BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013J20

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004973949.1|  PREDICTED: methyltransferase-like protein 13...  63.2    9e-09   Setaria italica
ref|XP_010938164.1|  PREDICTED: endothelin-converting enzyme 2        63.2    1e-08   Elaeis guineensis
ref|XP_002445848.1|  hypothetical protein SORBIDRAFT_07g026860        62.0    3e-08   Sorghum bicolor [broomcorn]
ref|XP_002265997.1|  PREDICTED: methyltransferase-like protein 13...  61.6    3e-08   Vitis vinifera
ref|XP_002519302.1|  S-adenosylmethionine-dependent methyltransfe...  61.6    3e-08   Ricinus communis
ref|XP_010672622.1|  PREDICTED: methyltransferase-like protein 13     61.2    5e-08   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY69882.1|  BnaCnng65760D                                        60.8    7e-08   Brassica napus [oilseed rape]
ref|XP_009114089.1|  PREDICTED: methyltransferase-like protein 13     60.5    8e-08   Brassica rapa
ref|NP_566574.1|  S-adenosyl-L-methionine-dependent methyltransfe...  60.5    9e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KDP27990.1|  hypothetical protein JCGZ_19070                       60.8    1e-07   Jatropha curcas
ref|XP_010487617.1|  PREDICTED: uncharacterized protein LOC104765...  57.8    1e-07   Camelina sativa [gold-of-pleasure]
emb|CDX75912.1|  BnaC03g39950D                                        60.1    1e-07   
dbj|BAB02741.1|  unnamed protein product                              61.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY48692.1|  BnaCnng16690D                                        59.7    2e-07   Brassica napus [oilseed rape]
ref|XP_010487616.1|  PREDICTED: uncharacterized protein LOC104765...  57.8    2e-07   Camelina sativa [gold-of-pleasure]
ref|NP_001189917.1|  S-adenosyl-L-methionine-dependent methyltran...  60.1    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135524.1|  PREDICTED: methyltransferase-like protein 13     59.3    2e-07   Brassica rapa
ref|XP_006406738.1|  hypothetical protein EUTSA_v10021424mg           59.3    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_010505438.1|  PREDICTED: methyltransferase-like protein 13...  58.9    3e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010465786.1|  PREDICTED: methyltransferase-like protein 13...  58.9    3e-07   Camelina sativa [gold-of-pleasure]
gb|KFK39077.1|  hypothetical protein AALP_AA3G197500                  58.9    3e-07   Arabis alpina [alpine rockcress]
ref|XP_010465784.1|  PREDICTED: methyltransferase-like protein 13...  58.9    4e-07   Camelina sativa [gold-of-pleasure]
ref|XP_007223746.1|  hypothetical protein PRUPE_ppa010512mg           58.5    4e-07   Prunus persica
ref|XP_002885207.1|  hypothetical protein ARALYDRAFT_898077           58.5    4e-07   Arabidopsis lyrata subsp. lyrata
ref|XP_006298441.1|  hypothetical protein CARUB_v10014513mg           58.5    5e-07   Capsella rubella
ref|NP_001132547.1|  uncharacterized protein LOC100194012             58.5    5e-07   Zea mays [maize]
ref|XP_006488757.1|  PREDICTED: methyltransferase-like protein 13...  58.2    6e-07   Citrus sinensis [apfelsine]
ref|XP_004147623.1|  PREDICTED: methyltransferase-like protein 13...  58.2    6e-07   Cucumis sativus [cucumbers]
ref|XP_006660284.1|  PREDICTED: methyltransferase-like protein 13...  57.4    7e-07   
emb|CDO98708.1|  unnamed protein product                              57.8    8e-07   Coffea canephora [robusta coffee]
ref|XP_008793315.1|  PREDICTED: methyltransferase-like protein 13     57.4    1e-06   
ref|XP_009417774.1|  PREDICTED: methyltransferase-like protein 13     57.4    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004297100.1|  PREDICTED: methyltransferase-like protein 13     57.4    1e-06   Fragaria vesca subsp. vesca
ref|XP_008438982.1|  PREDICTED: methyltransferase-like protein 13...  57.0    2e-06   
