Sbjct  143  FRSR  146



>emb|CDY33970.1| BnaC02g43670D [Brassica napus]
Length=211

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M G QDP   ++ QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTV+RVTILTD
Sbjct  61   EKDM-GPQDPATIASDQAGKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVHRVTILTD  119

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ+AL LNESELHGRQLKV  KRTNVPG+KQ RGRRFNPY G
Sbjct  120  KFGQPKGFAYVEFVEAEAIQDALQLNESELHGRQLKVLPKRTNVPGLKQHRGRRFNPYMG  179

Query  381  FR  376
            FR
Sbjct  180  FR  181



>gb|KDP40916.1| hypothetical protein JCGZ_24915 [Jatropha curcas]
Length=197

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP AA  SQA +EEVD+RS++VGNVDY+C PEEVQQHFQSCGTVNRVTI TD
Sbjct  45   EKEMGSAQDP-AAGTSQASREEVDSRSVFVGNVDYSCNPEEVQQHFQSCGTVNRVTIRTD  103

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR NPY G
Sbjct  104  KYGQPKGYAYVEFLEAEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRSNPYMG  163

Query  381  FRSR  370
            F  R
Sbjct  164  FPPR  167



>ref|XP_009760239.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=197

 Score =   207 bits (526),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+A+QA +EEVD RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  43   EKEMGSVQDPAAAAATQANREEVDGRSVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q ALLLNESELHGRQ+KVSAKRTNVPGMKQFR RR +PY G
Sbjct  103  KFGQPKGYAYVEFLEAEAVQEALLLNESELHGRQIKVSAKRTNVPGMKQFRARRPSPYMG  162

Query  381  FR  376
            FR
Sbjct  163  FR  164



>ref|XP_010442595.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
 ref|XP_010482442.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=226

 Score =   208 bits (529),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+   +S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGAGQDPSGGVSS-AEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGMKQFRGRR F P  
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMKQFRGRRPFRPMR  197

Query  384  GF  379
            GF
Sbjct  198  GF  199



>ref|XP_006281051.1| hypothetical protein CARUB_v10027069mg [Capsella rubella]
 ref|XP_010426305.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
 gb|EOA13949.1| hypothetical protein CARUB_v10027069mg [Capsella rubella]
Length=226

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+   +S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGAGQDPSGGVSS-AEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGMKQFRGRR F P  
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMKQFRGRRPFRPMR  197

Query  384  GF  379
            GF
Sbjct  198  GF  199



>ref|XP_010027916.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW54560.1| hypothetical protein EUGRSUZ_I00520 [Eucalyptus grandis]
Length=221

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ASQA KEEVD RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEMGAVQDPASAAASQASKEEVDTRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEF+EVE IQ ALLLNESELHGRQLKV  KRTNVPGMKQ+  RRFNPYA 
Sbjct  128  KFGHPKGFAYVEFLEVEAIQEALLLNESELHGRQLKVLPKRTNVPGMKQYFPRRFNPYAS  187

Query  381  FRSRR  367
            +R RR
Sbjct  188  YRFRR  192



>gb|KHG15936.1| Polyadenylate-binding 2 [Gossypium arboreum]
Length=194

 Score =   206 bits (525),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ SQA +EEVD+RSI+VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPASAATSQANREEVDSRSIFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            K+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  KYGQPKGYAYVEFLEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  160



>ref|XP_006366227.1| PREDICTED: polyadenylate-binding protein 2-A-like [Solanum tuberosum]
Length=216

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP  A ASQA +EE+D+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRVTILTD
Sbjct  62   EKEMGSVQDPANADASQANREELDSRSIFVGNVDYACTPEEVQQHFQACGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ AL LNESELHGRQLKV  KRTNVPGMKQF  RRF+PY  
Sbjct  122  KFGQPKGFAYVEFVEQEAIQEALQLNESELHGRQLKVMPKRTNVPGMKQFHPRRFSPYQP  181

Query  381  FRSRR  367
            +  RR
Sbjct  182  YGFRR  186



>ref|XP_006402013.1| hypothetical protein EUTSA_v10014588mg [Eutrema salsugineum]
 gb|ESQ43466.1| hypothetical protein EUTSA_v10014588mg [Eutrema salsugineum]
Length=226

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP++   S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGSGQDPSSG-ISAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGMKQFRGRR F P  
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMKQFRGRRPFRPMR  197

Query  384  GF  379
            GF
Sbjct  198  GF  199



>gb|AFK37159.1| unknown [Lotus japonicus]
Length=217

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M  VQD   +SA+QAEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKDMGAVQD-AGSSATQAEKEEVDGRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  127

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E +QNA++LNE ELHGRQLKVSAKRTNVPGMKQ+ GRR    AG
Sbjct  128  KFGQPKGFAYVEFVEAEAVQNAVMLNELELHGRQLKVSAKRTNVPGMKQYFGRR---PAG  184

Query  381  FRSRR  367
            FRSRR
Sbjct  185  FRSRR  189



>ref|XP_011092431.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Sesamum 
indicum]
Length=197

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E+EM  VQDP AA+A+Q  +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI T+
Sbjct  43   EQEMGAVQDPAAAAANQTNREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTN  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E ++ A+LLNESELHGRQLKVSAKRTNVPGMKQFR RR NPY G
Sbjct  103  KYGQPKGYAYVEFLEPEAVEQAILLNESELHGRQLKVSAKRTNVPGMKQFRPRRSNPYMG  162

Query  381  FRSR  370
            FRSR
Sbjct  163  FRSR  166



>ref|XP_009776052.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=196

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 110/124 (89%), Gaps = 1/124 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+A+QA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  43   EKEMGSVQDP-AAAANQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q ALLLNESELHGRQLKVSAKRTNVPGMK +R RR NP  G
Sbjct  102  KFGQPKGYAYVEFLETEAVQEALLLNESELHGRQLKVSAKRTNVPGMKLYRARRPNPPMG  161

