BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013J02

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS62642.1|  hypothetical protein M569_12144                         304   1e-101   Genlisea aurea
ref|XP_009797237.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    307   9e-101   Nicotiana sylvestris
ref|XP_008246046.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    306   4e-100   Prunus mume [ume]
gb|KDO73256.1|  hypothetical protein CISIN_1g0046341mg                  303   5e-100   Citrus sinensis [apfelsine]
ref|XP_003597229.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    317   1e-99    
gb|AES67479.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       317   2e-99    Medicago truncatula
ref|XP_003597228.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    316   3e-99    
gb|AID51432.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    316   4e-99    Astragalus membranaceus
gb|AEM42998.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    315   9e-99    Siraitia grosvenorii [arhat fruit]
ref|XP_008344871.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    297   1e-98    
gb|AEZ55668.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       313   4e-98    Salvia miltiorrhiza [Chinese salvia]
gb|AJA39985.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    313   4e-98    Salvia miltiorrhiza f. alba
ref|XP_009803352.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    295   4e-98    Nicotiana sylvestris
gb|KJB26175.1|  hypothetical protein B456_004G228600                    311   1e-97    Gossypium raimondii
gb|KJB26176.1|  hypothetical protein B456_004G228600                    311   1e-97    Gossypium raimondii
gb|KHG03611.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    311   1e-97    Gossypium arboreum [tree cotton]
ref|XP_007016723.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    311   2e-97    
gb|ADX06907.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate sy...    311   2e-97    Rauvolfia verticillata
ref|NP_001234648.1|  GcpE                                               310   4e-97    Solanum lycopersicum
ref|XP_002285130.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    310   5e-97    Vitis vinifera
ref|XP_011089897.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    310   6e-97    Sesamum indicum [beniseed]
emb|CAN72185.1|  hypothetical protein VITISV_005654                     310   6e-97    Vitis vinifera
emb|CDP07116.1|  unnamed protein product                                309   7e-97    Coffea canephora [robusta coffee]
gb|AGQ04156.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase       310   8e-97    Lavandula angustifolia [lavender]
gb|AHA11129.1|  chloroplast 4-hydroxy-3-methylbut-2-enyl diphosph...    309   1e-96    Picrorhiza kurrooa
gb|KHN21521.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    308   2e-96    Glycine soja [wild soybean]
ref|XP_003540178.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   2e-96    Glycine max [soybeans]
ref|XP_003543457.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   2e-96    Glycine max [soybeans]
ref|XP_004487120.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   2e-96    
ref|XP_010253662.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   2e-96    Nelumbo nucifera [Indian lotus]
gb|KHN11204.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    308   2e-96    Glycine soja [wild soybean]
ref|XP_010535603.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   3e-96    Tarenaya hassleriana [spider flower]
ref|XP_006340201.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    308   4e-96    Solanum tuberosum [potatoes]
gb|ACT64770.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    305   4e-96    Artemisia annua [sweet Annie]
dbj|BAF98296.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    307   5e-96    Hevea brasiliensis [jebe]
ref|XP_009592136.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    307   7e-96    
ref|XP_007207209.1|  hypothetical protein PRUPE_ppa002111mg             306   9e-96    
gb|EYU36193.1|  hypothetical protein MIMGU_mgv1a001893mg                305   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_008349746.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    305   3e-95    
gb|EYU36192.1|  hypothetical protein MIMGU_mgv1a001893mg                305   3e-95    Erythranthe guttata [common monkey flower]
ref|XP_006424585.1|  hypothetical protein CICLE_v10027881mg             305   3e-95    Citrus clementina [clementine]
ref|XP_010043743.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    305   4e-95    Eucalyptus grandis [rose gum]
ref|XP_004148774.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    305   4e-95    Cucumis sativus [cucumbers]
ref|XP_008463938.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    304   8e-95    Cucumis melo [Oriental melon]
ref|XP_004295028.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    304   1e-94    Fragaria vesca subsp. vesca
dbj|BAB09833.1|  GcpE protein                                           302   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098198.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    307   3e-94    
gb|AFQ98370.1|  hydroxymethylbutenyl diphosphate synthase               302   5e-94    Camellia sinensis [black tea]
ref|XP_010456601.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    302   5e-94    Camelina sativa [gold-of-pleasure]
emb|CDY53637.1|  BnaC09g54000D                                          302   6e-94    Brassica napus [oilseed rape]
gb|AAL91150.1|  GcpE protein                                            302   6e-94    Arabidopsis thaliana [mouse-ear cress]
gb|KDP44060.1|  hypothetical protein JCGZ_05527                         302   6e-94    Jatropha curcas
gb|ABB78087.1|  (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate syn...    302   6e-94    Ginkgo biloba [ginkgo]
ref|XP_011044361.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    302   6e-94    Populus euphratica
ref|XP_007150210.1|  hypothetical protein PHAVU_005G135800g             302   6e-94    Phaseolus vulgaris [French bean]
ref|NP_851233.1|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     302   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200868.2|  4-hydroxy-3-methylbut-2-enyl diphosphate synthase     302   6e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400831.1|  hypothetical protein EUTSA_v10012774mg             302   7e-94    Eutrema salsugineum [saltwater cress]
gb|AAM19840.1|  AT5g60600/mup24_10                                      302   7e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443862.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   8e-94    Camelina sativa [gold-of-pleasure]
emb|CDY31531.1|  BnaA10g13400D                                          301   9e-94    Brassica napus [oilseed rape]
ref|XP_009120594.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   9e-94    Brassica rapa
ref|XP_010483710.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   1e-93    Camelina sativa [gold-of-pleasure]
ref|XP_009335082.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_009367086.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_010689558.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    301   2e-93    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001289212.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    300   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_002864694.1|  hypothetical protein ARALYDRAFT_919295             300   2e-93    Arabidopsis lyrata subsp. lyrata
ref|XP_006854508.1|  hypothetical protein AMTR_s00175p00057810          300   2e-93    Amborella trichopoda
gb|ABV02021.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate sy...    282   2e-93    Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_006378969.1|  hypothetical protein POPTR_0009s01900g             300   3e-93    
gb|ACD70401.1|  putative chloroplast 4-hydroxy-3-methylbut-2-en-1...    299   3e-93    Populus trichocarpa [western balsam poplar]
ref|XP_006280064.1|  hypothetical protein CARUB_v10025946mg             300   3e-93    Capsella rubella
ref|XP_008807336.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    300   4e-93    Phoenix dactylifera
ref|XP_006378968.1|  hypothetical protein POPTR_0009s01900g             298   7e-93    
ref|XP_006378966.1|  hypothetical protein POPTR_0009s01900g             299   7e-93    
ref|XP_008359197.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    298   2e-92    
gb|AAO24774.1|  GCPE protein                                            297   3e-92    Catharanthus roseus [chatas]
ref|XP_011040872.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    282   6e-92    Populus euphratica
gb|AAO72576.1|  isoprenoid biosynthesis-like protein                    293   6e-92    Oryza sativa Japonica Group [Japonica rice]
gb|ABG75916.2|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    296   1e-91    Stevia rebaudiana
ref|XP_010906493.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    296   1e-91    Elaeis guineensis
ref|XP_009392271.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    295   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047365.1|  Os02g0603800                                       294   8e-91    
ref|XP_006647487.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    291   8e-90    Oryza brachyantha
ref|XP_006384896.1|  hypothetical protein POPTR_0004s22010g             291   8e-90    
gb|AJA32313.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    291   8e-90    Narcissus tazetta
ref|XP_004487119.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    291   1e-89    
gb|AHN91473.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    290   2e-89    Dendrobium officinale
gb|ACL53652.1|  unknown                                                 290   3e-89    Zea mays [maize]
gb|AJA32314.1|  chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-di...    290   3e-89    Narcissus tazetta
gb|ACG47448.1|  hydroxymethylbutenyl 4-diphosphate synthase             290   3e-89    Zea mays [maize]
ref|XP_004169086.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    289   7e-89    
ref|NP_001105676.1|  LOC542690                                          288   1e-88    Zea mays [maize]
ref|XP_003575307.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    288   2e-88    Brachypodium distachyon [annual false brome]
ref|XP_004953020.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    286   5e-88    Setaria italica
ref|XP_002454137.1|  hypothetical protein SORBIDRAFT_04g025290          286   8e-88    Sorghum bicolor [broomcorn]
ref|XP_001766565.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    284   1e-87    
ref|XP_001755871.1|  predicted protein                                  280   6e-86    
ref|XP_001764903.1|  predicted protein                                  277   1e-85    
ref|XP_002973473.1|  hypothetical protein SELMODRAFT_149035             279   1e-85    
ref|XP_002986683.1|  hypothetical protein SELMODRAFT_158184             279   1e-85    
emb|CDY53636.1|  BnaC09g53990D                                          262   5e-85    Brassica napus [oilseed rape]
ref|XP_008225843.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    277   2e-84    Prunus mume [ume]
gb|AHG98060.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    253   6e-82    Plectranthus barbatus
gb|AAS75817.1|  (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synt...    252   8e-80    Nicotiana benthamiana
ref|XP_002530286.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    254   3e-76    
gb|KDO73263.1|  hypothetical protein CISIN_1g0046341mg                  239   3e-75    Citrus sinensis [apfelsine]
ref|XP_006488105.1|  PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl d...    249   6e-74    
ref|XP_001690937.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    242   1e-71    Chlamydomonas reinhardtii
gb|AAX54905.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E)-but...    242   1e-71    Chlamydomonas reinhardtii
gb|ABG74579.1|  isoprenoid biosynthesis-like protein                    225   2e-71    Musa acuminata AAA Group [Cavendish banana]
gb|KIZ04819.1|  hypothetical protein MNEG_3143                          238   3e-71    Monoraphidium neglectum
ref|XP_005650225.1|  putative chloroplast 1-hydroxy-2-methyl-2-(E...    239   2e-70    Coccomyxa subellipsoidea C-169
ref|XP_002953482.1|  hypothetical protein VOLCADRAFT_63610              235   5e-69    Volvox carteri f. nagariensis
ref|XP_002506236.1|  predicted protein                                  234   2e-68    Micromonas commoda
ref|XP_005841109.1|  hypothetical protein GUITHDRAFT_63981              231   2e-67    Guillardia theta CCMP2712
ref|XP_011400578.1|  26S proteasome non-ATPase regulatory subunit 1     234   1e-66    Auxenochlorella protothecoides
ref|XP_003081089.1|  putative chloroplast 1-hydroxy-2-methyl-2-(ISS)    228   5e-66    Ostreococcus tauri
ref|XP_001419500.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    226   1e-65    Ostreococcus lucimarinus CCE9901
gb|KDD76259.1|  GcpE                                                    210   1e-64    Helicosporidium sp. ATCC 50920
ref|XP_003056663.1|  predicted protein                                  221   9e-64    Micromonas pusilla CCMP1545
emb|CBJ30926.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    220   2e-63    Ectocarpus siliculosus
ref|XP_007510861.1|  predicted protein                                  219   7e-63    Bathycoccus prasinos
gb|ACI45948.1|  putative chloroplast 4-hydroxy-3-methylbut-2-en-1...    202   1e-60    Guillardia theta
gb|EMT15013.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    205   9e-58    
gb|KFG49560.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   3e-57    Toxoplasma gondii GAB2-2007-GAL-DOM2
gb|KFH07783.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   3e-57    Toxoplasma gondii MAS
gb|KFG35221.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   3e-57    Toxoplasma gondii p89
gb|KFG65470.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   4e-57    Toxoplasma gondii RUB
gb|KFH10447.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   4e-57    Toxoplasma gondii VAND
gb|EMS56222.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    202   5e-57    Triticum urartu
ref|XP_005848392.1|  hypothetical protein CHLNCDRAFT_144676             202   7e-57    Chlorella variabilis
gb|KFG52681.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   3e-56    Toxoplasma gondii FOU
gb|ESS31948.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   3e-56    Toxoplasma gondii VEG
gb|EPR62596.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    204   4e-56    Toxoplasma gondii GT1
ref|XP_002365345.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    204   4e-56    Toxoplasma gondii ME49
emb|CDZ80220.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    197   2e-55    Candidatus Rubidus massiliensis
ref|XP_002292108.1|  gcpe-like protein                                  196   1e-54    Thalassiosira pseudonana CCMP1335
ref|XP_009035331.1|  hypothetical protein AURANDRAFT_71112              199   2e-54    Aureococcus anophagefferens
ref|XP_008882873.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    198   3e-54    
ref|XP_003882784.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    198   4e-54    Neospora caninum Liverpool
ref|XP_005783224.1|  hypothetical protein EMIHUDRAFT_442353             195   5e-54    Emiliania huxleyi CCMP1516
ref|XP_002179061.1|  1-hydroxy-2-methyl-2-(E)-butenyl-4-diphospha...    194   5e-54    Phaeodactylum tricornutum CCAP 1055/1
gb|EFB40485.1|  hypothetical protein pah_c200o034                       193   6e-54    Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_036746476.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    193   8e-54    Parachlamydia acanthamoebae
ref|WP_013925438.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    191   4e-53    Parachlamydia acanthamoebae
gb|KIA77148.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    191   5e-53    Parachlamydia acanthamoebae
ref|WP_042103571.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    191   6e-53    Parachlamydiaceae bacterium HS-T3
ref|WP_039385010.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    189   2e-52    Neochlamydia sp. TUME1
gb|EJK67655.1|  hypothetical protein THAOC_11283                        190   2e-52    Thalassiosira oceanica
gb|KIC74118.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    186   2e-51    Neochlamydia sp. EPS4
ref|XP_765233.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate syn...    186   5e-51    Theileria parva strain Muguga
ref|WP_011175290.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    184   1e-50    Candidatus Protochlamydia amoebophila
gb|KIC72391.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    184   1e-50    Candidatus Protochlamydia amoebophila
ref|WP_039357656.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    184   1e-50    Candidatus Protochlamydia amoebophila
ref|WP_042282293.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    184   2e-50    Candidatus Protochlamydia sp. R18
ref|WP_035395035.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    184   2e-50    
gb|EMR00731.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    173   4e-50    Cesiribacter andamanensis AMV16
ref|WP_043587352.1|  hypothetical protein                               171   4e-50    
ref|WP_042240386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    182   5e-50    Neochlamydia sp. S13
ref|XP_952048.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate ...    183   1e-49    Theileria annulata
ref|XP_009690697.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphospha...    182   1e-49    Theileria orientalis strain Shintoku
ref|XP_004829307.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    182   2e-49    Theileria equi strain WA
ref|WP_043128162.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   2e-49    
ref|WP_008101242.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    181   2e-49    Verrucomicrobiae bacterium DG1235
ref|XP_002768617.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    179   2e-48    Perkinsus marinus ATCC 50983
dbj|BAG14389.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    179   2e-48    Perkinsus marinus ATCC 50439
ref|WP_013044727.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    178   3e-48    Coraliomargarita akajimensis
ref|XP_006378965.1|  hypothetical protein POPTR_0009s01900g             177   4e-48    
ref|WP_013943315.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    177   4e-48    Simkania negevensis
ref|XP_006424584.1|  hypothetical protein CICLE_v10027881mg             176   1e-47    
ref|NP_001119467.1|  4-hydroxy-3-methylbut-2-enyl diphosphate syn...    177   1e-47    Arabidopsis thaliana [mouse-ear cress]
ref|WP_028788241.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    175   4e-47    Terrimonas ferruginea
ref|WP_020152560.1|  hypothetical protein                               173   6e-47    
ref|WP_041873442.1|  hypothetical protein                               167   7e-47    
ref|WP_000541454.1|  hypothetical protein                               166   1e-46    
ref|WP_026768257.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   3e-46    Asinibacterium sp. OR53
ref|WP_026772720.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    172   3e-46    Asinibacterium sp. OR43
ref|WP_025298932.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   8e-46    
emb|CDR94010.1|  gcpE protein, putative                                 171   1e-45    Babesia bigemina
ref|WP_018627269.1|  hypothetical protein                               171   1e-45    Niabella aurantiaca
ref|WP_035071223.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   2e-45    Anditalea andensis
ref|WP_009508000.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    171   2e-45    Opitutaceae bacterium TAV5
ref|WP_020149813.1|  hypothetical protein                               169   2e-45    
ref|WP_028261665.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   2e-45    
ref|WP_002702180.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   2e-45    Microscilla marina
gb|AEA43526.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    169   3e-45    Fluviicola taffensis DSM 16823
ref|WP_015265930.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    170   3e-45    Echinicola vietnamensis
ref|WP_043024168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   3e-45    
gb|EOQ87425.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    169   4e-45    Leptospira yanagawae serovar Saopaulo str. Sao Paulo = ATCC 700523
ref|WP_039929258.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    169   4e-45    Leptospira yanagawae
ref|WP_012377418.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   5e-45    Opitutus terrae
ref|WP_008627688.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   6e-45    Mariniradius saccharolyticus
ref|WP_009036471.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    169   7e-45    Indibacter alkaliphilus
ref|WP_012388276.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   8e-45    Leptospira biflexa
gb|EMJ86182.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    168   9e-45    Leptospira meyeri serovar Semaranga str. Veldrot Semarang 173
ref|WP_014681066.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   9e-45    Solitalea canadensis
ref|WP_029998282.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   1e-44    
ref|WP_035983785.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    168   1e-44    Leptospira meyeri
ref|WP_039126529.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   1e-44    Flavihumibacter sp. ZG627
ref|WP_038162080.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-44    Verrucomicrobium sp. BvORR106
ref|WP_016194246.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    168   1e-44    Arcticibacter svalbardensis
ref|WP_028831439.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   1e-44    
ref|WP_001011572.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-44    Leptospira interrogans
ref|WP_009965977.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-44    Verrucomicrobium spinosum
ref|WP_001011575.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-44    Leptospira interrogans
ref|WP_001011584.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   1e-44    Leptospira interrogans
ref|WP_019111293.1|  hypothetical protein                               167   2e-44    Verrucomicrobia bacterium SCGC AAA164-L15
gb|EKJ85057.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    167   2e-44    Leptospira meyeri serovar Hardjo str. Went 5
ref|WP_038131498.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-44    Verrucomicrobia bacterium SCGC AAA168-F10
ref|WP_001011574.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-44    
ref|WP_002101771.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    167   2e-44    Leptospira interrogans
ref|WP_012925967.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   2e-44    
ref|WP_040917603.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   2e-44    Leptospira meyeri
ref|WP_020888417.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    Cyclobacterium qasimii
ref|WP_014020335.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    Cyclobacterium marinum
ref|WP_014772391.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    Belliella baltica
ref|WP_038029147.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    Thermonema rossianum
ref|WP_015030917.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    Emticicia oligotrophica
ref|WP_033412090.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    167   3e-44    
ref|WP_001011587.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    167   3e-44    
ref|WP_018477847.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   3e-44    Pontibacter roseus
ref|WP_033418316.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-44    Cytophaga aurantiaca