ref|XP_010235322.1|  PREDICTED: methyltransferase-like protein 13...  56.6    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_010235321.1|  PREDICTED: methyltransferase-like protein 13...  56.6    2e-06   Brachypodium distachyon [annual false brome]
ref|XP_011011501.1|  PREDICTED: methyltransferase-like protein 13     56.6    2e-06   Populus euphratica
ref|XP_008390504.1|  PREDICTED: methyltransferase-like protein 13     55.5    5e-06   
ref|XP_010270938.1|  PREDICTED: methyltransferase-like protein 13...  55.5    6e-06   Nelumbo nucifera [Indian lotus]
ref|XP_007035953.1|  S-adenosyl-L-methionine-dependent methyltran...  55.8    6e-06   
dbj|BAD09975.1|  unknown protein                                      55.1    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002316072.1|  hypothetical protein POPTR_0010s16300g           55.1    9e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009372047.1|  PREDICTED: methyltransferase-like protein 13     55.1    9e-06   
gb|EEC83886.1|  hypothetical protein OsI_29891                        55.1    9e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_007035954.1|  S-adenosyl-L-methionine-dependent methyltran...  55.5    9e-06   
ref|XP_006419271.1|  hypothetical protein CICLE_v10005764mg           54.7    1e-05   Citrus clementina [clementine]
ref|XP_003594886.1|  Methyltransferase-like protein                   54.3    1e-05   Medicago truncatula
gb|KCW61370.1|  hypothetical protein EUGRSUZ_H04109                   53.1    2e-05   Eucalyptus grandis [rose gum]
dbj|BAJ96913.1|  predicted protein                                    54.7    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB28819.1|  hypothetical protein B456_005G071000                  53.9    2e-05   Gossypium raimondii
ref|XP_003546391.1|  PREDICTED: methyltransferase-like protein 13...  53.9    2e-05   Glycine max [soybeans]
gb|AFK47960.1|  unknown                                               53.5    3e-05   Medicago truncatula
gb|EMT31220.1|  Methyltransferase-like protein 13                     53.5    3e-05   
ref|XP_010465787.1|  PREDICTED: methyltransferase-like protein 13...  53.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010024858.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...  53.5    3e-05   
gb|KCW61369.1|  hypothetical protein EUGRSUZ_H04109                   53.1    3e-05   Eucalyptus grandis [rose gum]
ref|XP_010555151.1|  PREDICTED: methyltransferase-like protein 13...  53.1    3e-05   Tarenaya hassleriana [spider flower]
gb|KJB28820.1|  hypothetical protein B456_005G071000                  53.1    4e-05   Gossypium raimondii
ref|XP_006597757.1|  PREDICTED: methyltransferase-like protein 13...  53.1    4e-05   Glycine max [soybeans]
ref|XP_010555152.1|  PREDICTED: methyltransferase-like protein 13...  52.8    5e-05   Tarenaya hassleriana [spider flower]
gb|KHN26616.1|  Methyltransferase-like protein 13                     52.8    5e-05   Glycine soja [wild soybean]
ref|XP_008438981.1|  PREDICTED: methyltransferase-like protein 13...  52.8    6e-05   Cucumis melo [Oriental melon]
gb|KHN47725.1|  Methyltransferase-like protein 13                     52.0    1e-04   Glycine soja [wild soybean]
ref|XP_006597756.1|  PREDICTED: methyltransferase-like protein 13...  52.0    1e-04   
gb|ACJ84630.1|  unknown                                               51.6    1e-04   Medicago truncatula
ref|XP_009359766.1|  PREDICTED: methyltransferase-like protein 13     51.6    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_009349214.1|  PREDICTED: methyltransferase-like protein 13     51.6    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_007138845.1|  hypothetical protein PHAVU_009G242300g           51.6    1e-04   Phaseolus vulgaris [French bean]
ref|XP_009391525.1|  PREDICTED: methyltransferase-like protein 13     51.2    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK45927.1|  unknown                                               50.4    3e-04   Lotus japonicus
ref|XP_011100681.1|  PREDICTED: methyltransferase-like protein 13...  50.1    4e-04   