Query  381  FRSR  370
            FR R
Sbjct  162  FRGR  165



>ref|XP_009611267.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana tomentosiformis]
 ref|XP_009757522.1| PREDICTED: polyadenylate-binding protein 2 [Nicotiana sylvestris]
Length=216

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ASQA +EEVD+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRVTILTD
Sbjct  63   EKEMGSVQDPASAAASQASREEVDSRSIFVGNVDYACTPEEVQQHFQACGTVNRVTILTD  122

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVE E IQ AL LNESELHGRQLKV  KRTNVPGMKQFRGRRFNPY  
Sbjct  123  KFGQPKGFAYVEFVEQEAIQEALQLNESELHGRQLKVMPKRTNVPGMKQFRGRRFNPYMA  182

Query  381  FRSRR  367
            +  RR
Sbjct  183  YGFRR  187



>ref|XP_009390281.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=214

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ASQA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  62   EKEMGSVQDPASAAASQASKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  121

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q AL LNESELHGRQ+KV+AKRTNVPGMKQFR RRF+PY G
Sbjct  122  KFGQPKGFAYVEFLEVEAVQEALQLNESELHGRQIKVAAKRTNVPGMKQFRPRRFSPYMG  181

Query  381  FRSRR  367
               RR
Sbjct  182  NPYRR  186



>ref|XP_009390280.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=216

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+ASQA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  64   EKEMGSVQDPASAAASQASKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +Q AL LNESELHGRQ+KV+AKRTNVPGMKQFR RRF+PY G
Sbjct  124  KFGQPKGFAYVEFLEVEAVQEALQLNESELHGRQIKVAAKRTNVPGMKQFRPRRFSPYMG  183

Query  381  FRSRR  367
               RR
Sbjct  184  NPYRR  188



>gb|KFK26726.1| hypothetical protein AALP_AA8G284900 [Arabis alpina]
Length=226

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP++   S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGAGQDPSSG-ISAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  197

Query  384  GF  379
            GF
Sbjct  198  GF  199



>ref|XP_007042909.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOX98740.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=194

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+ SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            K+GQPKGYAYVEF+E E +Q AL+LNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  KYGQPKGYAYVEFLEAEAVQEALVLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  160



>ref|XP_009132625.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
 emb|CDY38851.1| BnaA03g13280D [Brassica napus]
 emb|CDY32641.1| BnaC03g16090D [Brassica napus]
Length=225

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP+ A +S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  78   EKEMGADQDPSGAISS-AEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  136

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE + +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  137  KFGQPKGFAYVEFVEEDAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  196

Query  384  GF  379
            GF
Sbjct  197  GF  198



>gb|AFJ66183.1| hypothetical protein 11M19.19 [Arabidopsis halleri]
Length=228

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  81   EKDMGAGQDPSGG-VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  139

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  140  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  199

Query  384  GF  379
            GF
Sbjct  200  GF  201



>ref|XP_002864097.1| hypothetical protein ARALYDRAFT_918145 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40356.1| hypothetical protein ARALYDRAFT_918145 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  81   EKDMGAGQDPSGG-VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  139

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  140  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  199

Query  384  GF  379
            GF
Sbjct  200  GF  201



>ref|XP_007042910.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOX98741.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=189

 Score =   204 bits (520),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+ SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TD
Sbjct  43   EKEMGSVQDPAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTD  102

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            K+GQPKGYAYVEF+E E +Q AL+LNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  KYGQPKGYAYVEFLEAEAVQEALVLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  160



>ref|XP_001784768.1| predicted protein [Physcomitrella patens]
 gb|EDQ50428.1| predicted protein [Physcomitrella patens]
Length=219

 Score =   205 bits (522),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ VQD      S A +EE DARS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  73   EKEMSAVQDSVGKDGSPANREEADARSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  132

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +QNA+LLNESELH RQLKV+AKRTNVPGMK +RGR + P+ G
Sbjct  133  KFGQPKGFAYVEFLEVEAVQNAILLNESELHNRQLKVTAKRTNVPGMKAYRGRPYAPFYG  192

Query  381  FRSRR  367
            +R RR
Sbjct  193  YRPRR  197



>gb|EYU35168.1| hypothetical protein MIMGU_mgv1a013256mg [Erythranthe guttata]
Length=219

 Score =   205 bits (522),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  720  QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  541
            +D   AS +QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG
Sbjct  87   EDATGASVTQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  146

Query  540  YAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR  400
            +AYVEFVEVE +QNALLLNE+ELHGRQLKVSAKRTNVPGMKQFRGRR
Sbjct  147  FAYVEFVEVEAVQNALLLNETELHGRQLKVSAKRTNVPGMKQFRGRR  193



>ref|NP_850803.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AED91528.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=202

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP + +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKEMGATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSMG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>ref|XP_009140879.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
 emb|CDY05837.1| BnaA10g05830D [Brassica napus]
Length=227

 Score =   205 bits (522),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+ A +S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  80   EKDMGAGQDPSNAISS-AEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE + +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  139  KFGQPKGFAYVEFVEADAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  198

Query  384  GF  379
            GF
Sbjct  199  GF  200



>ref|XP_006359788.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum tuberosum]
Length=196

 Score =   204 bits (519),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+A+QA KEEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  42   EKEMGSVQDPAAAAANQANKEEVDSRSVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKVSAKRTNVPGMK +R RR NPY G
Sbjct  102  KFGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVSAKRTNVPGMKPYRARRPNPYMG  161

Query  381  FRSR  370
            FR R
Sbjct  162  FRGR  165



>ref|XP_002873452.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49711.1| polyadenylate-binding protein family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=202