ref|WP_027000276.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-44    
ref|WP_015681381.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   4e-44    Leptospira wolbachii
ref|WP_013452189.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-44    Marivirga tractuosa
ref|WP_014222823.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   4e-44    Niastella koreensis
gb|ABG59455.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    166   5e-44    Cytophaga hutchinsonii ATCC 33406
ref|WP_039139364.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   5e-44    Flavihumibacter solisilvae
ref|WP_035610064.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    
ref|WP_001011579.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira interrogans
ref|WP_001011576.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira interrogans
ref|WP_041932708.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   5e-44    Cytophaga hutchinsonii
ref|WP_001011581.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira interrogans
ref|WP_001011580.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira interrogans
ref|WP_004765637.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   5e-44    Leptospira kirschneri
ref|WP_020763499.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   5e-44    Leptospira kirschneri
ref|WP_001011585.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira interrogans
ref|WP_018472954.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   5e-44    Echinicola pacifica
ref|WP_002974114.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   5e-44    Leptospira terpstrae
ref|WP_020779677.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   6e-44    Leptospira kirschneri
ref|WP_016752197.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   6e-44    Leptospira kirschneri
ref|WP_002725099.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    166   6e-44    Leptospira
ref|WP_004783178.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   6e-44    Leptospira kirschneri
ref|WP_001011586.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   6e-44    Leptospira interrogans
ref|WP_004755752.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   6e-44    Leptospira kirschneri
ref|WP_004756563.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   6e-44    Leptospira kirschneri
ref|WP_002981464.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   6e-44    Leptospira vanthielii
ref|WP_020765666.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   6e-44    Leptospira
ref|WP_020784592.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   6e-44    Leptospira interrogans
gb|EKQ84987.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    166   6e-44    Leptospira kirschneri serovar Grippotyphosa str. Moskva
ref|WP_001011571.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   6e-44    Leptospira interrogans
ref|WP_009185621.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   7e-44    Cecembia lonarensis
ref|WP_020526939.1|  hypothetical protein                               166   7e-44    Flexithrix dorotheae
ref|WP_026952032.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    166   7e-44    Algoriphagus mannitolivorans
ref|WP_002752446.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   7e-44    
ref|WP_002625642.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    166   8e-44    Leptospira
ref|WP_011670735.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   8e-44    Leptospira borgpetersenii
ref|WP_004506808.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    166   8e-44    Leptospira weilii
ref|WP_011671608.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   8e-44    Leptospira borgpetersenii
ref|WP_016761207.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    166   8e-44    Leptospira weilii
ref|XP_001610211.1|  gcpE protein                                       166   8e-44    Babesia bovis T2Bo
ref|WP_044513706.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   9e-44    Hymenobacter sp. DG25B
ref|WP_026764890.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    Sediminibacterium salmoneum
gb|EDM36017.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    165   1e-43    Pedobacter sp. BAL39
ref|WP_039866655.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    Pedobacter sp. BAL39
ref|WP_012420427.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   1e-43    Akkermansia muciniphila
ref|WP_010576785.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   1e-43    Leptospira alexanderi
ref|WP_026750307.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    Sediminibacterium sp. C3
ref|WP_036852241.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-43    Porphyromonas cangingivalis
ref|WP_022824903.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    Hymenobacter norwichensis
ref|WP_029996480.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   1e-43    Leptospira interrogans
ref|WP_004484777.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    Leptospira santarosai
ref|WP_031930960.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-43    Akkermansia muciniphila
ref|WP_004466801.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   1e-43    Leptospira santarosai
ref|WP_044168752.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-43    Porphyromonas catoniae
ref|WP_004482338.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    Leptospira santarosai
ref|WP_022198292.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   1e-43    
gb|EMF90050.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    165   1e-43    
gb|EKO79202.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    165   1e-43    
ref|WP_025145959.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    
ref|WP_004501491.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    
ref|WP_004499155.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    
ref|WP_004491347.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    
ref|WP_026464184.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    165   1e-43    
ref|WP_004479487.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    
ref|WP_004461954.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    165   1e-43    
ref|WP_004485858.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   1e-43    
ref|WP_032916231.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   1e-43    
ref|WP_002997489.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   2e-43    
ref|WP_017863172.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    165   2e-43    
ref|WP_020783453.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    165   2e-43    
gb|ELR70856.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    164   2e-43    
ref|WP_040496810.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-43    
ref|WP_041016942.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
gb|EKY01400.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    164   2e-43    
ref|WP_039721940.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
ref|WP_017852765.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
emb|CDR33454.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    164   2e-43    
ref|WP_001011577.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
ref|WP_001011578.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
ref|WP_012788578.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-43    
ref|WP_044234467.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
ref|WP_022396268.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
ref|WP_026946987.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-43    
ref|WP_016750149.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   2e-43    
gb|EKR08142.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl diphosph...    164   2e-43    
ref|WP_024283448.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   2e-43    
ref|WP_014855999.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   3e-43    
ref|WP_044117870.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   3e-43    
ref|WP_007418591.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    164   3e-43    
ref|WP_002746741.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    164   3e-43    
ref|WP_019599168.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   3e-43    
ref|WP_024808156.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   3e-43    
ref|WP_025837262.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   4e-43    
ref|WP_039749913.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   4e-43    
ref|WP_028980942.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   4e-43    
ref|WP_042725663.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   4e-43    
dbj|GAL87502.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    163   4e-43    
ref|WP_026995433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    164   4e-43    
ref|WP_039477998.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   4e-43    
gb|EDY17533.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    163   4e-43    
ref|WP_033111082.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   4e-43    
ref|WP_040919883.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   4e-43    
ref|WP_025761675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   5e-43    
ref|WP_040888669.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   5e-43    
ref|WP_039449219.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   5e-43    
ref|WP_007658562.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   5e-43    
gb|EHQ06249.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    163   5e-43    
ref|WP_010856632.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   5e-43    
ref|WP_037439696.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   6e-43    
ref|WP_001011583.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   6e-43    
ref|WP_018969131.1|  hypothetical protein                               163   6e-43    
ref|WP_036845168.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   6e-43    
ref|WP_016549865.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   6e-43    
ref|WP_020772242.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   6e-43    
ref|WP_041952338.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   6e-43    
ref|WP_026967844.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   6e-43    
gb|EMO39017.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synth...    162   6e-43    
ref|WP_039053483.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    163   7e-43    
ref|WP_016544642.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    163   7e-43    
ref|WP_010417793.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   7e-43    
ref|WP_012500067.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    163   7e-43    
ref|WP_030001802.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   8e-43    
ref|WP_044200698.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   8e-43    
ref|WP_020986937.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   8e-43    
emb|CDJ42285.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    165   8e-43    
ref|WP_036881806.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   9e-43    
ref|WP_004452120.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   9e-43    
ref|WP_002152870.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   9e-43    
ref|WP_004450043.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   9e-43    
ref|WP_004456392.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   9e-43    
gb|EKE08670.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    151   9e-43    
emb|CDJ67490.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    165   1e-42    
ref|WP_002177887.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   1e-42    
ref|WP_017215661.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   1e-42    
ref|WP_016560160.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   1e-42    
ref|WP_040762255.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-42    
ref|WP_029284060.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-42    
ref|WP_004447250.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   1e-42    
ref|WP_012464304.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   1e-42    
ref|WP_004419791.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   1e-42    
ref|WP_004426903.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    162   1e-42    
ref|WP_026955484.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-42    
ref|WP_015809258.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-42    
ref|WP_009053773.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   1e-42    
ref|WP_033564087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   2e-42    
ref|WP_025605263.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   2e-42    
ref|WP_040580353.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   2e-42    
ref|WP_026904001.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   2e-42    
ref|WP_009060399.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    161   2e-42    
ref|WP_029275774.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    162   2e-42    
ref|WP_008592103.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    162   2e-42    
gb|EEN83170.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    161   2e-42    
ref|WP_044004668.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   2e-42    
ref|WP_026898877.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   2e-42    
emb|CCH52120.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    161   2e-42    
ref|WP_020770260.1|  putative 4-hydroxy-3-methylbut-2-en-1-yl dip...    161   2e-42    
ref|WP_017729932.1|  hypothetical protein                               161   2e-42    
ref|WP_040005539.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   2e-42    
ref|WP_036885384.1|  hypothetical protein                               154   3e-42    
ref|WP_044017536.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   3e-42    
ref|WP_027418785.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    161   3e-42    
gb|KDU79597.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    160   3e-42    
ref|XP_740737.1|  hypothetical protein                                  151   4e-42    
ref|WP_017259779.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   4e-42    
ref|WP_044125133.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   4e-42    
gb|ERJ73001.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    160   4e-42    
ref|WP_041259095.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   5e-42    
ref|WP_041886704.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   5e-42    
ref|WP_009433030.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   5e-42    
ref|WP_044114366.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   5e-42    
emb|CCH01413.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate s...    160   6e-42    
ref|WP_029465287.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   6e-42    
gb|ETZ23959.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    160   6e-42    
ref|WP_010230169.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   6e-42    
ref|WP_010575421.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    160   7e-42    
ref|WP_014559193.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   8e-42    
ref|WP_028070631.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    160   8e-42    
ref|WP_021069034.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   1e-41    
ref|WP_010602512.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   1e-41    
ref|WP_031527052.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   1e-41    
ref|WP_035403961.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   2e-41    
gb|EHQ25285.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    159   2e-41    
ref|WP_018358592.1|  hypothetical protein                               158   2e-41    
ref|WP_028297123.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   2e-41    
emb|CDS92835.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    159   2e-41    
ref|WP_022436495.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   2e-41    
ref|WP_040627083.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    159   2e-41    
ref|WP_020149744.1|  hypothetical protein                               158   2e-41    
gb|KGN83000.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    158   2e-41    
ref|WP_008199314.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-41    
gb|KGN97437.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    158   2e-41    
ref|WP_012509318.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    159   2e-41    
ref|WP_038700675.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   2e-41    
ref|WP_040585707.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   3e-41    
ref|WP_019943804.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   3e-41    
ref|WP_044190040.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   3e-41    
ref|WP_034413798.1|  hypothetical protein                               159   3e-41    
ref|WP_044233106.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    158   3e-41    
ref|WP_035562438.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   3e-41    
ref|WP_019986408.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   3e-41    
ref|WP_022477760.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   3e-41    
ref|WP_018028589.1|  hypothetical protein                               157   3e-41    
ref|WP_013633270.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   4e-41    
gb|ETX05585.1|  hypothetical protein ETSY2_22100                        157   4e-41    
ref|WP_010526318.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   4e-41    
ref|WP_012780078.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    158   4e-41    
ref|WP_013926162.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   5e-41    
ref|WP_009596898.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    156   5e-41    
ref|WP_010883016.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   6e-41    
ref|WP_003011709.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   6e-41    
ref|WP_002992820.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   6e-41    
ref|WP_014517754.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   6e-41    
ref|WP_026632945.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   6e-41    
gb|ETR80258.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    157   6e-41    
ref|WP_013407896.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   7e-41    
ref|WP_020036128.1|  hypothetical protein                               157   8e-41    
ref|WP_028665433.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   8e-41    
ref|WP_044222153.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   9e-41    
ref|WP_037525485.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    157   1e-40    
gb|EQB83053.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    157   1e-40    
ref|WP_011358682.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    157   1e-40    
ref|WP_006344058.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   1e-40    
ref|WP_035405552.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   1e-40    
emb|CED80467.1|  1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate s...    156   2e-40    
ref|WP_011097048.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    156   2e-40    
ref|WP_032135488.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   2e-40    
ref|WP_026318442.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   2e-40    
ref|WP_019307250.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   2e-40    
ref|WP_033389833.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   2e-40    
gb|EKD52354.1|  hypothetical protein ACD_62C00046G0001                  154   2e-40    
ref|WP_011006385.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   2e-40    
ref|WP_037495597.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   2e-40    
emb|CCF74567.1|  unnamed protein product                                156   2e-40    
ref|WP_014944975.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   2e-40    
gb|EPP30393.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    154   3e-40    
ref|WP_011361395.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   3e-40    
ref|WP_012873985.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   4e-40    
ref|WP_006367343.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    155   4e-40    
ref|WP_038973847.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   4e-40    
ref|WP_028523087.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    155   5e-40    
ref|WP_036884355.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   5e-40    
ref|WP_011431793.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   5e-40    
ref|WP_019130491.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphospha...    154   5e-40    
ref|WP_010508976.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   6e-40    
ref|WP_010422549.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   7e-40    
ref|WP_013712790.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   8e-40    
ref|WP_006343099.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   8e-40    
ref|WP_014943808.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   8e-40    
ref|WP_021756575.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   8e-40    
ref|WP_021757239.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   8e-40    
gb|EPJ23313.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    154   9e-40    
ref|WP_014945938.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   9e-40    
ref|WP_016967917.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   9e-40    
ref|WP_014518475.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    154   9e-40    
ref|WP_014944250.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   1e-39    
ref|WP_014946610.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   1e-39    
ref|WP_036984102.1|  hypothetical protein                               146   1e-39    
ref|WP_022331833.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   2e-39    
emb|CDS45871.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synt...    155   2e-39    
ref|XP_743307.1|  GcpE protein                                          154   2e-39    
gb|EUD69889.1|  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synt...    154   2e-39    
ref|WP_022064503.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   2e-39    
ref|WP_012465168.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   2e-39    
ref|WP_035473733.1|  hypothetical protein                               152   2e-39    
ref|WP_016776386.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    153   2e-39    
ref|WP_022309152.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    151   3e-39    
ref|WP_041375130.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    150   3e-39    
gb|AEJ77048.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    152   4e-39    
gb|ABM78180.1|  GcpE protein                                            150   4e-39    
ref|WP_030002905.1|  MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-y...    149   4e-39    
ref|WP_009873526.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   4e-39    
ref|WP_011324544.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   4e-39    
gb|AGT67768.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    152   4e-39    
gb|AEP34867.1|  1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate sy...    152   4e-39    
gb|AGT69620.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase    152   4e-39    
ref|XP_680310.1|  GcpE protein                                          154   4e-39    
ref|WP_015505856.1|  4-hydroxy-3-methylbut-2-en-1-yl diphosphate ...    152   4e-39    