>ref|XP_004973949.1| PREDICTED: methyltransferase-like protein 13-like [Setaria italica]
Length=242

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            S++Q KWELT P+ LD D +SV SVLGP P VHYIYVCVK N
Sbjct  187  SANQDKWELTKPLPLDDDNASVVSVLGPKPDVHYIYVCVKGN  228



>ref|XP_010938164.1| PREDICTED: endothelin-converting enzyme 2 [Elaeis guineensis]
Length=243

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQIKN  217
            SS Q+ WELT P+ L++D SSV +VLG NP VHYIYVC KD +L       +++
Sbjct  190  SSEQKTWELTRPLPLNEDGSSVAAVLGTNPEVHYIYVCTKDQSLRQNQNEGVEH  243



>ref|XP_002445848.1| hypothetical protein SORBIDRAFT_07g026860 [Sorghum bicolor]
 gb|EES15343.1| hypothetical protein SORBIDRAFT_07g026860 [Sorghum bicolor]
Length=244

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            SS+Q KWELT P+ LD D +S+ ++LGP P VHYIYVCVK N
Sbjct  189  SSNQNKWELTKPLPLDDDSTSLVALLGPKPDVHYIYVCVKGN  230



>ref|XP_002265997.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Vitis 
vinifera]
 emb|CBI25999.3| unnamed protein product [Vitis vinifera]
Length=230

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  381  GSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
              +  Q WELT+P+ LD + SSVE+VLG NP VHYIY+C+KD++
Sbjct  187  AKTEHQTWELTNPVPLDDEGSSVEAVLGKNPDVHYIYICIKDDS  230



>ref|XP_002519302.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF43166.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=243

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  381  GSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQ  226
            G S    WELT+P+ L+ D SSVE+ LG NP VHYIY+C KD +L++  K +
Sbjct  189  GDSEHPVWELTNPVPLNDDGSSVEAALGKNPDVHYIYICTKDESLKAGQKPE  240



>ref|XP_010672622.1| PREDICTED: methyltransferase-like protein 13 [Beta vulgaris subsp. 
vulgaris]
Length=244

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  369  QQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTL  247
            QQKWELT P+ LD+   S+E  +G NP VHYIYVC KD++L
Sbjct  193  QQKWELTKPVPLDQKEKSIEDFIGSNPDVHYIYVCTKDDSL  233



>emb|CDY69882.1| BnaCnng65760D [Brassica napus]
Length=240

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  396  DKVPTGSSHQQ-KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            DK  TG   +  KWELT PI LD + SSVES +G +P VHYIYVC+KD  L++   A
Sbjct  183  DKSLTGQPLETPKWELTKPIPLDDEGSSVESAIGKSPDVHYIYVCIKDEALKTETDA  239



>ref|XP_009114089.1| PREDICTED: methyltransferase-like protein 13 [Brassica rapa]
Length=240

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 1/57 (2%)
 Frame = -2

Query  396  DKVPTGSSHQQ-KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            DK  TG   +  KWELT PI LD + SSVES +G +P VHYIYVC+KD  L++   A
Sbjct  183  DKSLTGQPLETPKWELTKPIPLDDEGSSVESAIGKSPDVHYIYVCIKDEALKTETDA  239



>ref|NP_566574.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK93650.1| unknown protein [Arabidopsis thaliana]
 gb|AAM67530.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75944.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=239

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
            KWELT P+ LD D SSVES +G NP VHYIYVC+KD +
Sbjct  194  KWELTKPLPLDADGSSVESAIGKNPDVHYIYVCIKDES  231



>gb|KDP27990.1| hypothetical protein JCGZ_19070 [Jatropha curcas]
Length=268

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHK  232
            WELT+P+ LD D +S E+ LG NP VHYIYVC KD +++S  K
Sbjct  200  WELTNPVPLDDDGNSAEAALGKNPDVHYIYVCTKDESMKSAQK  242



>ref|XP_010487617.1| PREDICTED: uncharacterized protein LOC104765581 isoform X2 [Camelina 
sativa]
Length=99

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            S   KWEL +P+ LD + SSVES +G +P VHYIYVC+KD +L+    A
Sbjct  50   SETPKWELATPLPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMEADA  98



>emb|CDX75912.1| BnaC03g39950D [Brassica napus]
Length=236

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  369  QQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
             Q WELT PI LD + SSVES LG +P VHYIYVC+KD +L+
Sbjct  189  HQPWELTKPIPLDAEGSSVESALGKSPDVHYIYVCIKDESLK  230