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP   +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKEMGATQDPATMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSIG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>gb|EYU35167.1| hypothetical protein MIMGU_mgv1a013256mg [Erythranthe guttata]
Length=226

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/107 (90%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -2

Query  720  QDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  541
            +D   AS +QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG
Sbjct  87   EDATGASVTQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG  146

Query  540  YAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR  400
            +AYVEFVEVE +QNALLLNE+ELHGRQLKVSAKRTNVPGMKQFRGRR
Sbjct  147  FAYVEFVEVEAVQNALLLNETELHGRQLKVSAKRTNVPGMKQFRGRR  193



>ref|NP_196597.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 sp|Q9LX90.1|PABN3_ARATH RecName: Full=Polyadenylate-binding protein 3; Short=AtPabN2; 
Short=AtPabN3; Short=Poly(A)-binding protein 3; AltName: Full=Nuclear 
poly(A)-binding protein 3; AltName: Full=Poly(A)-binding 
protein III; Short=PABIII [Arabidopsis thaliana]
 emb|CAB89408.1| RNA binding protein-like [Arabidopsis thaliana]
 gb|AAO41941.1| putative polyadenylate-binding protein II (PAB2) [Arabidopsis 
thaliana]
 gb|AAO50536.1| putative polyadenylate-binding protein II (PAB2) [Arabidopsis 
thaliana]
 gb|AED91529.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=217

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP + +A+Q  KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKEMGATQDPASMAANQEGKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSMG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>ref|XP_004250109.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Solanum 
lycopersicum]
Length=219

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 110/127 (87%), Gaps = 2/127 (2%)
 Frame = -2

Query  741  EKEMTGVQD-PNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQD P + +ASQ  +EE+D+RSI+VGNVDYACTPEEVQQHFQ+CGTVNRVTILT
Sbjct  64   EKEMGSVQDDPASTAASQENREELDSRSIFVGNVDYACTPEEVQQHFQACGTVNRVTILT  123

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY-  388
            DKFGQPKG+AYVEF+E E +Q AL LNESELHGRQLKV  KRTNVPGMKQFR  RFNPY 
Sbjct  124  DKFGQPKGFAYVEFIEQEAVQEALQLNESELHGRQLKVMPKRTNVPGMKQFRPGRFNPYL  183

Query  387  AGFRSRR  367
             G+RSRR
Sbjct  184  GGYRSRR  190



>ref|XP_004504814.1| PREDICTED: polyadenylate-binding protein 2-A-like isoform X3 
[Cicer arietinum]
Length=205

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = -2

Query  717  DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGY  538
            DP  A+ASQ  +EEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI TDKFGQPKGY
Sbjct  57   DPANAAASQINREEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGY  116

Query  537  AYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYAGFRSR  370
            AYVEFVEVE +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR  NPY GFR R
Sbjct  117  AYVEFVEVEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRPRRPSNPYMGFRGR  173



>ref|XP_004288178.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=222

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QDP AA+ SQA KEE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  69   EKEMGAAQDPAAAAVSQAHKEEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  128

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL+LNESELHGRQLKV  KRTNVPGMKQFR RRF+PY G
Sbjct  129  KFGQPKGFAYVEFLETEAVQEALVLNESELHGRQLKVLPKRTNVPGMKQFRPRRFSPYMG  188

Query  381  FRSRR  367
            +R RR
Sbjct  189  YRFRR  193



>dbj|BAA97374.1| unnamed protein product [Arabidopsis thaliana]
Length=267

 Score =   205 bits (521),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGASQDPSGG-VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQF--RGRRFNPY  388
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QF  RGR F P 
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPM  197

Query  387  AGF  379
             GF
Sbjct  198  RGF  200



>gb|AAM61036.1| contains similarity to poly(A)-binding protein II [Arabidopsis 
thaliana]
Length=227

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGASQDPSGG-VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQF--RGRRFNPY  388
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QF  RGR F P 
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPM  197

Query  387  AGF  379
             GF
Sbjct  198  RGF  200



>ref|NP_568751.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
 sp|Q93VI4.1|PABN1_ARATH RecName: Full=Polyadenylate-binding protein 1; Short=AtPabN1; 
Short=Poly(A)-binding protein 1; AltName: Full=Nuclear poly(A)-binding 
protein 1; AltName: Full=Poly(A)-binding protein 
I; Short=PABI [Arabidopsis thaliana]
 gb|AAL06847.1| AT5g51120/MWD22_6 [Arabidopsis thaliana]
 gb|AAL09819.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85123.1| unknown protein [Arabidopsis thaliana]
 gb|AAM47151.1| unknown protein [Arabidopsis thaliana]
 gb|AED96038.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
Length=227

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 108/123 (88%), Gaps = 3/123 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP+    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  79   EKDMGASQDPSGG-VSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  137

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQF--RGRRFNPY  388
            KFGQPKG+AYVEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QF  RGR F P 
Sbjct  138  KFGQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPM  197

Query  387  AGF  379
             GF
Sbjct  198  RGF  200



>emb|CDX71690.1| BnaC09g27310D [Brassica napus]
Length=227

 Score =   204 bits (518),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 111/122 (91%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QDP++A +S AEKEEVD+RSI+VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  80   EKDMGAGQDPSSAISS-AEKEEVDSRSIHVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE + +QN+L+LNESELHGR++KVSAKRTNVPGM+QFRGRR F P  
Sbjct  139  KFGQPKGFAYVEFVEADAVQNSLILNESELHGRKIKVSAKRTNVPGMRQFRGRRPFRPMR  198

Query  384  GF  379
            GF
Sbjct  199  GF  200



>ref|XP_009393548.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   203 bits (517),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQ+ ++A+A+QA KEEVDARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGAVQESSSAAATQASKEEVDARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  133