>gb|EPS62642.1| hypothetical protein M569_12144, partial [Genlisea aurea]
Length=182

 Score =   304 bits (779),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI+FPKD HRDDLVI AG+NAG LLVDGLGDG+LLEA D DF+FIRNT
Sbjct  7    LSENSLNFPVIHHIQFPKDTHRDDLVIGAGTNAGGLLVDGLGDGLLLEAADQDFEFIRNT  66

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  67   SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  126

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTV++R IAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  127  EMADADFGYVGGAPGKIDLYVGKTVLRRGIAMEHATEALIQLIKDHGRWVDPPVEE  182



>ref|XP_009797237.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Nicotiana sylvestris]
Length=325

 Score =   307 bits (786),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  150  LSENSLNFPVIHHIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNT  209

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  210  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  269

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP EE
Sbjct  270  EMADADFGYVGGAPGKIDLYVGKTVVKRGIQMEHATDALIQLIKDNGRWVDPPAEE  325



>ref|XP_008246046.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like, partial [Prunus mume]
Length=348

 Score =   306 bits (784),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +NS +FPVIHHI+FP  IHRDDLVI+AG+NAG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  173  LGDNSLNFPVIHHIQFPSGIHRDDLVIAAGTNAGALLVDGLGDGLLLEAADKDFDFLRNT  232

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  233  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  292

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ ATDALI LIK+HGRWVDPP EE
Sbjct  293  EMADADFGYVGGAPGKIDLYVGKTVVKRAIEMEHATDALIQLIKDHGRWVDPPAEE  348



>gb|KDO73256.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73257.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73258.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73259.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73260.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73261.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
 gb|KDO73262.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
Length=275

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ +FPVIHHI+FP  IHRDDLVI AG+N G LLVDGLGDG+LLEAP  DFDF+R+T
Sbjct  100  LSENNLNFPVIHHIQFPNGIHRDDLVIGAGTNVGALLVDGLGDGLLLEAPGQDFDFLRDT  159

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  160  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  219

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+QATDALI LIK+HGRW +PP EE
Sbjct  220  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEQATDALIQLIKDHGRWAEPPAEE  275



>ref|XP_003597229.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=731

 Score =   317 bits (811),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS DFPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  556  LSDNSLDFPVIHHIQFPNGIHRDDLVIGAGSHAGALLVDGLGDGLLLEASDKDFDFLRNT  615

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  616  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  675

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  676  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIDLIKEHGRWVDPPVEE  731



>gb|AES67479.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Medicago truncatula]
Length=740

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS DFPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  565  LSDNSLDFPVIHHIQFPNGIHRDDLVIGAGSHAGALLVDGLGDGLLLEASDKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIDLIKEHGRWVDPPVEE  740



>ref|XP_003597228.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Medicago 
truncatula]
Length=767

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/176 (92%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS DFPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  592  LSDNSLDFPVIHHIQFPNGIHRDDLVIGAGSHAGALLVDGLGDGLLLEASDKDFDFLRNT  651

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  652  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  711

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  712  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIDLIKEHGRWVDPPVEE  767



>gb|AID51432.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Astragalus 
membranaceus]
Length=742

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSE S +FPVIHHI+FP  IHRDDLVI AGSNAG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  567  LSEKSLNFPVIHHIQFPNGIHRDDLVIGAGSNAGALLVDGLGDGILLEASDKDFDFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIDLIKEHGRWVDPPAEE  742



>gb|AEM42998.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Siraitia 
grosvenorii]
Length=740

 Score =   315 bits (806),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ +FPVIHHI+FPK IHRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDF+RNT
Sbjct  565  LAENALNFPVIHHIQFPKGIHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRW+DPPTEE
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMENATDALIQLIKDHGRWIDPPTEE  740



>ref|XP_008344871.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Malus domestica]
Length=201

 Score =   297 bits (761),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHHI+FP  IH DDLVI AG+NAG LLVDGLGDG+LLEAPD DFD++RNT
Sbjct  26   LGDNALNFPVIHHIQFPSGIHGDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDYLRNT  85

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  86   SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  145

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  146  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  201



>gb|AEZ55668.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia miltiorrhiza]
Length=742

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHIEFPK IHRDDLVI AG+NAG LLVDGLGDG+LLE+PD +F+F+RNT
Sbjct  567  LSENSLDFPVIHHIEFPKGIHRDDLVIGAGTNAGALLVDGLGDGILLESPDQEFEFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIR++TSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIRDRTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI+LIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIELIKEHGRWVDPPVEE  742



>gb|AJA39985.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Salvia 
miltiorrhiza f. alba]
Length=742

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHIEFPK IHRDDLVI AG+NAG LLVDGLGDG+LLE+PD +F+F+RNT
Sbjct  567  LSENSLDFPVIHHIEFPKGIHRDDLVIGAGTNAGALLVDGLGDGILLESPDQEFEFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIR++TSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIRDRTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI+LIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIELIKEHGRWVDPPVEE  742



>ref|XP_009803352.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like, partial [Nicotiana sylvestris]
Length=182

 Score =   295 bits (755),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  7    LSENSLNFPVIHHIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNT  66

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  67   SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  126

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGK VVKR I M+ ATDALI LIK++G WVDPP  E
Sbjct  127  EMADADFGYVGGAPGKIDLYVGKAVVKRGIQMEHATDALIQLIKDNGCWVDPPAAE  182



>gb|KJB26175.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=740

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHI+FP   HRDDLVI+AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LSENSLDFPVIHHIQFPNGTHRDDLVINAGTNAGALLVDGLGDGILLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|KJB26176.1| hypothetical protein B456_004G228600 [Gossypium raimondii]
Length=739

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHI+FP   HRDDLVI+AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  564  LSENSLDFPVIHHIQFPNGTHRDDLVINAGTNAGALLVDGLGDGILLEAPDQDFDFLRNT  623

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  624  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  683

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  684  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIQLIKDHGRWVDPPAEE  739



>gb|KHG03611.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gossypium 
arboreum]
Length=740

 Score =   311 bits (798),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHI+FP   HRDDLVI+AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LSENSLDFPVIHHIQFPNGTHRDDLVINAGTNAGALLVDGLGDGILLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_007016723.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007016724.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34342.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
 gb|EOY34343.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase isoform 1 [Theobroma 
cacao]
Length=740

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ DFPVIHHI+FP  IHRDDLVI+AG+NAG LLVDGLGDGVLLEAPD DFDF+RNT
Sbjct  565  LSENALDFPVIHHIQFPNGIHRDDLVINAGTNAGALLVDGLGDGVLLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|ADX06907.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Rauvolfia 
verticillata]
Length=740

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHH++FPK IHRDDLVI AGSNAG LLVDGLGDGV+LEAPD DF+F+RNT
Sbjct  565  LSENSLNFPVIHHMQFPKGIHRDDLVIRAGSNAGALLVDGLGDGVMLEAPDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGINMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|NP_001234648.1| GcpE [Solanum lycopersicum]
 ref|XP_010313199.1| PREDICTED: gcpE isoform X1 [Solanum lycopersicum]
 gb|AAO15447.1|AF435086_1 GcpE [Solanum lycopersicum]
Length=740

 Score =   310 bits (794),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI+FP + HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LSENSLNFPVIHHIQFPSNTHRDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ ATDALI LIK+H RWVDPPTEE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIEMEHATDALIQLIKDHDRWVDPPTEE  740



>ref|XP_002285130.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Vitis vinifera]
 emb|CBI16309.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   310 bits (794),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+N+ +FPVIHHI+FPK IHRDDLVI AG+NAG LLVDGLGDG+LLEAP+ DFDF+RNT
Sbjct  565  LSDNALNFPVIHHIQFPKGIHRDDLVIGAGTNAGALLVDGLGDGLLLEAPEQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_011089897.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089899.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
 ref|XP_011089900.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Sesamum indicum]
Length=742

 Score =   310 bits (794),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+ENS +FPVIHHI+FPKD HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DF+F+RNT
Sbjct  567  LAENSLNFPVIHHIQFPKDTHRDDLVIGAGTNAGALLVDGLGDGILLEAPDQDFEFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ AT+ALI LIK+HGRWVDPP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKTVVKRAIDMEHATEALIQLIKDHGRWVDPPAEE  742



>emb|CAN72185.1| hypothetical protein VITISV_005654 [Vitis vinifera]
Length=740

 Score =   310 bits (793),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+N+ +FPVIHHI+FPK IHRDDLVI AG+NAG LLVDGLGDG+LLEAP+ DFDF+RNT
Sbjct  565  LSDNALNFPVIHHIQFPKGIHRDDLVIGAGTNAGALLVDGLGDGLLLEAPEQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATDALIQLIKDHGRWVDPPAEE  740



>emb|CDP07116.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   309 bits (792),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS DFPVIHHI+FP+ IHRDDLVI AGSNAG LLVDGLGDGVLLEAP+ DF+F+RNT
Sbjct  556  LSENSLDFPVIHHIQFPRAIHRDDLVIGAGSNAGALLVDGLGDGVLLEAPEQDFEFLRNT  615

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  616  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  675

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+QATDALI LIK++GRWV+P  EE
Sbjct  676  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEQATDALIQLIKDNGRWVEPSAEE  731



>gb|AGQ04156.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Lavandula 
angustifolia]
Length=742

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHIEFP +IHRD+LVI AG+NAG LLVDGLGDG+LLEAPD +F+F+RNT
Sbjct  567  LSDNSLNFPVIHHIEFPTEIHRDELVIGAGTNAGALLVDGLGDGILLEAPDQEFEFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEGATDALIQLIKEHGRWVDPPAEE  742



>gb|AHA11129.1| chloroplast 4-hydroxy-3-methylbut-2-enyl diphosphate synthase 
[Picrorhiza kurrooa]
Length=748

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPV+HHI+FPK IHRDDLVI AG+NAG LLVDGLGDG+LLEA D DF+F+RNT
Sbjct  573  LSENSLEFPVVHHIQFPKAIHRDDLVIGAGTNAGGLLVDGLGDGILLEAHDQDFEFLRNT  632

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREK SHLPGVSIAIMGCIV+GPG
Sbjct  633  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKISHLPGVSIAIMGCIVSGPG  692

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALI LIKEHGRWVDPP +E
Sbjct  693  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIQLIKEHGRWVDPPVDE  748



>gb|KHN21521.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=742

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  567  LSDNSLNFPVIHHIQFPNGIHRDDLVIGAGSDAGALLVDGLGDGLLLEAPDKDFEFIRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGTPGKIDLYVGKTVVKRGIAMEHATNALIDLIKEHGRWVDPPAEE  742