>dbj|BAB02741.1| unnamed protein product [Arabidopsis thaliana]
Length=419

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
            KWELT P+ LD D SSVES +G NP VHYIYVC+KD +
Sbjct  374  KWELTKPLPLDADGSSVESAIGKNPDVHYIYVCIKDES  411



>emb|CDY48692.1| BnaCnng16690D [Brassica napus]
Length=240

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            KWELT PI LD + SSVES +G +P VHYIYVC+KD  L++   A
Sbjct  195  KWELTKPIPLDDEGSSVESAIGKSPDVHYIYVCIKDAALKTETDA  239



>ref|XP_010487616.1| PREDICTED: uncharacterized protein LOC104765581 isoform X1 [Camelina 
sativa]
Length=122

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            S   KWEL +P+ LD + SSVES +G +P VHYIYVC+KD +L+    A
Sbjct  73   SETPKWELATPLPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMEADA  121



>ref|NP_001189917.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEE75945.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=277

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
            KWELT P+ LD D SSVES +G NP VHYIYVC+KD +
Sbjct  232  KWELTKPLPLDADGSSVESAIGKNPDVHYIYVCIKDES  269



>ref|XP_009135524.1| PREDICTED: methyltransferase-like protein 13 [Brassica rapa]
 emb|CDX82372.1| BnaA03g34490D [Brassica napus]
Length=236

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  390  VPTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            +   S    KWELT PI LD + SSVES +G +P VHYIYVC+KD +L+
Sbjct  182  IDKSSLETSKWELTKPIPLDTEGSSVESAIGKSPDVHYIYVCIKDESLK  230



>ref|XP_006406738.1| hypothetical protein EUTSA_v10021424mg [Eutrema salsugineum]
 gb|ESQ48191.1| hypothetical protein EUTSA_v10021424mg [Eutrema salsugineum]
Length=239

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            KWELT PIALD +  SVES +G +P VHYIYVC KD +L+
Sbjct  194  KWELTKPIALDAEEDSVESAIGKSPDVHYIYVCTKDESLK  233



>ref|XP_010505438.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
Length=240

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            S   KWELT P+ LD + SSVES +G +P VHYIYVC+KD +L+    A
Sbjct  191  SETPKWELTKPLPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMEADA  239



>ref|XP_010465786.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Camelina 
sativa]
Length=240

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            KWELT P+ LD + SSVES +G +P VHYIYVC+KD +L+    A
Sbjct  195  KWELTKPVPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMEADA  239



>gb|KFK39077.1| hypothetical protein AALP_AA3G197500 [Arabis alpina]
Length=239

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            KWELT PI LD + SSVES +G +P VHYIYVC KD +L++   A
Sbjct  194  KWELTQPIPLDAEGSSVESAIGTSPDVHYIYVCTKDESLKTDADA  238



>ref|XP_010465784.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
 ref|XP_010465785.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Camelina 
sativa]
Length=247

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            KWELT P+ LD + SSVES +G +P VHYIYVC+KD +L+    A
Sbjct  202  KWELTKPVPLDAEGSSVESAIGKSPDVHYIYVCIKDESLKMEADA  246



>ref|XP_007223746.1| hypothetical protein PRUPE_ppa010512mg [Prunus persica]
 ref|XP_008223460.1| PREDICTED: methyltransferase-like protein 13 [Prunus mume]
 gb|EMJ24945.1| hypothetical protein PRUPE_ppa010512mg [Prunus persica]
Length=247

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            WELT+P+ L+ D SS E +LG NP VHYIYVC KDN+L+
Sbjct  199  WELTNPVPLNDDGSSAEELLGNNPDVHYIYVCAKDNSLK  237



>ref|XP_002885207.1| hypothetical protein ARALYDRAFT_898077 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61466.1| hypothetical protein ARALYDRAFT_898077 [Arabidopsis lyrata subsp. 
lyrata]
Length=239

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            KWELT P+ LD + SSVES +G +P VHYIYVC+KD +L+
Sbjct  194  KWELTKPLPLDAEGSSVESAIGKSPDVHYIYVCIKDESLK  233



>ref|XP_006298441.1| hypothetical protein CARUB_v10014513mg [Capsella rubella]
 gb|EOA31339.1| hypothetical protein CARUB_v10014513mg [Capsella rubella]
Length=239

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            KWELT P+ LD + SSVES +G +P VHYIYVC+KD +L+
Sbjct  193  KWELTKPLPLDDEGSSVESAIGKSPDVHYIYVCIKDESLK  232