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNESELHGRQ+KV+AKRTNVPGMKQFR RRFN YAG
Sbjct  134  KFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQIKVAAKRTNVPGMKQFRPRRFNSYAG  193

Query  381  FRSRR  367
               RR
Sbjct  194  SPYRR  198



>ref|XP_009127326.1| PREDICTED: polyadenylate-binding protein 2-like [Brassica rapa]
Length=231

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E +M   QDP++A  S AEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  84   ENDMAAAQDPSSA-ISAAEKEEVDLRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  142

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE E +QN+L+LNE+ELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  143  KFGQPKGFAYVEFVEEEAVQNSLVLNETELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  202

Query  384  GF  379
            GF
Sbjct  203  GF  204



>emb|CDY16338.1| BnaA02g11420D [Brassica napus]
Length=231

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E +M   QDP++A  S AEKEEVD RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  84   ENDMAAAQDPSSA-ISAAEKEEVDLRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  142

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE E +QN+L+LNE+ELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  143  KFGQPKGFAYVEFVEEEAVQNSLVLNETELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  202

Query  384  GF  379
            GF
Sbjct  203  GF  204



>ref|XP_010690525.1| PREDICTED: polyadenylate-binding protein 3-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=203

 Score =   202 bits (514),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP A +A QA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI T+
Sbjct  51   EKEMGAVQDPAAVAADQANKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTN  110

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q AL LNES LHGRQLKV+AKRTNVPGMKQFR RR +P  G
Sbjct  111  KFGQPKGYAYVEFLETEAVQEALRLNESVLHGRQLKVTAKRTNVPGMKQFRPRRPSPIMG  170

Query  381  F  379
            +
Sbjct  171  Y  171



>ref|XP_010690526.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=201

 Score =   202 bits (513),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP A +A QA KEEVD+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTI T+
Sbjct  49   EKEMGAVQDPAAVAADQANKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTN  108

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEF+E E +Q AL LNES LHGRQLKV+AKRTNVPGMKQFR RR +P  G
Sbjct  109  KFGQPKGYAYVEFLETEAVQEALRLNESVLHGRQLKVTAKRTNVPGMKQFRPRRPSPIMG  168

Query  381  F  379
            +
Sbjct  169  Y  169



>ref|XP_010555595.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=222

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 1/122 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM   QD ++ S S AEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  74   EKEMGSGQDSSSGSPSLAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  133

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE++ +QNAL+LNESELHGRQLKVSAKRTNVPGMKQ+RGRR F P  
Sbjct  134  KFGQPKGFAYVEFVEIDAVQNALMLNESELHGRQLKVSAKRTNVPGMKQYRGRRSFRPMR  193

Query  384  GF  379
            GF
Sbjct  194  GF  195



>gb|AHA84276.1| polyadenylate-binding protein 2 [Phaseolus vulgaris]
Length=211

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  717  DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGY  538
            DP  A+ASQA KEE D+RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG+
Sbjct  66   DPANAAASQANKEEADSRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGF  125

Query  537  AYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            AYVEFVEVE +Q A+LLNESELHGRQLKV  KRTNVPGMKQ R RRFNPY  +  RR
Sbjct  126  AYVEFVEVEAVQEAILLNESELHGRQLKVLPKRTNVPGMKQHRPRRFNPYMXYGFRR  182



>ref|XP_001752237.1| predicted protein [Physcomitrella patens]
 gb|EDQ82970.1| predicted protein, partial [Physcomitrella patens]
Length=156

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G QD    S +QA +EE DARS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  23   EKEMGGSQDSAITSGAQANREEADARSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  82

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLK-VSAKRTNVPGMKQFRGRRFNPYA  385
            KFGQPKG+AYVEF+EVE +QNA+LL+ESELH R LK V++KRTNVPGMK FRGR + PY 
Sbjct  83   KFGQPKGFAYVEFLEVEAVQNAILLSESELHNRPLKVVTSKRTNVPGMKGFRGRPYAPYY  142

Query  384  GFRSRR  367
            G+R RR
Sbjct  143  GYRPRR  148



>ref|XP_010273013.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Nelumbo 
nucifera]
Length=151

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  735  EMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF  556
            ++    DP +A+A QA +EE D+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTDKF
Sbjct  2    KLCCATDPASAAAIQASREEGDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKF  61

Query  555  GQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            GQPKG+AYVEF+E+E +Q ALLLNESELHGRQLKV  KRTN+PGMKQFR RRF+PY G R
Sbjct  62   GQPKGFAYVEFLEMEAVQEALLLNESELHGRQLKVLPKRTNIPGMKQFRPRRFSPYLGCR  121

Query  375  SRR  367
             RR
Sbjct  122  FRR  124



>ref|XP_010273012.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Nelumbo 
nucifera]
Length=153

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = -2

Query  735  EMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF  556
            ++    DP +A+A QA +EE D+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTDKF
Sbjct  2    KLCCATDPASAAAIQASREEGDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTDKF  61

Query  555  GQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            GQPKG+AYVEF+E+E +Q ALLLNESELHGRQLKV  KRTN+PGMKQFR RRF+PY G R
Sbjct  62   GQPKGFAYVEFLEMEAVQEALLLNESELHGRQLKVLPKRTNIPGMKQFRPRRFSPYLGCR  121

Query  375  SRR  367
             RR
Sbjct  122  FRR  124



>ref|XP_010109150.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC21079.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=421

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 2/120 (2%)
 Frame = -2

Query  726  GVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQP  547
            GV   ++A+A+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQP
Sbjct  172  GVNHSSSATATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQP  231