>ref|XP_003540178.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Glycine max]
 ref|XP_006592698.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Glycine max]
 ref|XP_006592699.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Glycine max]
Length=741

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  566  LSDNSLNFPVIHHIQFPNGIHRDDLVIGAGSDAGALLVDGLGDGLLLEAPDKDFEFIRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  686  EMADADFGYVGGTPGKIDLYVGKTVVKRGIAMEHATNALIDLIKEHGRWVDPPAEE  741



>ref|XP_003543457.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Glycine max]
Length=742

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  567  LSDNSLNFPVIHHIQFPNGIHRDDLVIGAGSDAGALLVDGLGDGLLLEAPDKDFEFIRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  687  EMADADFGYVGGTPGKIDLYVGKTVVKRGIAMEHATNALIDLIKEHGRWVDPPAEE  742



>ref|XP_004487120.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Cicer arietinum]
Length=740

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS++S +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  565  LSDSSLNFPVIHHIQFPNGIHRDDLVIGAGSHAGALLVDGLGDGLLLEAADKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ ISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQVISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEQATDALIDLIKEHGRWVDPPVEE  740



>ref|XP_010253662.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
 ref|XP_010253663.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nelumbo nucifera]
Length=740

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L++N+ +FPV+HH++FP+ IHRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDF+RNT
Sbjct  565  LADNALNFPVVHHLQFPEGIHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPPTEE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPTEE  740



>gb|KHN11204.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Glycine 
soja]
Length=741

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  566  LSDNSLNFPVIHHIQFPNGIHRDDLVIGAGSDAGALLVDGLGDGLLLEAPDKDFEFIRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  686  EMADADFGYVGGTPGKIDLYVGKTVVKRGIAMEHATNALIDLIKEHGRWVDPPAEE  741



>ref|XP_010535603.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Tarenaya hassleriana]
Length=743

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS DFPVIHHI FPK  +RDDLVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  566  LSDNSLDFPVIHHIHFPKGFNRDDLVIRAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR IAM +ATDALIDLIKEHGRWVDPPTE+
Sbjct  686  EMADADFGYVGGTPGKIDLYVGKTVVKRGIAMAEATDALIDLIKEHGRWVDPPTED  741



>ref|XP_006340201.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Solanum tuberosum]
Length=740

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI+FP + HRDDLVI AG+NAG LLVDGLGDG+LLEAP  DFDF+RNT
Sbjct  565  LSENSLNFPVIHHIQFPSNTHRDDLVIGAGTNAGALLVDGLGDGLLLEAPVKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ ATDALI LIK++GRWVDPPTEE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIEMEHATDALIQLIKDNGRWVDPPTEE  740



>gb|ACT64770.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Artemisia 
annua]
Length=617

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPV+HHI+FPK I RDDLVISAG+NAG LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  442  LSENSLNFPVLHHIKFPKGIPRDDLVISAGANAGALLVDGLGDGILLEAPDQDFEFIRNT  501

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ ISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  502  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQVISAEIREKTSHLPGVSIAIMGCIVNGPG  561

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  562  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDHGRWVDPPVEE  617



>dbj|BAF98296.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hevea brasiliensis]
Length=740

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+N+ +FPVIHHI+FP  IHRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LSDNALNFPVIHHIQFPNAIHRDDLVIGAGTNAGALLVDGLGDGILLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ+ISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQDISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEGATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_009592136.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009592137.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Nicotiana tomentosiformis]
Length=740

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LSENSLNFPVIHHIHFPSDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIQMEHATDALIQLIKDNGRWVDPPKEE  740



>ref|XP_007207209.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
 gb|EMJ08408.1| hypothetical protein PRUPE_ppa002111mg [Prunus persica]
Length=715

 Score =   306 bits (784),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +NS +FPVIHHI+FP  IHRDDLVI+AG+N G LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  540  LGDNSLNFPVIHHIQFPSGIHRDDLVIAAGTNVGALLVDGLGDGLLLEAPDKDFDFLRNT  599

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  600  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  659

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+RAI M+ ATDALI LIK+HGRWVDPP EE
Sbjct  660  EMADADFGYVGGAPGKIDLYVGKTVVRRAIEMEHATDALIQLIKDHGRWVDPPVEE  715



>gb|EYU36193.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=742

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSE S +FPVIHHI+FPK IHRDDLVI AG+NAG LLVDGLGDG+LL+AP  DFDF+RNT
Sbjct  567  LSEKSLNFPVIHHIQFPKGIHRDDLVIGAGTNAGGLLVDGLGDGILLDAPHQDFDFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGK VV+RAIAM+ ATDALI LIK+HGRWV+PP EE
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKEVVRRAIAMEHATDALIQLIKDHGRWVEPPAEE  742



>ref|XP_008349746.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
 ref|XP_008349747.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHHI+FP  IHRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LGDNALNFPVIHHIQFPSGIHRDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|EYU36192.1| hypothetical protein MIMGU_mgv1a001893mg [Erythranthe guttata]
Length=743

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSE S +FPVIHHI+FPK IHRDDLVI AG+NAG LLVDGLGDG+LL+AP  DFDF+RNT
Sbjct  568  LSEKSLNFPVIHHIQFPKGIHRDDLVIGAGTNAGGLLVDGLGDGILLDAPHQDFDFLRNT  627

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  628  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  687

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGK VV+RAIAM+ ATDALI LIK+HGRWV+PP EE
Sbjct  688  EMADADFGYVGGAPGKIDLYVGKEVVRRAIAMEHATDALIQLIKDHGRWVEPPAEE  743



>ref|XP_006424585.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006424586.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 ref|XP_006488107.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X3 [Citrus sinensis]
 gb|ESR37825.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37826.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=741

 Score =   305 bits (782),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ +FPVIHHI+FP  IHRDDLVI AGSN G LLVDGLGDG+LLEAP  DFDF+R+T
Sbjct  566  LSENNLNFPVIHHIQFPNGIHRDDLVIGAGSNVGALLVDGLGDGLLLEAPGQDFDFLRDT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+QATDALI LIK+HGRW +PP EE
Sbjct  686  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEQATDALIQLIKDHGRWAEPPAEE  741



>ref|XP_010043743.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85733.1| hypothetical protein EUGRSUZ_B02495 [Eucalyptus grandis]
Length=740

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L EN+  FPVIHH++FP   HRDDLVI AG+NAG LLVDGLGDGVL+E PD D +F+RNT
Sbjct  565  LQENALTFPVIHHLQFPDGTHRDDLVIGAGTNAGALLVDGLGDGVLIEVPDQDLEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+QATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEQATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_004148774.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Cucumis sativus]
 gb|KGN64731.1| hypothetical protein Csa_1G084300 [Cucumis sativus]
Length=741

 Score =   305 bits (781),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN   FPVIHHI+FP  +HRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDFIRNT
Sbjct  566  LSENGLTFPVIHHIQFPNGVHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDKDFDFIRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALI LIK++GRW +PPTEE
Sbjct  686  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMENATEALIQLIKDNGRWAEPPTEE  741



>ref|XP_008463938.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
 ref|XP_008463947.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Cucumis melo]
Length=741

 Score =   304 bits (779),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN   FPVIHHI+FP  +HRDDLVI AGSNAG LLVDGLGDGVLLEA D DFDFIRNT
Sbjct  566  LSENGLTFPVIHHIQFPNGVHRDDLVIGAGSNAGALLVDGLGDGVLLEAADKDFDFIRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALI LIK++GRWV+PPTEE
Sbjct  686  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMENATEALIQLIKDNGRWVEPPTEE  741



>ref|XP_004295028.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
 ref|XP_011461710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=740

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  ++PVIHHI FP  IHRDDLVISAG+N G LLVDGLGDG+LLEAPD DF+FIRNT
Sbjct  565  LGDNGLNYPVIHHIHFPSGIHRDDLVISAGTNVGALLVDGLGDGLLLEAPDKDFNFIRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIEMEHATDALIQLIKDHGRWVDPPAEE  740



>dbj|BAB09833.1| GcpE protein [Arabidopsis thaliana]
Length=716

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  540  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  599

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  600  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  659

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  660  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  713



>ref|XP_010098198.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
 gb|EXB74654.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Morus notabilis]
Length=978

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+N+ +FPVIHHI FP  IHRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDF+RNT
Sbjct  803  LSDNALNFPVIHHISFPNGIHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDKDFDFLRNT  862

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKT HLPGVSIAIMGCIVNGPG
Sbjct  863  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTLHLPGVSIAIMGCIVNGPG  922

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPPTEE
Sbjct  923  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPTEE  978



>gb|AFQ98370.1| hydroxymethylbutenyl diphosphate synthase [Camellia sinensis]
Length=741

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ D PVIHHI+FPK IHRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDF+RNT
Sbjct  565  LSENALDLPVIHHIQFPKGIHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IRE+TSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREQTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGK VVKR I M+ ATDALI LIK++GRWVDP  EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKMVVKRGIEMEHATDALIQLIKDNGRWVDPAAEE  740



>ref|XP_010456601.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=743

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI+FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  567  LSENSVNFPVIHHIDFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFDFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM  ATDALI LIKEHGRWVDPP 
Sbjct  687  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTGATDALIGLIKEHGRWVDPPV  740



>emb|CDY53637.1| BnaC09g54000D [Brassica napus]
Length=736

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNT
Sbjct  560  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNT  619

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  620  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  679

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  680  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMSEATDALIGLIKEHGRWVDPPV  733



>gb|AAL91150.1| GcpE protein [Arabidopsis thaliana]
 gb|AAQ65096.1| At5g60600 [Arabidopsis thaliana]
Length=741

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  738



>gb|KDP44060.1| hypothetical protein JCGZ_05527 [Jatropha curcas]
Length=740

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+++ +FPVIHHI+FP  IHRDDLVI AG+NAG LLVDGLGDG+LLEAP  DFDF+RNT
Sbjct  565  LSDHALNFPVIHHIQFPNAIHRDDLVIGAGTNAGALLVDGLGDGLLLEAPGQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIDMEGATDALIQLIKDHGRWVDPPAEE  740



>gb|ABB78087.1| (E)-4-hydroxy-3-methyl-but-2-enyl diphosphate synthase [Ginkgo 
biloba]
Length=741

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L E   +FPVIHH+EFP   HRDDLVI+AGS AG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  566  LQETGLNFPVIHHLEFPAGTHRDDLVINAGSEAGALLVDGLGDGLLLEAPDQDFDFLRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKT+HLPGVSIAIMGCIVNGPG
Sbjct  626  SFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTAHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGK VVKR IAMDQATDALI LIK+HGRWVDPP EE
Sbjct  686  EMADADFGYVGGSPGKIDLYVGKEVVKRGIAMDQATDALIQLIKDHGRWVDPPVEE  741



>ref|XP_011044361.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
 ref|XP_011044362.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Populus euphratica]
Length=740

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  565  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLVEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDNGRWVDPPAEE  740



>ref|XP_007150210.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
 gb|ESW22204.1| hypothetical protein PHAVU_005G135800g [Phaseolus vulgaris]
Length=740

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS NS +FPVIHHI+FP   HRDDLVI AGS+AG LLVDGLGDG+LLEA D +F+FIRNT
Sbjct  565  LSNNSLNFPVIHHIQFPNGTHRDDLVIGAGSDAGALLVDGLGDGLLLEATDKEFEFIRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG PGKIDLYVGKTVVKR I M+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  685  EMADADFGYVGGTPGKIDLYVGKTVVKRGIQMEHATNALIDLIKEHGRWVDPPVEE  740



>ref|NP_851233.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 sp|F4K0E8.1|ISPG_ARATH RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; AltName: Full=Protein 
CHLOROPLAST BIOGENESIS 4; AltName: Full=Protein CONSTITUTIVE 
SUBTILISIN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AED97353.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=741

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  738



>ref|NP_200868.2| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AAO15446.1|AF434673_1 GcpE [Arabidopsis thaliana]
 gb|AED97354.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=740

 Score =   302 bits (773),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  564  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  623

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  624  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  683

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  684  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  737



>ref|XP_006400831.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
 dbj|BAJ34115.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42284.1| hypothetical protein EUTSA_v10012774mg [Eutrema salsugineum]
Length=742

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  566  LSENSINFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFDFLRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIR+KTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIRDKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  686  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALISLIKEHGRWVDPPV  739



>gb|AAM19840.1| AT5g60600/mup24_10 [Arabidopsis thaliana]
Length=741

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_010443862.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Camelina sativa]
Length=741

 Score =   301 bits (772),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM  ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTGATDALIGLIKEHGRWVDPPV  738



>emb|CDY31531.1| BnaA10g13400D [Brassica napus]
Length=741

 Score =   301 bits (772),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMSEATDALIGLIKEHGRWVDPPV  738



>ref|XP_009120594.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brassica rapa]
Length=741

 Score =   301 bits (772),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMSEATDALIGLIKEHGRWVDPPV  738



>ref|XP_010483710.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Camelina sativa]
Length=742

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  566  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFDFLRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM  ATDALI LIKEHGRWVDPP 
Sbjct  686  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTGATDALIGLIKEHGRWVDPPV  739



>ref|XP_009335082.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
 ref|XP_009335083.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=740

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+  FPVIHHI+FP  IH DDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  565  LGDNALSFPVIHHIQFPSGIHGDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_009367086.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367087.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
 ref|XP_009367088.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Pyrus x bretschneideri]
Length=740

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHHI+FP  IH DDLVI AG+NAG LLVDGLGDG+LLEAPD DFD++RNT
Sbjct  565  LGDNALNFPVIHHIQFPSGIHGDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDYLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_010689558.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010689559.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=740

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI+FP   HRDDLVI AG+ AG LLVDGLGDGVLLEA D DF+F+RNT
Sbjct  565  LSDNSLNFPVIHHIQFPSGTHRDDLVIRAGTYAGCLLVDGLGDGVLLEARDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALIDLIKEHGRWVDPP EE
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMEHATNALIDLIKEHGRWVDPPVEE  740



>ref|NP_001289212.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, chloroplastic 
[Pyrus x bretschneideri]
 gb|AHM26645.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase protein 
[Pyrus x bretschneideri]
Length=740

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHHI+FP  IH DDLVI AG+NAG LLVDGLGDG+LLEAPD DFD++RNT
Sbjct  565  LGDNALNFPVIHHIQFPSGIHGDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDYLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  740



>ref|XP_002864694.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40953.1| hypothetical protein ARALYDRAFT_919295 [Arabidopsis lyrata subsp. 
lyrata]
Length=741