>ref|NP_001132547.1| uncharacterized protein LOC100194012 [Zea mays]
 gb|ACF81433.1| unknown [Zea mays]
 gb|ACG27198.1| methylase [Zea mays]
 gb|ACG34978.1| methylase [Zea mays]
 tpg|DAA48111.1| TPA: methylase [Zea mays]
Length=244

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            SS+Q KWELT P+ L+   +S+ ++LGP P VHYIYVCVK N
Sbjct  189  SSNQNKWELTKPLPLEDHSTSLAALLGPKPDVHYIYVCVKGN  230



>ref|XP_006488757.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Citrus sinensis]
 gb|KDO72134.1| hypothetical protein CISIN_1g026558mg [Citrus sinensis]
Length=237

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHK  232
            WELT+P+ L+ D  SVE +LG NP VHYIYVC KD +L++  K
Sbjct  195  WELTNPVPLENDGRSVEELLGKNPDVHYIYVCTKDESLKTSSK  237



>ref|XP_004147623.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 ref|XP_004164476.1| PREDICTED: methyltransferase-like protein 13-like [Cucumis sativus]
 gb|KGN57199.1| hypothetical protein Csa_3G171070 [Cucumis sativus]
Length=241

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQI  223
            KW+L  P+  D DV ++E++LG NP +HY+Y+C KD++L++  K ++
Sbjct  192  KWDLLKPVPFDNDVRTLETMLGQNPDIHYVYICTKDSSLKTDEKHEV  238



>ref|XP_006660284.1| PREDICTED: methyltransferase-like protein 13-like, partial [Oryza 
brachyantha]
Length=196

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 5/54 (9%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT-----LESRHKA  229
            S +  WELT P+ LD D +SV S+LGP P VHYIYVC+K +      L+SR +A
Sbjct  138  SREPSWELTKPLPLDGDSTSVVSILGPKPDVHYIYVCIKGSDDGKSHLDSRAEA  191



>emb|CDO98708.1| unnamed protein product [Coffea canephora]
Length=251

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLES  241
            +S  ++W+LT P+ LD D  S E+VLG NP VHYIYVC+KD   ES
Sbjct  204  TSQCREWDLTFPVPLDDDGISTEAVLGKNPDVHYIYVCIKDKKHES  249



>ref|XP_008793315.1| PREDICTED: methyltransferase-like protein 13 [Phoenix dactylifera]
Length=243

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            SS Q+ WELT P+ L++D SSV +++G N  VHYIYVC+K+ +L 
Sbjct  190  SSEQKTWELTRPLPLNEDGSSVAAIIGANNEVHYIYVCIKEKSLR  234



>ref|XP_009417774.1| PREDICTED: methyltransferase-like protein 13 [Musa acuminata 
subsp. malaccensis]
Length=245

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -2

Query  378  SSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQ  226
            SS Q+ WEL +P+ L++D SSV +VL  NP VHYIYVC+KD   ESR   Q
Sbjct  187  SSGQKTWELITPLPLNEDGSSVAAVLRSNPEVHYIYVCIKD---ESRRWQQ  234



>ref|XP_004297100.1| PREDICTED: methyltransferase-like protein 13 [Fragaria vesca 
subsp. vesca]
Length=248

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQI  223
            WELT+P+ L+ D SS E++LG NP VH+IY+C KDN+ +   K ++
Sbjct  200  WELTNPVPLNDDGSSAEALLGNNPDVHFIYICTKDNSSKPGFKREV  245



>ref|XP_008438982.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Cucumis 
melo]
Length=241

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQI  223
            KW+L  P+  D DV  +E++LG NP VHYIY+C KD +L++  K  +
Sbjct  192  KWDLLKPVPFDNDVRPLETMLGQNPDVHYIYICTKDCSLKTDQKYDV  238



>ref|XP_010235322.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Brachypodium 
distachyon]
Length=241

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK-DNTLESRHKAQ  226
            S +QKW+LT P+ L  D +S  S+LGP P VHYIYVC+K DN   +  KA+
Sbjct  185  SSKQKWDLTKPLPLHDDSTSTISLLGPKPDVHYIYVCIKGDNGARASSKAE  235



>ref|XP_010235321.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Brachypodium 
distachyon]
Length=242