Query  546  KGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            KG+AYVEFVE++ +QNALLLNESELHGRQLKVSAKRTN+PGMKQ+RGRR  P +  RSRR
Sbjct  232  KGFAYVEFVEIDAVQNALLLNESELHGRQLKVSAKRTNIPGMKQYRGRR--PGSFPRSRR  289



>pdb|2M70|A Chain A, Structural Determination Of The Citrus Sinensis Poly(a)-binding 
Protein Cspabp1
Length=155

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD ++ SA+QAEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  50   EKEMGAVQDSSSTSATQAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  109

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPG  424
            KFGQPKG+AYVEFVE++ +QNALLLNE+ELHGRQLKVSAKRTN+PG
Sbjct  110  KFGQPKGFAYVEFVEIDAVQNALLLNETELHGRQLKVSAKRTNIPG  155



>ref|XP_011097543.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Sesamum 
indicum]
Length=217

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP +A+A+QA KEEVD+RS++VGNVDYACTPEEVQQHFQ+CGTVNRVTILTD
Sbjct  64   EKEMGAVQDPASAAAAQASKEEVDSRSVFVGNVDYACTPEEVQQHFQACGTVNRVTILTD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+E E +Q AL LNESELHGRQLKV  KRTNVPGMKQ+R RRFNPY  
Sbjct  124  KFGQPKGFAYVEFLEQEAVQEALQLNESELHGRQLKVMVKRTNVPGMKQYRPRRFNPYLA  183

Query  381  FRSRR  367
            +  RR
Sbjct  184  YGYRR  188



>emb|CDX91567.1| BnaC02g15930D [Brassica napus]
Length=228

 Score =   201 bits (510),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            E +M   QDP++A  S AEKEEVD RSIYVGNVDYACTPEEVQQHFQS GTVNRVTILTD
Sbjct  81   ENDMAAAQDPSSA-ISAAEKEEVDLRSIYVGNVDYACTPEEVQQHFQSFGTVNRVTILTD  139

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRR-FNPYA  385
            KFGQPKG+AYVEFVE E +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QFRGRR F P  
Sbjct  140  KFGQPKGFAYVEFVEEEAVQNSLVLNESELHGRQIKVSAKRTNVPGMRQFRGRRPFRPMR  199

Query  384  GF  379
            GF
Sbjct  200  GF  201



>ref|XP_011465382.1| PREDICTED: polyadenylate-binding protein 2-like [Fragaria vesca 
subsp. vesca]
Length=213

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM+  QDP   + SQA KE  D  S+YVGNVDYACTPEEV QHF+SCGTVNRVTI TDK
Sbjct  61   KEMSSAQDPATGAVSQANKEVADECSVYVGNVDYACTPEEVPQHFESCGTVNRVTIPTDK  120

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGF  379
            FGQPKGYAYVEF+E E +Q AL LNESELHGRQLKV  KRTNVPGMKQFR RRFNPY G+
Sbjct  121  FGQPKGYAYVEFLEAEAVQKALALNESELHGRQLKVLPKRTNVPGMKQFRPRRFNPYMGY  180

Query  378  RSRR  367
              RR
Sbjct  181  SFRR  184



>gb|KHG28448.1| Polyadenylate-binding 2 [Gossypium arboreum]
 gb|KJB79640.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=195

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP AA+  SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T
Sbjct  43   EKEMGSVQDPAAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQTCGTVNRVTIRT  102

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  DKYGQPKGYAYVEFVEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  161



>ref|XP_010027917.1| PREDICTED: polyadenylate-binding protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54561.1| hypothetical protein EUGRSUZ_I00520 [Eucalyptus grandis]
Length=217

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM    DP +A+ASQA KEEVD RS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  68   EKEM----DPASAAASQASKEEVDTRSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKG+AYVEF+EVE IQ ALLLNESELHGRQLKV  KRTNVPGMKQ+  RRFNPYA 
Sbjct  124  KFGHPKGFAYVEFLEVEAIQEALLLNESELHGRQLKVLPKRTNVPGMKQYFPRRFNPYAS  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>gb|KJB79638.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=194

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP AA+  SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T
Sbjct  42   EKEMGSVQDPAAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQTCGTVNRVTIRT  101

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  102  DKYGQPKGYAYVEFVEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  160



>ref|XP_004248796.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=196

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQDP AA+A+QA KEEVD+RS++VGNVDY+CTPEEVQQHFQ+CG VNRVTI T+
Sbjct  42   EKEMGSVQDPAAAAANQANKEEVDSRSVFVGNVDYSCTPEEVQQHFQACGMVNRVTIRTN  101

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKGYAYVEFVE E +Q ALLLNESELHGRQLKVSAKRTNVPGMK +R RR N Y G
Sbjct  102  KFGQPKGYAYVEFVESEAVQEALLLNESELHGRQLKVSAKRTNVPGMKPYRARRPNLYMG  161

Query  381  FRSR  370
            FR R
Sbjct  162  FRGR  165



>gb|KJB79639.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=183

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP AA+  SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T
Sbjct  43   EKEMGSVQDPAAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQTCGTVNRVTIRT  102

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  DKYGQPKGYAYVEFVEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  161



>gb|KJB79637.1| hypothetical protein B456_013G060100 [Gossypium raimondii]
Length=195

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAAS-ASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP AA+  SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T
Sbjct  43   EKEMGSVQDPAAAAATSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQTCGTVNRVTIRT  102

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTN+PGMKQ+R RR NP+
Sbjct  103  DKYGQPKGYAYVEFVEAEAVQEALLLNESELHGRQLKVTAKRTNIPGMKQYRPRRSNPF  161



>gb|EYU39126.1| hypothetical protein MIMGU_mgv1a012968mg [Erythranthe guttata]
Length=234