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS  FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNT
Sbjct  565  LSENSVSFPVIHHINFPTGIHRDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_006854508.1| hypothetical protein AMTR_s00175p00057810 [Amborella trichopoda]
 gb|ERN15975.1| hypothetical protein AMTR_s00175p00057810 [Amborella trichopoda]
Length=741

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L++N+ +FPVIHH++FP   HRDD+VI AG++AG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  566  LADNALNFPVIHHLQFPSGAHRDDVVIGAGTDAGALLVDGLGDGLLLEAPDQDFDFLRNT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M  ATDALI LIK+HGRWVDPP+EE
Sbjct  686  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMAHATDALIQLIKDHGRWVDPPSEE  741



>gb|ABV02021.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Nicotiana 
langsdorffii x Nicotiana sanderae]
Length=164

 Score =   282 bits (722),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -1

Query  627  HIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRN  448
            HI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNTSFNLLQGCRMRN
Sbjct  1    HIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNTSFNLLQGCRMRN  60

Query  447  TKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG  268
            TKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG
Sbjct  61   TKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG  120

Query  267  APGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            APGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP EE
Sbjct  121  APGKIDLYVGKTVVKRGIQMEHATDALIQLIKDNGRWVDPPAEE  164



>ref|XP_006378969.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56766.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=708

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  532  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLIEAPDQDFDFLRNT  591

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  592  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  651

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP  E
Sbjct  652  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMESATDALIQLIKDNGRWVDPPPAE  707



>gb|ACD70401.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase [Populus trichocarpa]
Length=680

 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  504  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLIEAPDQDFDFLRNT  563

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  564  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  623

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP  E
Sbjct  624  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMESATDALIQLIKDNGRWVDPPPAE  679



>ref|XP_006280064.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
 gb|EOA12962.1| hypothetical protein CARUB_v10025946mg [Capsella rubella]
Length=741

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP   HRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGTHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM +ATDALI LIKEHGRWVDPP 
Sbjct  685  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMTEATDALIGLIKEHGRWVDPPV  738



>ref|XP_008807336.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
 ref|XP_008807344.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Phoenix dactylifera]
Length=743

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  +FPVIHHI+FP+ IHRDDLVI+AGS AG LLVDGLGDGVLLEA D DFDF+RNT
Sbjct  568  LEDNVLNFPVIHHIQFPEGIHRDDLVIAAGSYAGALLVDGLGDGVLLEASDHDFDFLRNT  627

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  628  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  687

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ AT+ALI LIK+HGRWVDPPT E
Sbjct  688  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATEALIQLIKDHGRWVDPPTNE  743



>ref|XP_006378968.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56765.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=705

 Score =   298 bits (764),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  529  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLIEAPDQDFDFLRNT  588

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  589  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  648

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP  E
Sbjct  649  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMESATDALIQLIKDNGRWVDPPPAE  704



>ref|XP_006378966.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378967.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_002314268.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 ref|XP_006378970.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56763.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56764.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|EEE88223.2| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56767.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=741

 Score =   299 bits (766),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  565  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLIEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP  E
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMESATDALIQLIKDNGRWVDPPPAE  740



>ref|XP_008359197.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Malus domestica]
Length=740

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ + PVIHHI+FP  IH DDLVI AG+NAG LLVDGLGDG+LLEAPD DFD++RNT
Sbjct  565  LGDNALNXPVIHHIQFPSGIHGDDLVIGAGTNAGALLVDGLGDGLLLEAPDKDFDYLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDHGRWVDPPAEE  740



>gb|AAO24774.1| GCPE protein [Catharanthus roseus]
Length=740

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHH++F   IHRDDLVI AGS+AG LLVDGLGDGV+LEA D DF+F+RNT
Sbjct  565  LSENSLNFPVIHHMQFANAIHRDDLVIGAGSDAGALLVDGLGDGVMLEAHDQDFEFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK+HGRWVDPP E+
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRGIDMEHATDALIQLIKDHGRWVDPPAED  740



>ref|XP_011040872.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Populus euphratica]
Length=247

 Score =   282 bits (721),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L++ +   PVIHHI+FPK + RD+LVI AG++AG  LVDGLGDGVL+EAPD DFDF+RNT
Sbjct  72   LADKALSVPVIHHIQFPKGVRRDELVIGAGTDAGAFLVDGLGDGVLVEAPDQDFDFLRNT  131

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  132  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  191

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ AT ALI LIK++G WVDPP E
Sbjct  192  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATGALIQLIKDNGCWVDPPAE  246



>gb|AAO72576.1| isoprenoid biosynthesis-like protein [Oryza sativa Japonica Group]
Length=608

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHIEFPK ++RDDLVI AG+N G LLVDGLGDGVLLEA D +F+F+R+T
Sbjct  433  LETNGLNFPVIHHIEFPKSVNRDDLVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDT  492

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  493  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  552

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  553  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDHGRWVDPPVEE  608



>gb|ABG75916.2| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Stevia 
rebaudiana]
Length=740

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPV+HHI FPK + RD+LVI+AG+NAG LLVDGLGDG+LL+APD DF+FIRNT
Sbjct  565  LSENSLNFPVLHHITFPKGVPRDELVINAGANAGALLVDGLGDGILLDAPDQDFEFIRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ ISAEIR+KTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQVISAEIRDKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK++GRWVDPP EE
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMENATDALIQLIKDNGRWVDPPVEE  740



>ref|XP_010906493.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906494.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
 ref|XP_010906496.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Elaeis guineensis]
Length=743

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  +FPVIHHI+FP+ IHRDDLVI+AGS AG LLVDGLGDGVLLEA D DFDF+RNT
Sbjct  568  LEDNVLNFPVIHHIQFPEGIHRDDLVITAGSYAGALLVDGLGDGVLLEASDQDFDFLRNT  627

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ+ISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  628  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQDISAQIREKTSHLPGVSIAIMGCIVNGPG  687

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ AT+ALI LIK++GRWVDPPT E
Sbjct  688  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATEALIQLIKDNGRWVDPPTNE  743



>ref|XP_009392271.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=745

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  NS +FPVIHH++FP+ IHRDDLVI AGS+AG LLVDGLGDGVLLEA D +++F+RNT
Sbjct  570  LEGNSLNFPVIHHLQFPEQIHRDDLVIMAGSSAGALLVDGLGDGVLLEASDQEYEFLRNT  629

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  630  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  689

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALI LIK+HGRWVDPP E+
Sbjct  690  EMADADFGYVGGSPGKIDLYVGKTVVKRGIAMEHATEALIQLIKDHGRWVDPPAED  745



>ref|NP_001047365.1| Os02g0603800 [Oryza sativa Japonica Group]
 sp|Q6K8J4.1|ISPG_ORYSJ RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(ferredoxin), chloroplastic; AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD19354.1| putative GCPE protein [Oryza sativa Japonica Group]
 dbj|BAF09279.1| Os02g0603800 [Oryza sativa Japonica Group]
 dbj|BAH00163.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73552.1| hypothetical protein OsI_07973 [Oryza sativa Indica Group]
 gb|EEE57327.1| hypothetical protein OsJ_07430 [Oryza sativa Japonica Group]
Length=744

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHIEFPK ++RDDLVI AG+N G LLVDGLGDGVLLEA D +F+F+R+T
Sbjct  569  LETNGLNFPVIHHIEFPKSVNRDDLVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDT  628

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  629  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  688

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  689  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDHGRWVDPPVEE  744



>ref|XP_006647487.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Oryza brachyantha]
Length=744

 Score =   291 bits (745),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHIEFP  I+RDDLVI AG+N G LLVDGLGDGVLLEA D +F+F+R+T
Sbjct  569  LETNGLNFPVIHHIEFPISINRDDLVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDT  628

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQE+SA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  629  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVSAQIREKTSHLPGVSIAIMGCIVNGPG  688

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  689  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDHGRWVDPPVEE  744



>ref|XP_006384896.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
 gb|ERP62693.1| hypothetical protein POPTR_0004s22010g [Populus trichocarpa]
Length=760

 Score =   291 bits (746),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L + +   PVIHHI+FPK + RDDLVI AG++AG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  585  LVDKALSVPVIHHIQFPKGVRRDDLVIGAGTDAGALLVDGLGDGVLIEAPDQDFDFLRNT  644

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  645  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  704

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            EMADADFGYVGGAPGKIDLYVGKTVVKR I M+ ATDALI LIK++GRWVDPP E
Sbjct  705  EMADADFGYVGGAPGKIDLYVGKTVVKRGIEMEHATDALIQLIKDNGRWVDPPAE  759



>gb|AJA32313.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   291 bits (745),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHH++FP+   RD+LVI+AGS+AG LLVDGLGDGV+LEA D DF F+RNT
Sbjct  570  LEDNTLNFPVIHHLQFPETTERDNLVIAAGSSAGALLVDGLGDGVMLEAADQDFGFLRNT  629

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKT HLPGVSIAIMGCIVNGPG
Sbjct  630  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTLHLPGVSIAIMGCIVNGPG  689

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  690  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEHATEALIQLIKDHGRWVDPPVEE  745



>ref|XP_004487119.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Cicer arietinum]
Length=774

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 166/210 (79%), Gaps = 34/210 (16%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS++S +FPVIHHI+FP  IHRDDLVI AGS+AG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  565  LSDSSLNFPVIHHIQFPNGIHRDDLVIGAGSHAGALLVDGLGDGLLLEAADKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS------------  340
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ ISAEIREKTSHLPGVS            
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQVISAEIREKTSHLPGVSVISPNLMLYNMR  684

Query  339  ----------------------IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV  226
                                  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV
Sbjct  685  LHNKKCPLFYIIINNFCCFPHQIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVV  744

Query  225  KRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            KR IAM+QATDALIDLIKEHGRWVDPP EE
Sbjct  745  KRGIAMEQATDALIDLIKEHGRWVDPPVEE  774



>gb|AHN91473.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Dendrobium 
catenatum]
Length=745

 Score =   290 bits (743),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L ENS + PVIHH++FP    RDDLVI AGS AG LLVDG GDG+L+EA D DFDF+R+T
Sbjct  570  LQENSLNLPVIHHLQFPDGTERDDLVIGAGSEAGALLVDGFGDGILIEAQDHDFDFLRDT  629

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQ+ISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  630  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQDISAQIREKTSHLPGVSIAIMGCIVNGPG  689

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKR IAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  690  EMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEGATEALIQLIKDHGRWVDPPAEE  745



>gb|ACL53652.1| unknown [Zea mays]
 gb|AFW72213.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI FP+ I RD LVI AG+N G LLVDGLGDGV LEA D +F+F+R+T
Sbjct  571  LQANGLNFPVIHHINFPETIDRDGLVIGAGANVGALLVDGLGDGVFLEAADQEFEFLRDT  630

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  631  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  690

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+RAIAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  691  EMADADFGYVGGAPGKIDLYVGKTVVQRAIAMEGATDALIQLIKDHGRWVDPPAEE  746



>gb|AJA32314.1| chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase 
[Narcissus tazetta]
Length=745

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N+ +FPVIHH++F +   RD+LVI+AGS+AG LLVDGLGDGV+LEA D DF F+RNT
Sbjct  570  LEDNTLNFPVIHHLQFSEATERDNLVIAAGSSAGALLVDGLGDGVMLEAADQDFGFLRNT  629

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKT HLPGVSIAIMGCIVNGPG
Sbjct  630  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTLHLPGVSIAIMGCIVNGPG  689

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVVKRAIAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  690  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMEHATEALIQLIKDHGRWVDPPVEE  745



>gb|ACG47448.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=745

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI FP+ I RD LVI AG+N G LLVDGLGDGV LEA D +F+F+R+T
Sbjct  570  LQANGLNFPVIHHINFPETIDRDGLVIGAGANVGALLVDGLGDGVFLEAADQEFEFLRDT  629

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  630  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  689

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+RAIAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  690  EMADADFGYVGGAPGKIDLYVGKTVVQRAIAMEGATDALIQLIKDHGRWVDPPAEE  745



>ref|XP_004169086.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Cucumis sativus]
Length=767

 Score =   289 bits (740),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 163/202 (81%), Gaps = 26/202 (13%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN   FPVIHHI+FP  +HRDDLVI AGSNAG LLVDGLGDGVLLEAPD DFDFIRNT
Sbjct  566  LSENGLTFPVIHHIQFPNGVHRDDLVIGAGSNAGALLVDGLGDGVLLEAPDKDFDFIRNT  625

Query  483  SFNLLQGCRMRNTK--------------------------TEYVSCPSCGRTLFDLQEIS  382
            SFNLLQGCRMRNTK                           EYVSCPSCGRTLFDLQEIS
Sbjct  626  SFNLLQGCRMRNTKPHSKQVLRVFLTKLQLFSITFLHTSLQEYVSCPSCGRTLFDLQEIS  685

Query  381  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQ  202
            AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ 
Sbjct  686  AEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRGIAMEN  745

Query  201  ATDALIDLIKEHGRWVDPPTEE  136
            AT+ALI LIK++GRW +PPTEE
Sbjct  746  ATEALIQLIKDNGRWAEPPTEE  767



>ref|NP_001105676.1| LOC542690 [Zea mays]
 gb|AAT70081.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
 gb|AAT70082.1| hydroxymethylbutenyl 4-diphosphate synthase [Zea mays]
Length=746

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI FP+ I RD LVI AG+N G LLVDGLGDGV LEA D +F+F+R+T
Sbjct  571  LQANGLNFPVIHHINFPETIDRDGLVIGAGANVGALLVDGLGDGVFLEAADQEFEFLRDT  630

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRN KTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  631  SFNLLQGCRMRNAKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  690

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+RAIAM+ ATDALI LIK+HGRWVDPP EE
Sbjct  691  EMADADFGYVGGAPGKIDLYVGKTVVQRAIAMEGATDALIQLIKDHGRWVDPPAEE  746



>ref|XP_003575307.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Brachypodium distachyon]
Length=744

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI+FPK I RD LVI AGSN G LLVDGLGDGVLLEA + +F+F+R+T
Sbjct  569  LETNGLNFPVIHHIDFPKSIDRDGLVIGAGSNVGALLVDGLGDGVLLEATNQEFEFLRDT  628

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  629  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  688

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ AT+ALI LIK+HGRWVDPP EE
Sbjct  689  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATEALIQLIKDHGRWVDPPVEE  744



>ref|XP_004953020.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like [Setaria italica]
Length=746