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK-DNTLESRHKAQ  226
            S +QKW+LT P+ L  D +S  S+LGP P VHYIYVC+K DN   +  KA+
Sbjct  186  SSKQKWDLTKPLPLHDDSTSTISLLGPKPDVHYIYVCIKGDNGARASSKAE  236



>ref|XP_011011501.1| PREDICTED: methyltransferase-like protein 13 [Populus euphratica]
Length=241

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = -2

Query  381  GSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHK  232
            GS H  + ELT+P+ +D + SSVE+VLG NP VHYIYVC KD +L+   K
Sbjct  188  GSRHPVQ-ELTNPVPIDDNGSSVEAVLGKNPDVHYIYVCTKDESLKPEQK  236



>ref|XP_008390504.1| PREDICTED: methyltransferase-like protein 13 [Malus domestica]
Length=246

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLE  244
            W+LT+P+ L  D SS E +LG NP VHYIY+C KDN+L+
Sbjct  198  WDLTNPVPLHGDGSSAEELLGNNPDVHYIYICTKDNSLK  236



>ref|XP_010270938.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270939.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Nelumbo 
nucifera]
Length=235

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -2

Query  390  VPTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKD  256
            V   S   +KWELT P+ LD+   SVE+VLG NP VHYIYVC KD
Sbjct  184  VAERSLEHKKWELTEPVPLDEG-GSVEAVLGKNPEVHYIYVCTKD  227



>ref|XP_007035953.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY06879.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=291

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  387  PTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKD  256
            P GSS Q   ELT+P+ L++  SSVE VLG NP VHYIYVC K+
Sbjct  243  PEGSSEQPIRELTNPVPLEEGGSSVEDVLGKNPDVHYIYVCTKE  286



>dbj|BAD09975.1| unknown protein [Oryza sativa Japonica Group]
Length=241

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            S +  WELT P+ LD D +S+ S+LGP P VHYIYVC+K
Sbjct  192  SREPSWELTKPLPLDGDSTSIVSLLGPKPDVHYIYVCIK  230



>ref|XP_002316072.1| hypothetical protein POPTR_0010s16300g [Populus trichocarpa]
 gb|EEF02243.1| hypothetical protein POPTR_0010s16300g [Populus trichocarpa]
Length=241

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = -2

Query  381  GSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTL--ESRHKAQI  223
            GS H  + EL +P+++D + SSVE+VLG NP VHYIYVC KD +L  E +H+  +
Sbjct  188  GSEHPVQ-ELMNPVSIDDNGSSVEAVLGKNPDVHYIYVCTKDESLTPEQKHEELV  241



>ref|XP_009372047.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=237

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTL  247
            W+LT+P+ L+ D SS E +LG NP VHYIYVC KD++L
Sbjct  200  WDLTNPVPLNDDGSSTEELLGNNPDVHYIYVCTKDDSL  237



>gb|EEC83886.1| hypothetical protein OsI_29891 [Oryza sativa Indica Group]
 gb|EEE68998.1| hypothetical protein OsJ_27938 [Oryza sativa Japonica Group]
Length=249

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            S +  WELT P+ LD D +S+ S+LGP P VHYIYVC+K
Sbjct  192  SREPSWELTKPLPLDGDSTSIVSLLGPKPDVHYIYVCIK  230



>ref|XP_007035954.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
 gb|EOY06880.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2, partial [Theobroma cacao]
Length=294

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  387  PTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            P GSS Q   ELT+P+ L++  SSVE VLG NP VHYIYVC K
Sbjct  243  PEGSSEQPIRELTNPVPLEEGGSSVEDVLGKNPDVHYIYVCTK  285



>ref|XP_006419271.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
 gb|ESR32511.1| hypothetical protein CICLE_v10005764mg [Citrus clementina]
Length=237

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHK  232
            WELT+P+ L+ D  SVE +LG  P VHYIYVC KD +L++  K
Sbjct  195  WELTNPVPLENDGRSVEELLGKIPDVHYIYVCTKDESLKTSSK  237



>ref|XP_003594886.1| Methyltransferase-like protein [Medicago truncatula]
 gb|AES65137.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=236

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            WELT PI L+ D SSV+  LG NP VHYIY+C K+ +  S  KA
Sbjct  193  WELTKPIPLNNDGSSVDETLGLNPDVHYIYICTKEISANSNVKA  236