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            ++E+  VQDP AA+A Q  KEEVDARSI+VGNVDY+CTPEEVQQHFQ+CGTVNRVTI T+
Sbjct  79   DQEIGAVQDPAAAAADQTNKEEVDARSIFVGNVDYSCTPEEVQQHFQACGTVNRVTIRTN  138

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            K+GQPKGYAYVEF+E E +  A+LLNESELHGRQLK+SAKRTNVPGMK FR RR NPY G
Sbjct  139  KYGQPKGYAYVEFLEPEAVDQAILLNESELHGRQLKISAKRTNVPGMKIFRPRRSNPYMG  198

Query  381  FRSR  370
             RSR
Sbjct  199  SRSR  202



>ref|NP_001190512.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
 gb|AED96040.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
Length=142

 Score =   194 bits (494),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = -2

Query  711  NAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAY  532
            +    S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG+AY
Sbjct  3    HGGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAY  62

Query  531  VEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQF--RGRRFNPYAGF  379
            VEFVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QF  RGR F P  GF
Sbjct  63   VEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPMRGF  115



>ref|XP_011043113.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=199

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 110/125 (88%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP+A++A+    +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGTVNRVTI +
Sbjct  45   EKEMGSVQDPSASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTVNRVTIRS  104

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK+GQPKGYAYVEFVE E +Q ALLLNESELHGRQLKV+AKRTNVPGMKQFR RR +PY 
Sbjct  105  DKYGQPKGYAYVEFVEPEAVQEALLLNESELHGRQLKVTAKRTNVPGMKQFRARRPSPYM  164

Query  384  GFRSR  370
            GF  R
Sbjct  165  GFPPR  169



>ref|XP_006288515.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
 gb|EOA21413.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
Length=238

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            E +M   QDP ++ A+  E KEEVDARS+YVGNVDY+CTPEEVQ HFQ+CGTVNRVTIL 
Sbjct  99   ESDMAATQDPASSMATNQEGKEEVDARSVYVGNVDYSCTPEEVQLHFQTCGTVNRVTILM  158

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DKFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  
Sbjct  159  DKFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSM  218

Query  384  GFRSRR  367
            G+R RR
Sbjct  219  GYRFRR  224



>ref|XP_006492630.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Citrus 
sinensis]
Length=196

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  735  EMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF  556
            EM   QDP A  +SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TDKF
Sbjct  45   EMASKQDPGAGGSSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKF  104

Query  555  GQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            GQPKGYAYVEF++ E +Q AL LNESELHGRQLKV+ KRTNVPGMKQ R RR NP+  ++
Sbjct  105  GQPKGYAYVEFLQSEAVQEALHLNESELHGRQLKVTVKRTNVPGMKQHRPRRPNPFMVYQ  164

Query  375  SR  370
            SR
Sbjct  165  SR  166



>ref|XP_001784990.1| predicted protein [Physcomitrella patens]
 gb|EDQ50211.1| predicted protein [Physcomitrella patens]
Length=216

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM  VQD      S   +EE DARS++VGNVDY+CTPEEVQQHFQSCGTVNRVTILTD
Sbjct  73   EKEMGAVQDSVGKDGSATNREEADARSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTILTD  132

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEF+EVE +QNA+LL+ESELH R LKV+AKRTNVPGMK +RGR   PY G
Sbjct  133  KFGQPKGFAYVEFLEVEAVQNAILLSESELHNRPLKVTAKRTNVPGMKAYRGR---PYYG  189

Query  381  FRSRR  367
            +RSRR
Sbjct  190  YRSRR  194



>ref|XP_004964965.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Setaria 
italica]
Length=204

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 104/119 (87%), Gaps = 3/119 (3%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM GV DPNA ++    KEE+DARS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDK
Sbjct  61   KEMQGV-DPNATTSEN--KEEMDARSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDK  117

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            FGQPKG+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY G
Sbjct  118  FGQPKGFAYVEFVEVEAVQEAVKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPYHG  176



>ref|XP_006288516.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
 gb|EOA21414.1| hypothetical protein CARUB_v10001786mg, partial [Capsella rubella]
Length=253

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            E +M   QDP ++ A+  E KEEVDARS+YVGNVDY+CTPEEVQ HFQ+CGTVNRVTIL 
Sbjct  99   ESDMAATQDPASSMATNQEGKEEVDARSVYVGNVDYSCTPEEVQLHFQTCGTVNRVTILM  158

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DKFGQPKG+AYVEFVEVE +Q AL LNESELHGRQLKVS KRTNVPGMKQ+   RFNP  
Sbjct  159  DKFGQPKGFAYVEFVEVEAVQEALQLNESELHGRQLKVSPKRTNVPGMKQYHPGRFNPSM  218

Query  384  GFRSRR  367
            G+R RR
Sbjct  219  GYRFRR  224



>ref|XP_004964966.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Setaria 
italica]
Length=202

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 104/119 (87%), Gaps = 3/119 (3%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM GV DPNA ++    KEE+DARS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDK
Sbjct  59   KEMQGV-DPNATTSEN--KEEMDARSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDK  115

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            FGQPKG+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY G
Sbjct  116  FGQPKGFAYVEFVEVEAVQEAVKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPYHG  174



>ref|XP_010318196.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318197.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318198.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Solanum 
lycopersicum]
Length=192

 Score =   194 bits (494),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  708  AASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAYV  529
             AS++Q EKEEVD+RSIYVGNVDYAC P EVQQHFQ CGTVNRVTILTDK G+PKG+AYV
Sbjct  24   TASSTQDEKEEVDSRSIYVGNVDYACKPGEVQQHFQVCGTVNRVTILTDKLGRPKGFAYV  83