 Score =   286 bits (733),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI+FPK I RD LVI AG+N G LLVDGLGDGVLLEA D +F+F+R+T
Sbjct  571  LQTNGLNFPVIHHIDFPKTIDRDALVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDT  630

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  631  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  690

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK++GRWVDPP EE
Sbjct  691  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDNGRWVDPPAEE  746



>ref|XP_002454137.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
 gb|EES07113.1| hypothetical protein SORBIDRAFT_04g025290 [Sorghum bicolor]
Length=746

 Score =   286 bits (732),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  +  +FPVIHHI+FPK I RD LVI AG+N G LLVDGLGDGVLLEA D +F+F+R+T
Sbjct  571  LQASGLNFPVIHHIDFPKAIDRDGLVIGAGANVGALLVDGLGDGVLLEAADQEFEFLRDT  630

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  631  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  690

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ ATDALI LIK++GRWVDPP EE
Sbjct  691  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATDALIQLIKDNGRWVDPPAEE  746



>ref|XP_001766565.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
 gb|EDQ68630.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Physcomitrella 
patens]
Length=691

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  DFPVIHH++FP + HRDDLVI AGS AG +LVDGLGDG++LEA D DFDFIRNT
Sbjct  515  LQTNKLDFPVIHHLKFPANTHRDDLVIKAGSEAGAMLVDGLGDGIMLEAADQDFDFIRNT  574

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF +LQGCRMR+TKTEYVSCPSCGRTLFDLQEISAEIREKT HLPGVSIAIMGCIVNGPG
Sbjct  575  SFGMLQGCRMRHTKTEYVSCPSCGRTLFDLQEISAEIREKTDHLPGVSIAIMGCIVNGPG  634

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP-PTE  139
            EMADADFGYVGGAPGKIDLYVGK VV+R IAM  AT+ LI LIKEHGRWVDP PTE
Sbjct  635  EMADADFGYVGGAPGKIDLYVGKEVVRRGIAMAMATNELIGLIKEHGRWVDPEPTE  690



>ref|XP_001755871.1| predicted protein [Physcomitrella patens]
 gb|EDQ79156.1| predicted protein [Physcomitrella patens]
Length=687

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHH++FP + HRDDLVI +GS AG +LVDGLGDGVLLEA D DFDF+RNT
Sbjct  511  LQTNDINFPVIHHLKFPANTHRDDLVIKSGSEAGAMLVDGLGDGVLLEAADLDFDFLRNT  570

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF +LQGCRMRNTKTEYVSCPSCGRTLFDLQ++SAEIREKT HLPGVSIAIMGCIVNGPG
Sbjct  571  SFGMLQGCRMRNTKTEYVSCPSCGRTLFDLQDVSAEIREKTDHLPGVSIAIMGCIVNGPG  630

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP-PTE  139
            EMADADFGYVGGAPGKIDLYVGK VV+R IAM++AT+ LI LIKEHGRWVDP P+E
Sbjct  631  EMADADFGYVGGAPGKIDLYVGKEVVRRGIAMEKATNELIGLIKEHGRWVDPEPSE  686



>ref|XP_001764903.1| predicted protein [Physcomitrella patens]
 gb|EDQ70345.1| predicted protein [Physcomitrella patens]
Length=618

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N+ +FPVIHHI+FP +I+RD+LVI AGS  G +LVDGLGDGVLLEA D DFDF+R +
Sbjct  442  LQTNTLNFPVIHHIKFPANINRDELVIKAGSEVGAMLVDGLGDGVLLEASDLDFDFLRKS  501

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF +LQGCRMRNTKTEYVSCPSCGRTLFDLQ++SAEIREKT HLPGVSIAIMGCIVNGPG
Sbjct  502  SFGMLQGCRMRNTKTEYVSCPSCGRTLFDLQDVSAEIREKTDHLPGVSIAIMGCIVNGPG  561

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP-PTE  139
            EMADADFGYVGGAPGKIDLYVGK VV+R IAM++ATD LI LIKEHGRWVDP PTE
Sbjct  562  EMADADFGYVGGAPGKIDLYVGKEVVRRGIAMEKATDELIRLIKEHGRWVDPEPTE  617



>ref|XP_002973473.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
 gb|EFJ25847.1| hypothetical protein SELMODRAFT_149035 [Selaginella moellendorffii]
Length=690

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  NS  FPVIH++EF + + RDD VI AGS AG LLVDGLGDG+LL+A D DFDF+R+T
Sbjct  514  LQSNSLSFPVIHNLEFKQGLRRDDFVIKAGSEAGALLVDGLGDGILLDAADQDFDFVRST  573

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQ++SAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  574  SFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQDVSAEIREKTSHLPGVSIAIMGCIVNGPG  633

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGGAPGKIDLYVGK VVKR IA DQATDALI LIK+HGRWVDP
Sbjct  634  EMADADFGYVGGAPGKIDLYVGKQVVKRGIAKDQATDALIQLIKDHGRWVDP  685



>ref|XP_002986683.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
 gb|EFJ12246.1| hypothetical protein SELMODRAFT_158184 [Selaginella moellendorffii]
Length=690

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  NS  FPVIH++EF + + RDD VI AGS AG LLVDGLGDG+LL+A D DFDF+R+T
Sbjct  514  LQSNSLSFPVIHNLEFKQGLRRDDFVIKAGSEAGALLVDGLGDGILLDAADQDFDFVRST  573

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQ++SAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  574  SFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQDVSAEIREKTSHLPGVSIAIMGCIVNGPG  633

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGGAPGKIDLYVGK VVKR IA DQATDALI LIK+HGRWVDP
Sbjct  634  EMADADFGYVGGAPGKIDLYVGKQVVKRGIAKDQATDALIQLIKDHGRWVDP  685



>emb|CDY53636.1| BnaC09g53990D [Brassica napus]
Length=183

 Score =   262 bits (669),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -1

Query  600  RDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCP  421
            RD+LVI AG+ AG LLVDGLGDGV+LEAPD DF+F+RNTSFNLLQGCRMRNTKTEYVSCP
Sbjct  17   RDELVIHAGTYAGALLVDGLGDGVMLEAPDQDFEFLRNTSFNLLQGCRMRNTKTEYVSCP  76

Query  420  SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYV  241
            SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYV
Sbjct  77   SCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYV  136

Query  240  GKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            GKTVVKR IAM +ATDALI LIKEH RWVDPP
Sbjct  137  GKTVVKRGIAMSEATDALIGLIKEHDRWVDPP  168



>ref|XP_008225843.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic [Prunus mume]
Length=749

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +NS +FPVIHHI+FP  IHRDDLVI+AG+NAG LLVDGLGDG+LLEA D DFDF+RNT
Sbjct  565  LGDNSLNFPVIHHIQFPSGIHRDDLVIAAGTNAGALLVDGLGDGLLLEAADKDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  684

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDL  178
            EMADADFGYVGGAPGKIDLYVGKTVVKRAI M+ ATDALI L
Sbjct  685  EMADADFGYVGGAPGKIDLYVGKTVVKRAIEMEHATDALIQL  726



>gb|AHG98060.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Plectranthus barbatus]
Length=154

 Score =   253 bits (646),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -1

Query  618  FPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKT  439
            FP  IHRD+LVI AGSNAG LLVDGLGDG+LLEAPD +F+F+RNTSFNLLQGCRMRNTKT
Sbjct  4    FPSAIHRDELVIGAGSNAGGLLVDGLGDGILLEAPDQEFEFLRNTSFNLLQGCRMRNTKT  63

Query  438  EYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG  259
            EY SCPSCG TLFDLQEISAEIRE+TSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG
Sbjct  64   EYASCPSCGGTLFDLQEISAEIRERTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPG  123

Query  258  KIDLYVGKTVVKRAIAMDQATDALIDLIKEH  166
            KIDLYVGKTVVKR IAM+ AT ALI+LIKEH
Sbjct  124  KIDLYVGKTVVKRGIAMEYATTALIELIKEH  154



>gb|AAS75817.1| (E)-4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Nicotiana 
benthamiana]
Length=268

 Score =   252 bits (643),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI FP D HRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  125  LSQNSLNFPVIHHIHFPNDTHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNT  184

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVSIAIMGCIVNGPG
Sbjct  185  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSIAIMGCIVNGPG  244

Query  303  EMADADFGYVGGAPGKIDLYVGKT  232
            EMADADFGYVGGAPGKIDLY GKT
Sbjct  245  EMADADFGYVGGAPGKIDLYDGKT  268



>ref|XP_002530286.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
 gb|EEF32093.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Ricinus communis]
Length=716

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LS+NS +FPVIHHI FP  IHRDDLVI AG+NAG LLVDGLGDG+LLEAPD DFDF+RNT
Sbjct  567  LSDNSLNFPVIHHINFPNGIHRDDLVIGAGANAGALLVDGLGDGILLEAPDQDFDFLRNT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  686

Query  303  EMADADFGYVGGAPGKIDLYVGKTV  229
            EMADADFGYVGGAPGKIDLYVGK V
Sbjct  687  EMADADFGYVGGAPGKIDLYVGKRV  711



>gb|KDO73263.1| hypothetical protein CISIN_1g0046341mg, partial [Citrus sinensis]
Length=240

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ +FPVIHHI+FP  IHRDDLVI AG+N G LLVDGLGDG+LLEAP  DFDF+R+T
Sbjct  100  LSENNLNFPVIHHIQFPNGIHRDDLVIGAGTNVGALLVDGLGDGLLLEAPGQDFDFLRDT  159

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  160  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  219

Query  303  EMADADFGYVGGAPGKIDL  247
            EMADADFGYVGGAPGKIDL
Sbjct  220  EMADADFGYVGGAPGKIDL  238



>ref|XP_006488105.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X1 [Citrus sinensis]
 ref|XP_006488106.1| PREDICTED: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, 
chloroplastic-like isoform X2 [Citrus sinensis]
Length=751

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ +FPVIHHI+FP  IHRDDLVI AGSN G LLVDGLGDG+LLEAP  DFDF+R+T
Sbjct  566  LSENNLNFPVIHHIQFPNGIHRDDLVIGAGSNVGALLVDGLGDGLLLEAPGQDFDFLRDT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  685

Query  303  EMADADFGYVGGAPGKIDLYVGKTV  229
            EMADADFGYVGGAPGKIDLYVGK +
Sbjct  686  EMADADFGYVGGAPGKIDLYVGKVL  710



>ref|XP_001690937.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
 gb|EDP05383.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Chlamydomonas 
reinhardtii]
Length=681

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  +    PVIH I FP    RD++VI+ GS  G LLVDGLGDG ++E P  D DF+R T
Sbjct  497  LKRHGITTPVIHRITFPAGTVRDEIVITTGSLVGGLLVDGLGDGAMVECPGEDTDFLRTT  556

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            +F LLQGCRMRN KTEYVSCPSCGRTLF+LQE++ +IR +T HLPGV+IA+MGCIVNGPG
Sbjct  557  AFGLLQGCRMRNIKTEYVSCPSCGRTLFNLQEVTDQIRTRTGHLPGVAIAVMGCIVNGPG  616

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE*YHH  124
            EMADADFGYVGGAPGKIDLYVGK VV+R I M+ A D LI+LIKEHGRWV+P  EE    
Sbjct  617  EMADADFGYVGGAPGKIDLYVGKEVVRRGIPMESACDQLIELIKEHGRWVEPAVEEESKE  676

Query  123  LMFT  112
            L+ T
Sbjct  677  LVAT  680



>gb|AAX54905.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Chlamydomonas reinhardtii]
Length=681

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  +    PVIH I FP    RD++VI+ GS  G LLVDGLGDG ++E P  D DF+R T
Sbjct  497  LKRHGITTPVIHRITFPAGTVRDEIVITTGSLVGGLLVDGLGDGAMVECPGEDTDFLRTT  556

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            +F LLQGCRMRN KTEYVSCPSCGRTLF+LQE++ +IR +T HLPGV+IA+MGCIVNGPG
Sbjct  557  AFGLLQGCRMRNIKTEYVSCPSCGRTLFNLQEVTDQIRTRTGHLPGVAIAVMGCIVNGPG  616

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE*YHH  124
            EMADADFGYVGGAPGKIDLYVGK VV+R I M+ A D LI+LIKEHGRWV+P  EE    
Sbjct  617  EMADADFGYVGGAPGKIDLYVGKEVVRRGIPMESACDQLIELIKEHGRWVEPAVEEESKE  676

Query  123  LMFT  112
            L+ T
Sbjct  677  LVAT  680



>gb|ABG74579.1| isoprenoid biosynthesis-like protein [Musa acuminata AAA Group]
Length=120

 Score =   225 bits (573),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EA D +++F+RNTSFNLLQGCRMRNTK EYVSCPSCGRTLFDLQEISA+IREKTSHLPGV
Sbjct  3    EASDQEYEFLRNTSFNLLQGCRMRNTKAEYVSCPSCGRTLFDLQEISAQIREKTSHLPGV  62

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKE  169
            SIAIMGCIVNGPGEMADADFGYVGG+PGKIDLYVGKTVVKR IAM+ AT+ALI LIKE
Sbjct  63   SIAIMGCIVNGPGEMADADFGYVGGSPGKIDLYVGKTVVKRGIAMEHATEALIQLIKE  120



>gb|KIZ04819.1| hypothetical protein MNEG_3143 [Monoraphidium neglectum]
Length=541

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +     PV+HHI F +   RD++VI+ GS  G LLVDGLGDG ++EAP  D +F+R T
Sbjct  355  LKDAGVTIPVVHHIRFGEGAVRDEIVINTGSMVGGLLVDGLGDGAMIEAPHEDPEFLRTT  414

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            +F LLQG RMRN KTEYVSCPSCGRTLFDLQE++ +IR+KT HLPGV+IA+MGCIVNGPG
Sbjct  415  AFGLLQGSRMRNIKTEYVSCPSCGRTLFDLQEVTEQIRQKTGHLPGVAIAVMGCIVNGPG  474

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            EMADADFGYVGGAPGKIDLYVGK VVKRAI M+ A D L+ LIK++GRWV+PP
Sbjct  475  EMADADFGYVGGAPGKIDLYVGKEVVKRAIPMESACDQLVQLIKDNGRWVEPP  527



>ref|XP_005650225.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
 gb|EIE25681.1| putative chloroplast 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate 
synthase precursor [Coccomyxa subellipsoidea C-169]
Length=748

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  +  D PVIH   FP  + RD+LV+++G+  G LLVDGLGDGV +E P  D DF+R  
Sbjct  555  LQSHDIDIPVIHQRVFPAGVSRDELVLTSGTEIGALLVDGLGDGVAIECPSEDLDFLRTM  614