>gb|KCW61370.1| hypothetical protein EUGRSUZ_H04109 [Eucalyptus grandis]
Length=163

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            WELT+P+ LD + SS E++LG NP VHYIYVC K
Sbjct  128  WELTNPLPLDNEGSSAETLLGRNPDVHYIYVCTK  161



>dbj|BAJ96913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=288

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            S ++ W+LT P+ L  D +S+ ++LGP P VHYIYVC+KDN
Sbjct  232  SSKKTWDLTEPLPLHDDSTSIINLLGPKPDVHYIYVCIKDN  272



>gb|KJB28819.1| hypothetical protein B456_005G071000 [Gossypium raimondii]
Length=235

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = -2

Query  408  RIGADKVPTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKD  256
            + GA+    GSS Q    LT PI LD+  SSVE VLG NP VHYIYVC K+
Sbjct  184  KFGAE----GSSEQPTRALTDPILLDESGSSVEDVLGKNPDVHYIYVCTKE  230



>ref|XP_003546391.1| PREDICTED: methyltransferase-like protein 13-like isoform X1 
[Glycine max]
Length=236

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            WELT P+ L+ D SSVE  LG NP VHYIY+C K+ +  S   A
Sbjct  193  WELTKPVPLNDDGSSVEEALGQNPDVHYIYICTKEVSANSNTNA  236



>gb|AFK47960.1| unknown [Medicago truncatula]
Length=236

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            WELT PI L+ D SSV+  LG NP VHYIY+C K+ +  S  +A
Sbjct  193  WELTKPIPLNNDGSSVDETLGLNPDVHYIYICTKEISANSNVRA  236



>gb|EMT31220.1| Methyltransferase-like protein 13 [Aegilops tauschii]
Length=237

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            S ++ W+LT P+ L  D +S+ ++LGP P VHYIYVC+K+N
Sbjct  181  SSKKTWDLTEPLPLQDDSTSIINLLGPKPDVHYIYVCIKEN  221



>ref|XP_010465787.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Camelina 
sativa]
Length=239

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            KWELT P+ LD + SSVES +G +P VHYIYVC+K
Sbjct  202  KWELTKPVPLDAEGSSVESAIGKSPDVHYIYVCIK  236



>ref|XP_010024858.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
13 [Eucalyptus grandis]
Length=248

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            WELT+P+ LD + SS E++LG NP VHYIYVC K
Sbjct  195  WELTNPLPLDNEGSSAETLLGRNPDVHYIYVCTK  228



>gb|KCW61369.1| hypothetical protein EUGRSUZ_H04109 [Eucalyptus grandis]
Length=230

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            WELT+P+ LD + SS E++LG NP VHYIYVC K
Sbjct  195  WELTNPLPLDNEGSSAETLLGRNPDVHYIYVCTK  228



>ref|XP_010555151.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Tarenaya 
hassleriana]
Length=232

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 1/47 (2%)
 Frame = -2

Query  396  DKVPTGSSHQQ-KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            DK  T  + +  KWEL +PI +D + SSVE+ LG NP VHYIYVC K
Sbjct  183  DKTLTDEAAEHPKWELRNPIPVDAEGSSVETTLGKNPDVHYIYVCTK  229



>gb|KJB28820.1| hypothetical protein B456_005G071000 [Gossypium raimondii]
Length=261

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 32/50 (64%), Gaps = 4/50 (8%)
 Frame = -2

Query  408  RIGADKVPTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            + GA+    GSS Q    LT PI LD+  SSVE VLG NP VHYIYVC K
Sbjct  184  KFGAE----GSSEQPTRALTDPILLDESGSSVEDVLGKNPDVHYIYVCTK  229



>ref|XP_006597757.1| PREDICTED: methyltransferase-like protein 13-like isoform X3 
[Glycine max]
Length=229

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            WELT P+ L+ D SSVE  LG NP VHYIY+C K N
Sbjct  193  WELTKPVPLNDDGSSVEEALGQNPDVHYIYICTKIN  228



>ref|XP_010555152.1| PREDICTED: methyltransferase-like protein 13 isoform X2 [Tarenaya 
hassleriana]
Length=227

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            KWEL +PI +D + SSVE+ LG NP VHYIYVC K
Sbjct  190  KWELRNPIPVDAEGSSVETTLGKNPDVHYIYVCTK  224