Query  528  EFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSRR  367
            EF E E ++NALLLNESEL GR+LKVSAKRTNVPGM QFRG RFNPYAGFR RR
Sbjct  84   EFFERESVKNALLLNESELLGRKLKVSAKRTNVPGMNQFRGGRFNPYAGFRPRR  137



>ref|XP_006399527.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
 gb|ESQ40980.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
Length=202

 Score =   194 bits (494),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QD  +    QA KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKDMGAAQDSASTETDQAVKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNE+ELHGRQLKV  KRTNVPGMKQ+R   FNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAMQEALQLNETELHGRQLKVLPKRTNVPGMKQYRPGGFNPSIG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>ref|XP_011003863.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Populus 
euphratica]
Length=199

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  +QDP+A++A+    +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGT+NRVTI +
Sbjct  45   EKEMGSIQDPSASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTINRVTIRS  104

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+ KRTN+PGMKQFR RR NPY 
Sbjct  105  DKYGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVTVKRTNLPGMKQFRARRPNPYM  164

Query  384  GFRSR  370
            GF  R
Sbjct  165  GFPPR  169



>ref|XP_011003864.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Populus 
euphratica]
Length=197

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAE-KEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  +QDP+A++A+    +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGT+NRVTI +
Sbjct  43   EKEMGSIQDPSASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTINRVTIRS  102

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+ KRTN+PGMKQFR RR NPY 
Sbjct  103  DKYGQPKGYAYVEFLEPEAVQEALLLNESELHGRQLKVTVKRTNLPGMKQFRARRPNPYM  162

Query  384  GFRSR  370
            GF  R
Sbjct  163  GFPPR  167



>gb|ACF87534.1| unknown [Zea mays]
 gb|ACG33217.1| polyadenylate-binding protein 2 [Zea mays]
Length=203

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 104/119 (87%), Gaps = 3/119 (3%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM GV DPNA ++    KEE+D+RS+++GNVDYACTPEEVQQHF SCGTVNRVTILTDK
Sbjct  60   KEMQGV-DPNATTSEN--KEEMDSRSVFIGNVDYACTPEEVQQHFNSCGTVNRVTILTDK  116

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            FGQPKG+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY G
Sbjct  117  FGQPKGFAYVEFVEVEAVQEAIKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPYHG  175



>ref|XP_002436725.1| hypothetical protein SORBIDRAFT_10g007620 [Sorghum bicolor]
 gb|EER88092.1| hypothetical protein SORBIDRAFT_10g007620 [Sorghum bicolor]
Length=203

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 104/119 (87%), Gaps = 3/119 (3%)
 Frame = -2

Query  738  KEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK  559
            KEM GV DPNA ++    KEE+D+RS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDK
Sbjct  60   KEMQGV-DPNATTSEN--KEEMDSRSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDK  116

Query  558  FGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            FGQPKG+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY G
Sbjct  117  FGQPKGFAYVEFVEVEAVQEAVKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPYHG  175



>ref|NP_001190511.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
 gb|AED96039.1| polyadenylate-binding protein 1 [Arabidopsis thaliana]
Length=265

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 2/111 (2%)
 Frame = -2

Query  705  ASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGYAYVE  526
            +  S AEKEEVD+RSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKG+AYVE
Sbjct  128  SGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGFAYVE  187

Query  525  FVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQF--RGRRFNPYAGF  379
            FVEVE +QN+L+LNESELHGRQ+KVSAKRTNVPGM+QF  RGR F P  GF
Sbjct  188  FVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFRGRGRPFRPMRGF  238



>ref|XP_006399528.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
 gb|ESQ40981.1| hypothetical protein EUTSA_v10014635mg [Eutrema salsugineum]
Length=217

 Score =   194 bits (494),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EK+M   QD  +    QA KEEVDARS+YVGNVDYACTPEEVQ HFQ+CGTVNRVTIL D
Sbjct  64   EKDMGAAQDSASTETDQAVKEEVDARSVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMD  123

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFGQPKG+AYVEFVEVE +Q AL LNE+ELHGRQLKV  KRTNVPGMKQ+R   FNP  G
Sbjct  124  KFGQPKGFAYVEFVEVEAMQEALQLNETELHGRQLKVLPKRTNVPGMKQYRPGGFNPSIG  183

Query  381  FRSRR  367
            +R RR
Sbjct  184  YRFRR  188



>ref|XP_001766601.1| predicted protein [Physcomitrella patens]
 gb|EDQ68666.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 105/125 (84%), Gaps = 2/125 (2%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM G Q     +  QA +EE DARS++VGNVDYACTPEEVQQHFQSCGTVNRVTILTD
Sbjct  73   EKEMGGSQ--ALTNGDQANREEADARSVFVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  130

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            KFG PKGYAYVEF+EVE +QNA+LL+ESELH R +KV+AKRTNVPGMK +RGR + PY G
Sbjct  131  KFGSPKGYAYVEFLEVEAVQNAILLSESELHNRPIKVTAKRTNVPGMKGYRGRPYAPYYG  190

Query  381  FRSRR  367
            +R RR
Sbjct  191  YRPRR  195



>ref|NP_001149957.1| polyadenylate-binding protein 2 [Zea mays]
 gb|ACG37339.1| polyadenylate-binding protein 2 [Zea mays]
Length=199

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  723  VQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPK  544
            +QDPNA ++    KEE+D+RS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDKFGQPK
Sbjct  62   MQDPNATTSEN--KEEMDSRSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDKFGQPK  119

Query  543  GYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            G+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTN+PGMKQ RGR FNPY
Sbjct  120  GFAYVEFVEVEAVQEAIKLNESELHGRQLKVAPKRTNIPGMKQLRGRGFNPY  171



>gb|KDO50217.1| hypothetical protein CISIN_1g029268mg [Citrus sinensis]
Length=176