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF LLQG RMRNTKTEYVSCPSCGRTLFDLQE++ +IR +T HLPGVSIA+MGCIVNGPG
Sbjct  615  SFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTEQIRTQTGHLPGVSIAVMGCIVNGPG  674

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGGAPGKIDLYVGK VV+R I MD A D L++LIKEHGRW +P
Sbjct  675  EMADADFGYVGGAPGKIDLYVGKEVVRRGIPMDGACDQLVELIKEHGRWKEP  726



>ref|XP_002953482.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
 gb|EFJ45455.1| hypothetical protein VOLCADRAFT_63610 [Volvox carteri f. nagariensis]
Length=679

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PVIH+I FP   HRD++VI+ GS  G LLVDGLGDG L+E P  D DF+R T+F LLQG 
Sbjct  501  PVIHNIRFPAGTHRDEIVINTGSLVGGLLVDGLGDGALIECPGEDLDFLRTTAFGLLQGS  560

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMRNTKTEYVSCPSCGRTLF+LQE++ +IR++T HLPGV+IA+MGCIVNGPG MADADFG
Sbjct  561  RMRNTKTEYVSCPSCGRTLFNLQEVTDQIRQRTGHLPGVAIAVMGCIVNGPGRMADADFG  620

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  157
            YVGGAPGKIDLYVGK VV+RAI M+ A D LI+LIKE+GRW
Sbjct  621  YVGGAPGKIDLYVGKEVVRRAIPMESACDQLIELIKEYGRW  661



>ref|XP_002506236.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67494.1| predicted protein [Micromonas sp. RCC299]
Length=697

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PVIHHI+F     +DD+VI +GS  G LL DGLGDGVL+E P ++ D++R TSF LLQG 
Sbjct  525  PVIHHIQFTDADVKDDIVIQSGSQVGGLLCDGLGDGVLIEHPTAELDYLRRTSFGLLQGS  584

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMRNTKTEYVSCPSCGRTLFDLQE++A I E+T HLPGV+IA+MGCIVNGPGEMADADFG
Sbjct  585  RMRNTKTEYVSCPSCGRTLFDLQEVTAAISERTGHLPGVAIAVMGCIVNGPGEMADADFG  644

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            YVGGAPGKIDLYVGK VVKR I  D A D LI LIK+HGRWVD
Sbjct  645  YVGGAPGKIDLYVGKEVVKRGIDNDTACDELIQLIKDHGRWVD  687



>ref|XP_005841109.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
 gb|EKX54129.1| hypothetical protein GUITHDRAFT_63981 [Guillardia theta CCMP2712]
Length=679

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L ENS D PVIHHI F  D  RD +V+  GS  G  LVDG GDGVL++AP    DF+R +
Sbjct  499  LKENSIDTPVIHHIVFGADKSRDYVVLLTGSEVGCSLVDGNGDGVLMQAP-LPLDFLRLS  557

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQ ++ +I + T HLPGV+IA+MGCIVNGPG
Sbjct  558  SFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQTVTDQISKATGHLPGVTIAVMGCIVNGPG  617

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGK +V++AI  ++A D LI+LIKE+GRWV+P   E
Sbjct  618  EMADADFGYVGGAPGKIDLYVGKELVRKAIPSEKACDELIELIKENGRWVEPSKNE  673



>ref|XP_011400578.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
 gb|KFM27595.1| 26S proteasome non-ATPase regulatory subunit 1 [Auxenochlorella 
protothecoides]
Length=1584

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = -1

Query  663   LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
             L+      PV+H +EF     R++LV+SAG+  G L+VDG GDGV+L AP  D  ++R T
Sbjct  1396  LTRARCHLPVVHALEFAPGTGREELVLSAGALVGALMVDGRGDGVMLSAPGQDLAYLRTT  1455

Query  483   SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
             SF LLQG RMRNTKT+YVSCPSCGRTLFDLQE++ +IR+KT HLPGV+IAIMGCIVNGPG
Sbjct  1456  SFGLLQGVRMRNTKTDYVSCPSCGRTLFDLQEVTDQIRQKTGHLPGVAIAIMGCIVNGPG  1515

Query  303   EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
             EMADADFGYVGGAPGKIDLYVGK VV+RAI M+ A D L++LIKEHGRW D
Sbjct  1516  EMADADFGYVGGAPGKIDLYVGKEVVRRAIPMESACDQLVELIKEHGRWKD  1566



>ref|XP_003081089.1| putative chloroplast 1-hydroxy-2-methyl-2-(ISS) [Ostreococcus 
tauri]
 emb|CAL55258.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, bacterial-type 
[Ostreococcus tauri]
Length=726

 Score =   228 bits (580),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 138/173 (80%), Gaps = 5/173 (3%)
 Frame = -1

Query  642  FPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE----APDSDFDFIRNTSFN  475
             PVIHH+  P    R D+VI +G+  G LL DGLGDGVL++    A D   DF+R TSF 
Sbjct  552  LPVIHHMFMPSG-DRSDVVIQSGAQIGGLLCDGLGDGVLIQYTGAAKDISLDFLRTTSFG  610

Query  474  LLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMA  295
            LLQG RMRNTKTEYVSCPSCGRTLFDLQE++A+I+EKT HLPGV+IA+MGCIVNGPGEMA
Sbjct  611  LLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAQIQEKTGHLPGVAIAVMGCIVNGPGEMA  670

Query  294  DADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            DADFGYVGGAPGKIDLYVGK VV+R IA + A D LI+LIKEHGRW D   EE
Sbjct  671  DADFGYVGGAPGKIDLYVGKEVVRRGIASEVACDELIELIKEHGRWKDKEVEE  723



>ref|XP_001419500.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl  4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
 gb|ABO97793.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
chloroplast precursor (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate 
synthase) (ISPG) [Ostreococcus lucimarinus CCE9901]
Length=680

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 141/180 (78%), Gaps = 5/180 (3%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSD----FDF  496
            +++     PVIHH+  P    + D+VI +GS  G LLVDG GDGVL++   SD     DF
Sbjct  498  MAQVGAKMPVIHHMYMPTG-DKSDIVIQSGSQVGGLLVDGFGDGVLIQYAGSDKDVSLDF  556

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            +R TSF LLQG RMRNTKTEYVSCPSCGRTLFDLQE++A+I+EKT HLPGV+IA+MGCIV
Sbjct  557  LRTTSFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAQIQEKTGHLPGVAIAVMGCIV  616

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            NGPGEMADADFGYVGGAPGKIDLYVGK VVKR IAM+ A D LI LIK++ RW++   EE
Sbjct  617  NGPGEMADADFGYVGGAPGKIDLYVGKEVVKRGIAMETACDELIQLIKDNDRWIEKEVEE  676



>gb|KDD76259.1| GcpE, partial [Helicosporidium sp. ATCC 50920]
Length=204

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 138/191 (72%), Gaps = 20/191 (10%)
 Frame = -1

Query  651  SXDFPVI-HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDS-----------  508
            + D PV+ H+ +  +   R+ L+ +AGS  G LL+D LGDGVL+EA              
Sbjct  1    AADVPVVLHYRDLAERADREGLIFNAGSQLGALLMDALGDGVLVEAARGEAAEGEDVKRE  60

Query  507  --------DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHL  352
                    D  F+++T+F +LQG RMR+TKTEYVSCPSCGRTLFDLQE++A+I+ +T HL
Sbjct  61   DVGLEAPVDLAFLKDTAFGVLQGARMRSTKTEYVSCPSCGRTLFDLQEVTAQIKRRTGHL  120

Query  351  PGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIK  172
            PGV+IA+MGCIVNGPGEMADADFGYVGGAPGKIDLYV K V+KR + M+ A D LI+LIK
Sbjct  121  PGVAIAVMGCIVNGPGEMADADFGYVGGAPGKIDLYVNKDVIKRGVPMEHACDELIELIK  180

Query  171  EHGRWVDPPTE  139
             HGRW DPP E
Sbjct  181  AHGRWQDPPVE  191



>ref|XP_003056663.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58308.1| predicted protein [Micromonas pusilla CCMP1545]
Length=732

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PVIH+++F     +D +VI +G+ AG LL DGLGDGV++E P     ++R TSF LLQG 
Sbjct  559  PVIHNMQFDASAEKDTVVIESGAQAGGLLCDGLGDGVVVEHPGVPLSYLRTTSFGLLQGS  618

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMRNTKTEYVSCPSCGRTLFDLQE++A I E+T HLPGV+IA+MGCIVNGPGEMADADFG
Sbjct  619  RMRNTKTEYVSCPSCGRTLFDLQEVTAAISERTGHLPGVAIAVMGCIVNGPGEMADADFG  678

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  157
            YVGGAPGKIDLYVGK VVKR I  D A D LI LIK+HGRW
Sbjct  679  YVGGAPGKIDLYVGKEVVKRGIDNDTACDELIQLIKDHGRW  719



>emb|CBJ30926.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, chloroplast 
precursor [Ectocarpus siliculosus]
Length=695

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 140/179 (78%), Gaps = 3/179 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFP--KDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIR  490
            L++   D  VIH   FP   ++ +D  ++S G+  G  LVDGLGDGV+++AP  D   +R
Sbjct  512  LADAKNDLAVIHLASFPDASEMTQDKFILSVGAQVGGCLVDGLGDGVMVQAPGLDVGMLR  571

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
            +  F LLQGCRMRNTKTEYVSCPSCGRTLFDLQE++A+I EKT HLPGV+IAIMGCIVNG
Sbjct  572  SVCFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQEVTAQIAEKTGHLPGVAIAIMGCIVNG  631

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP-PTEE  136
             GEMADADFGYVGGAPGK+DLYVGK +V++ I  ++A DALIDLIK +GRWVD  P EE
Sbjct  632  VGEMADADFGYVGGAPGKVDLYVGKEMVQKGIPNEEACDALIDLIKANGRWVDKEPAEE  690



>ref|XP_007510861.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18394.1| predicted protein [Bathycoccus prasinos]
Length=745

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 135/175 (77%), Gaps = 4/175 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSD---FDFI  493
            L  N    PVIHH     D  + D+VI  G+  G LL DG GDGVLLE   ++     F+
Sbjct  564  LQANGVKIPVIHHKHIV-DGDKSDVVIQCGAQVGGLLCDGNGDGVLLEYVGNEKIPLSFL  622

Query  492  RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVN  313
            R TSF LLQG RMRNTKTEYVSCPSCGRTLFDLQE++A+I EKT HLPGV+IA+MGCIVN
Sbjct  623  RTTSFGLLQGSRMRNTKTEYVSCPSCGRTLFDLQEVTAQIAEKTGHLPGVAIAVMGCIVN  682

Query  312  GPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GPGEMADADFGYVGGAPGKIDLYVGK VV+R I M+ AT+ LI+LIKEH RWV+P
Sbjct  683  GPGEMADADFGYVGGAPGKIDLYVGKEVVRRGIPMEGATEELIELIKEHDRWVEP  737



>gb|ACI45948.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase precursor [Guillardia theta]
Length=276

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  504  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  325
             DF+R +SF LLQGCRMRNTKTEYVSCPSCGRTLFDLQ ++ +I + T HLPG +IA+MG
Sbjct  148  LDFLRLSSFGLLQGCRMRNTKTEYVSCPSCGRTLFDLQTVTDQISKATGHLPGATIAVMG  207

Query  324  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            CIVNGPGEMADADFGYVGGAPGKIDLYVGK +V++AI  ++A D LI+LIKE+GRWV+P 
Sbjct  208  CIVNGPGEMADADFGYVGGAPGKIDLYVGKELVRKAIPSEKACDELIELIKENGRWVEPS  267

Query  144  TEE  136
              E
Sbjct  268  KNE  270



>gb|EMT15013.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Aegilops 
tauschii]
Length=723

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 131/176 (74%), Gaps = 19/176 (11%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  N  +FPVIHHI+FPK I RD LVI AGSN G LLVDGLGDGVLLEA   +F+F+R+T
Sbjct  567  LETNGLNFPVIHHIDFPKSIDRDGLVIGAGSNVGALLVDGLGDGVLLEAASQEFEFLRDT  626

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKT                    +    + +L    IAIMGCIVNGPG
Sbjct  627  SFNLLQGCRMRNTKT-------------------VKHWPDSLYLCSWQIAIMGCIVNGPG  667

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ AT+ALI LIK+HGRWVDPPT+E
Sbjct  668  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATEALIQLIKDHGRWVDPPTDE  723



>gb|KFG49560.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii GAB2-2007-GAL-DOM2]
Length=856

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  738  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  797

Query  300  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  798  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  851



>gb|KFH07783.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii MAS]
Length=848

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  730  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  789

Query  300  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  790  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  843



>gb|KFG35221.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii p89]
Length=848

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  730  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  789

Query  300  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  790  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  843



>gb|KFG65470.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Toxoplasma gondii RUB]
Length=893

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  775  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  834

Query  300  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  835  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  888



>gb|KFH10447.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Toxoplasma gondii VAND]
Length=892

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480  FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
            FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  774  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  833

Query  300  MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  834  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  887



>gb|EMS56222.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Triticum 
urartu]
Length=665

 Score =   202 bits (514),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 128/176 (73%), Gaps = 33/176 (19%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L  +  +FPVIHHI+FPK I RD LVI AGSN G LLVDGLGDGVLLEA + +F+F+R+T
Sbjct  523  LETSGLNFPVIHHIDFPKSIDRDGLVIGAGSNVGALLVDGLGDGVLLEAGNQEFEFLRDT  582

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQGCRMRNTKT                                 IAIMGCIVNGPG
Sbjct  583  SFNLLQGCRMRNTKT---------------------------------IAIMGCIVNGPG  609

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKIDLYVGKTVV+R IAM+ AT+ALI LIK+HGRWVDPPTEE
Sbjct  610  EMADADFGYVGGAPGKIDLYVGKTVVQRGIAMEGATEALIQLIKDHGRWVDPPTEE  665



>ref|XP_005848392.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
 gb|EFN56290.1| hypothetical protein CHLNCDRAFT_144676 [Chlorella variabilis]
Length=698

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 125/173 (72%), Gaps = 14/173 (8%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +     PVIHHI FP    RDD+V+ +GS  G L+VDG GDG+++E    D D++R T
Sbjct  523  LQQQGISIPVIHHITFPDGTTRDDIVLQSGSMVGALMVDGYGDGLVVECASEDTDYLRTT  582