>gb|KHN26616.1| Methyltransferase-like protein 13 [Glycine soja]
Length=235

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQ  226
            WELT P+ L+ D SSVE  LG NP VHYIY+C K+ +  S HK  
Sbjct  188  WELTKPVPLNDDGSSVEEALGQNPDVHYIYICTKEISANS-HKCM  231



>ref|XP_008438981.1| PREDICTED: methyltransferase-like protein 13 isoform X1 [Cucumis 
melo]
Length=250

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  363  KWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDN  253
            KW+L  P+  D DV  +E++LG NP VHYIY+C KD+
Sbjct  192  KWDLLKPVPFDNDVRPLETMLGQNPDVHYIYICTKDS  228



>gb|KHN47725.1| Methyltransferase-like protein 13 [Glycine soja]
Length=244

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            WELT P+ L+ D SSVE  LG NP VHYIY+C K
Sbjct  188  WELTKPVPLNDDGSSVEEALGQNPDVHYIYICTK  221



>ref|XP_006597756.1| PREDICTED: methyltransferase-like protein 13-like isoform X2 
[Glycine max]
Length=249

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVK  259
            WELT P+ L+ D SSVE  LG NP VHYIY+C K
Sbjct  193  WELTKPVPLNDDGSSVEEALGQNPDVHYIYICTK  226



>gb|ACJ84630.1| unknown [Medicago truncatula]
Length=236

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            W LT PI L+ D SSV+  LG NP VHYIY+C K+ +  S  KA
Sbjct  193  WGLTKPIPLNNDGSSVDETLGLNPDVHYIYICTKEISANSNVKA  236



>ref|XP_009359766.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=247

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = -2

Query  360  WELTSPIALDKD-VSSVESVLGPNPSVHYIYVCVKDNTLE  244
            W+LT+P+ L  D  SS E +LG NP VHYIY+C KDN+L+
Sbjct  198  WDLTNPVPLHGDGRSSAEELLGNNPDVHYIYICTKDNSLK  237



>ref|XP_009349214.1| PREDICTED: methyltransferase-like protein 13 [Pyrus x bretschneideri]
Length=247

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = -2

Query  360  WELTSPIALDKD-VSSVESVLGPNPSVHYIYVCVKDNTLE  244
            W+LT+P+ L  D  SS E +LG NP VHYIY+C KDN+L+
Sbjct  198  WDLTNPVPLHGDGRSSAEELLGNNPDVHYIYICTKDNSLK  237



>ref|XP_007138845.1| hypothetical protein PHAVU_009G242300g [Phaseolus vulgaris]
 gb|ESW10839.1| hypothetical protein PHAVU_009G242300g [Phaseolus vulgaris]
Length=236

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -2

Query  375  SHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKA  229
            S Q  WELT P+ L+ D SSVE  LG +P VH+IY+C K+ +  S   A
Sbjct  188  SDQPIWELTKPVPLNDDGSSVEETLGRSPDVHFIYICTKEISANSNTNA  236



>ref|XP_009391525.1| PREDICTED: methyltransferase-like protein 13 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 3/47 (6%)
 Frame = -2

Query  366  QKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNTLESRHKAQ  226
            + W LT+P+ L+ D SS+ ++LG NP VHYIYVC K   LES+   Q
Sbjct  185  KTWTLTNPVPLNTDGSSIATLLGSNPEVHYIYVCTK---LESQRPPQ  228



>gb|AFK45927.1| unknown [Lotus japonicus]
Length=233

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -2

Query  360  WELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
            WELT P+ L+ D SSVE  LG N  VHYIY+C K+++
Sbjct  193  WELTKPVPLNDDGSSVEEALGRNADVHYIYICTKESS  229



>ref|XP_011100681.1| PREDICTED: methyltransferase-like protein 13 isoform X3 [Sesamum 
indicum]
Length=258

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = -2

Query  396  DKVPTGSSHQQKWELTSPIALDKDVSSVESVLGPNPSVHYIYVCVKDNT  250
            +K+ +G+S  Q  ++T PI LD +  SVE  +G    VHYIYVC+KDN+
Sbjct  199  EKLASGNSSHQTTDITCPIPLDVNGGSVEGAVGMKADVHYIYVCIKDNS  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880