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  735  EMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF  556
            EM   QDP A  +S A +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TDKF
Sbjct  25   EMASKQDPAAGGSSLANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKF  84

Query  555  GQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            GQPKGYAYVEF++ E +Q AL LNESELHGRQLKV+ KRTNVPGMKQ R RR NP+  ++
Sbjct  85   GQPKGYAYVEFLQSEAVQEALHLNESELHGRQLKVTVKRTNVPGMKQHRPRRPNPFMVYQ  144

Query  375  SR  370
            SR
Sbjct  145  SR  146



>ref|XP_004964967.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Setaria 
italica]
Length=202

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 101/114 (89%), Gaps = 2/114 (2%)
 Frame = -2

Query  723  VQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPK  544
            +QDPNA ++    KEE+DARS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDKFGQPK
Sbjct  63   MQDPNATTSEN--KEEMDARSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDKFGQPK  120

Query  543  GYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
            G+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY G
Sbjct  121  GFAYVEFVEVEAVQEAVKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPYHG  174



>gb|KDO50216.1| hypothetical protein CISIN_1g029268mg [Citrus sinensis]
Length=196

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  735  EMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKF  556
            EM   QDP A  +S A +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TDKF
Sbjct  45   EMASKQDPAAGGSSLANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKF  104

Query  555  GQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFR  376
            GQPKGYAYVEF++ E +Q AL LNESELHGRQLKV+ KRTNVPGMKQ R RR NP+  ++
Sbjct  105  GQPKGYAYVEFLQSEAVQEALHLNESELHGRQLKVTVKRTNVPGMKQHRPRRPNPFMVYQ  164

Query  375  SR  370
            SR
Sbjct  165  SR  166



>gb|ACR34224.1| unknown [Zea mays]
 gb|AFW85286.1| polyadenylate-binding protein 2 [Zea mays]
Length=199

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  723  VQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPK  544
            +QDPNA ++    KEE+D+RS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDKFGQPK
Sbjct  62   MQDPNATTSEN--KEEMDSRSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDKFGQPK  119

Query  543  GYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            G+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY
Sbjct  120  GFAYVEFVEVEAVQEAIKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPY  171



>ref|XP_002300187.2| hypothetical protein POPTR_0001s31900g [Populus trichocarpa]
 gb|EEE84992.2| hypothetical protein POPTR_0001s31900g [Populus trichocarpa]
Length=246

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 109/125 (87%), Gaps = 1/125 (1%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQA-EKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILT  565
            EKEM  VQDP+A++A+    +EEVD+RS++VGNVDY+CTPEEVQQHFQ+CGT+NR+TI +
Sbjct  92   EKEMGSVQDPSASAAASQANREEVDSRSVFVGNVDYSCTPEEVQQHFQACGTINRITIRS  151

Query  564  DKFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYA  385
            DK+GQPKGYAYVEF+E E +Q ALLLNESELHGRQLKV+ KRTN+PGMKQFR RR NPY 
Sbjct  152  DKYGQPKGYAYVEFLEPETVQEALLLNESELHGRQLKVTVKRTNLPGMKQFRARRPNPYM  211

Query  384  GFRSR  370
            GF  R
Sbjct  212  GFPPR  216



>ref|XP_008658656.1| PREDICTED: polyadenylate-binding protein 2 isoform X1 [Zea mays]
Length=227

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 2/112 (2%)
 Frame = -2

Query  723  VQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPK  544
            +QDPNA ++    KEE+D+RS++VGNVDYACTPEEVQQHF SCGTVNRVTILTDKFGQPK
Sbjct  90   MQDPNATTSEN--KEEMDSRSVFVGNVDYACTPEEVQQHFNSCGTVNRVTILTDKFGQPK  147

Query  543  GYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPY  388
            G+AYVEFVEVE +Q A+ LNESELHGRQLKV+ KRTNVPGMKQ RGR FNPY
Sbjct  148  GFAYVEFVEVEAVQEAIKLNESELHGRQLKVAPKRTNVPGMKQPRGRGFNPY  199



>ref|XP_006492629.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Citrus 
sinensis]
Length=204

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -2

Query  717  DPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDKFGQPKGY  538
            DP A  +SQA +EEVD+RS++VGNVDY+CTPEEVQQHFQSCGTVNRVTI TDKFGQPKGY
Sbjct  59   DPGAGGSSQANREEVDSRSVFVGNVDYSCTPEEVQQHFQSCGTVNRVTIRTDKFGQPKGY  118

Query  537  AYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAGFRSR  370
            AYVEF++ E +Q AL LNESELHGRQLKV+ KRTNVPGMKQ R RR NP+  ++SR
Sbjct  119  AYVEFLQSEAVQEALHLNESELHGRQLKVTVKRTNVPGMKQHRPRRPNPFMVYQSR  174



>ref|XP_009385630.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=210

 Score =   190 bits (482),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -2

Query  741  EKEMTGVQDPNAASASQAEKEEVDARSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD  562
            EKEM+ +QDP + SAS+  K EVD+RS++VGNVDYACT E V+ HFQS GTVNRVTILTD
Sbjct  57   EKEMSAIQDPASTSASETSKAEVDSRSVFVGNVDYACTSEVVRMHFQSSGTVNRVTILTD  116

Query  561  KFGQPKGYAYVEFVEVEVIQNALLLNESELHGRQLKVSAKRTNVPGMKQFRGRRFNPYAG  382
             FGQPKG+AYVEF+E+E +Q AL LNES LHGR+++V+AKRTN+PG KQFR RRFNPY G
Sbjct  117  TFGQPKGFAYVEFLELEAVQEALKLNESFLHGRRIRVTAKRTNIPGKKQFRPRRFNPYMG  176

Query  381  FRSRR  367
               RR
Sbjct  177  RPVRR  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210