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            +F LLQGCRMRNTKTEY              E++ +IR +T HLPGVSIA+MGCIVNGPG
Sbjct  583  AFGLLQGCRMRNTKTEY--------------EVTDQIRTRTGHLPGVSIAVMGCIVNGPG  628

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            EMADADFGYVGGAPGKIDLYVGK VV+R I  + A D LIDLIKEHGRW +PP
Sbjct  629  EMADADFGYVGGAPGKIDLYVGKEVVRRNIPNESACDELIDLIKEHGRWQEPP  681



>gb|KFG52681.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii FOU]
Length=1286

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1168  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1227

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1228  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1281



>gb|ESS31948.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii VEG]
Length=1283

 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>gb|EPR62596.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii GT1]
Length=1283

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>ref|XP_002365345.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Toxoplasma gondii ME49]
 gb|EPT29635.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Toxoplasma 
gondii ME49]
Length=1283

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+RNTKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1165  FNLLQACRLRNTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1224

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+DLIK+HGRWVDPP E
Sbjct  1225  MADADFGYVGGAPGKVDLYVKKKVVKRGISSAEACDALVDLIKQHGRWVDPPKE  1278



>emb|CDZ80220.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Chlamydia 
sp. 'Rubis']
Length=653

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PVI  + F   + ++DL+I A +  G LL DGLGDG+ ++A + D +FIRN SF++LQ  
Sbjct  483  PVI--LSFTYLVPKEDLIIQAAAECGALLCDGLGDGIWIQAQE-DINFIRNLSFSILQAA  539

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMR +KT+++SCPSCGRTLFDLQE+S  IR +TSHLPGV IAIMGCIVNGPGEMADADFG
Sbjct  540  RMRTSKTDFISCPSCGRTLFDLQEVSKRIRLRTSHLPGVKIAIMGCIVNGPGEMADADFG  599

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            YVG  PG IDLYVGK  V++ I  +QA D L++LIK+HGRWV+P
Sbjct  600  YVGSKPGMIDLYVGKECVEKDITFEQADDRLVELIKKHGRWVEP  643



>ref|XP_002292108.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90959.1| gcpe-like protein [Thalassiosira pseudonana CCMP1335]
Length=686

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE-APDSDF--DFI  493
            L  N  + P IHH +       +DL +  G+  G+LL DG GDG+L+E   +++F  +F+
Sbjct  501  LKTNEINVPAIHHYK-SSVADSNDLALELGTKIGSLLTDGNGDGILIEQVGETNFSVEFL  559

Query  492  RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVN  313
            RNT F+LLQGCRMRNTKTE+VSCPSCGRTLFDLQE +A+I E T HLPGV++A+MGCIVN
Sbjct  560  RNTGFSLLQGCRMRNTKTEFVSCPSCGRTLFDLQETTAKITEATGHLPGVTVAVMGCIVN  619

Query  312  GPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  157
            GPGEMADADFGYVG  PGK+DLY GK VV++ I  D A ++L++LIKE+G W
Sbjct  620  GPGEMADADFGYVGTLPGKVDLYYGKEVVRKNIPNDDAVESLVELIKEYGMW  671



>ref|XP_009035331.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
 gb|EGB10547.1| hypothetical protein AURANDRAFT_71112 [Aureococcus anophagefferens]
Length=2166

 Score =   199 bits (507),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 134/166 (81%), Gaps = 6/166 (4%)
 Frame = -1

Query  636  VIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLE---APDSDFD--FIRNTSFNL  472
            V+HH+  P +  R +L +  G  AG LL DGLGDGVL+E   A  ++FD  ++R+TSF L
Sbjct  595  VVHHLRAP-ECDRSELALQLGMQAGGLLGDGLGDGVLVEPEVANTANFDVAYLRDTSFAL  653

Query  471  LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMAD  292
            LQG RMRNTKTE+VSCPSCGRTLFDLQE++A+I EKT HLPGV+IAIMGCIVNGPGEMAD
Sbjct  654  LQGSRMRNTKTEFVSCPSCGRTLFDLQEVTAQISEKTGHLPGVAIAIMGCIVNGPGEMAD  713

Query  291  ADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  154
            ADFGYVG  PGKIDLYVGKTVV++ I  + A DALI LIK++G+WV
Sbjct  714  ADFGYVGTVPGKIDLYVGKTVVEKGIPDELACDALIQLIKDNGKWV  759



>ref|XP_008882873.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hammondia 
hammondi]
 gb|KEP66165.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Hammondia 
hammondi]
Length=1284

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+R+TKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1166  FNLLQACRLRSTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1225

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I+  +A DAL+ LIK+HGRWVDPP E
Sbjct  1226  MADADFGYVGGAPGKVDLYVKKRVVKRGISSAEACDALVALIKQHGRWVDPPKE  1279



>ref|XP_003882784.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, related 
[Neospora caninum Liverpool]
 emb|CBZ52752.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, related 
[Neospora caninum Liverpool]
Length=1294

 Score =   198 bits (503),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -1

Query  480   FNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGE  301
             FNLLQ CR+R+TKTE++SCPSCGRTLFD+Q++SAEIR +T HLPGV+IA+MGCIVNG GE
Sbjct  1175  FNLLQACRLRSTKTEFISCPSCGRTLFDIQKVSAEIRRRTGHLPGVTIAVMGCIVNGVGE  1234

Query  300   MADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
             MADADFGYVGGAPGK+DLYV K VVKR I   +A DAL+ LIK+HGRWVDPP E
Sbjct  1235  MADADFGYVGGAPGKVDLYVKKKVVKRGIPSAEACDALVALIKQHGRWVDPPKE  1288



>ref|XP_005783224.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
 gb|EOD30795.1| hypothetical protein EMIHUDRAFT_442353 [Emiliania huxleyi CCMP1516]
Length=780

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
            DF+R TSF LLQG RMR+TKTE+VSCPSCGRTLFDLQE++A+I  +T HLPGV+IAIMGC
Sbjct  649  DFLRTTSFGLLQGARMRSTKTEFVSCPSCGRTLFDLQEVTAQISSRTGHLPGVAIAIMGC  708

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRW  157
            IVNGPGEMADADFGYVGGAPGK+DLYVGK VV+R I  + A D LI+LIKE+G W
Sbjct  709  IVNGPGEMADADFGYVGGAPGKVDLYVGKEVVRRGIPNEDACDQLIELIKENGMW  763



>ref|XP_002179061.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|ACI45957.1| putative chloroplast 4-hydroxy-3-methylbut-2-en-1-yl diphosphate 
synthase precursor [Phaeodactylum tricornutum]
 gb|EEC49759.1| 1-hydroxy-2-methyl-2-(E)-butenyl-4-diphosphate synthase [Phaeodactylum 
tricornutum CCAP 1055/1]
Length=757

 Score =   194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 126/176 (72%), Gaps = 7/176 (4%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvd-----glgdgvlLEAPDSDFD  499
               N  +  VIHH E   +   ++L +  G+  G+LL D      + + V  E P S  D
Sbjct  568  FKSNDIETAVIHHFESNTN-DANELALQVGTKIGSLLTDGNGDGIMIEQVGEEKPFS-VD  625

Query  498  FIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCI  319
            F+R TSF+LLQG RMRNTKTE+VSCPSCGRTLFDLQE +A I+E T HLPGV++A+MGCI
Sbjct  626  FLRRTSFSLLQGSRMRNTKTEFVSCPSCGRTLFDLQETTAGIQEATGHLPGVTVAVMGCI  685

Query  318  VNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            VNGPGEMADADFGYVG  PGK+DLY GK VV++++   +A DALIDLIKE+G W D
Sbjct  686  VNGPGEMADADFGYVGTLPGKVDLYYGKEVVRKSVPNAEAVDALIDLIKEYGMWKD  741



>gb|EFB40485.1| hypothetical protein pah_c200o034 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=632

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 126/164 (77%), Gaps = 3/164 (2%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PV+ H  +  +  ++DL+I A +  G LL DGLG+G+ +EAP  + DF+R  SFN+LQ  
Sbjct  461  PVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIWIEAP-HELDFLRQLSFNILQAA  517

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPGV IAIMGCIVNGPGEMADADFG
Sbjct  518  RMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPGVKIAIMGCIVNGPGEMADADFG  577

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            YVG  PG IDLY+GK  V++ I   +A D L++LIK HGRWV+P
Sbjct  578  YVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRHGRWVEP  621



>ref|WP_036746476.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=656

 Score =   193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 126/164 (77%), Gaps = 3/164 (2%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGC  460
            PV+ H  +  +  ++DL+I A +  G LL DGLG+G+ +EAP  + DF+R  SFN+LQ  
Sbjct  485  PVMLHFTYVSN--KEDLIIQAAAEFGALLCDGLGEGIWIEAP-HELDFLRQLSFNILQAA  541

Query  459  RMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFG  280
            RMR +KT+++SCPSCGRTLFDLQ++S  IR +T+HLPGV IAIMGCIVNGPGEMADADFG
Sbjct  542  RMRISKTDFISCPSCGRTLFDLQDVSRNIRNRTAHLPGVKIAIMGCIVNGPGEMADADFG  601

Query  279  YVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            YVG  PG IDLY+GK  V++ I   +A D L++LIK HGRWV+P
Sbjct  602  YVGSKPGMIDLYLGKQCVEKDIPFSEAVDRLVELIKRHGRWVEP  645



>ref|WP_013925438.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
 emb|CCB87188.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae UV-7]
Length=656

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  603  HRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSC  424
            +++DL+I A +  G LL DGLG+G+ +EAP  + DF+R  SFN+LQ  RMR +KT+++SC
Sbjct  495  NKEDLIIQAAAEFGALLCDGLGEGIWIEAP-HELDFLRQLSFNILQAARMRISKTDFISC  553

Query  423  PSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY  244
            PSCGRTLFDLQ++S  IR +T+HLPGV IAIMGCIVNGPGEMADADFGYVG  PG IDLY
Sbjct  554  PSCGRTLFDLQDVSRNIRNRTAHLPGVKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLY  613

Query  243  VGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            +GK  V++ I   +A D L++LIK HGRWV+P
Sbjct  614  LGKQCVEKDIPFSEAVDRLVELIKRHGRWVEP  645



>gb|KIA77148.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydia 
acanthamoebae]
Length=673

 Score =   191 bits (486),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -1

Query  603  HRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSC  424
            +++DL+I A +  G LL DGLG+G+ +EAP  + DF+R  SFN+LQ  RMR +KT+++SC
Sbjct  512  NKEDLIIQAAAEFGALLCDGLGEGIWIEAP-HELDFLRQLSFNILQAARMRISKTDFISC  570

Query  423  PSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLY  244
            PSCGRTLFDLQ++S  IR +T+HLPGV IAIMGCIVNGPGEMADADFGYVG  PG IDLY
Sbjct  571  PSCGRTLFDLQDVSRNIRNRTAHLPGVKIAIMGCIVNGPGEMADADFGYVGSKPGMIDLY  630

Query  243  VGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            +GK  V++ I   +A D L++LIK HGRWV+P
Sbjct  631  LGKQCVEKDIPFSEAVDRLVELIKRHGRWVEP  662



>ref|WP_042103571.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Parachlamydiaceae 
bacterium HS-T3]
Length=649

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 129/172 (75%), Gaps = 3/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            + ++    PVI  + F     ++DL+I A +  G+LL DGLG+G+ LE P  + +F+RN 
Sbjct  476  MKDHQLAIPVI--LNFRYSCSKEDLIIHASAECGSLLCDGLGEGLWLEGPYEN-NFLRNL  532

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFNLLQ  RMR  KT+++SCPSCGRTLFDLQ++S  IR +T+HLPGV IAIMGCIVNGPG
Sbjct  533  SFNLLQAARMRTFKTDFISCPSCGRTLFDLQDVSKRIRSRTAHLPGVKIAIMGCIVNGPG  592

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG  PG IDLYVGK  V++ I+  +A D LIDLIK++ RW++P
Sbjct  593  EMADADFGYVGSKPGMIDLYVGKKCVEKDISFAEADDRLIDLIKKYDRWIEP  644



>ref|WP_039385010.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
 gb|KIC75889.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. TUME1]
Length=638

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N    PVI  + F     ++DLVI A    G L  DGLG+G+ L+ P  D +++R+ 
Sbjct  467  LKQNQIGIPVI--LNFHYSCSQEDLVIQASMEYGALFCDGLGEGIWLDVP-QDINYLRHL  523

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SFN+LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV IAIMGCIVNGPG
Sbjct  524  SFNILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVKIAIMGCIVNGPG  583

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K HGRW +P
Sbjct  584  EMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSHGRWQEP  635



>gb|EJK67655.1| hypothetical protein THAOC_11283, partial [Thalassiosira oceanica]
Length=756

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 119/175 (68%), Gaps = 5/175 (3%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdgl----gdgvlLEAPDSDFDF  496
               N  + P IHH +   D   +++ +  G+  G+LL DG         + E  +   DF
Sbjct  577  FKSNDINTPAIHHFKTTSD-DSNEIALGLGTKVGSLLTDGNGDGILIEQVGETANFSVDF  635

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            +RNT F+LLQGCRMRNTKTE+VSCPSCGRTLFDLQE +A I E T HLPGV+IA+MGCIV
Sbjct  636  VRNTGFSLLQGCRMRNTKTEFVSCPSCGRTLFDLQETTASITEATGHLPGVTIAVMGCIV  695

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            NGPGEMADADFGYVG  PGK+DLY GK +V++ I  + A   L++LIK +  W D
Sbjct  696  NGPGEMADADFGYVGTTPGKVDLYYGKEIVRKGIKNEDAVGELVELIKSYDMWQD  750



>gb|KIC74118.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. EPS4]
Length=638

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N    PVI + ++     ++DLVI A    G L  DGLG+G+ LEAP  D +++R+ 
Sbjct  467  LKQNQIGIPVILNFQYSGS--QEDLVIQASMEYGALFCDGLGEGIWLEAP-YDINYLRHL  523

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV IAIMGCIVNGPG
Sbjct  524  SFSILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVKIAIMGCIVNGPG  583

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K +G+W +P
Sbjct  584  EMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSYGKWQEP  635



>ref|XP_765233.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Theileria 
parva strain Muguga]
 gb|EAN32950.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Theileria parva]
Length=801

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L++   D PVIH + FP   ++ D+++ +    G  L+D +G+G+++++     D     
Sbjct  630  LNKTKCDLPVIHQLNFPSLENQQDMLVDSCCLLGCNLIDKMGEGIIIKSK-LPIDITNKL  688

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            S ++LQ  RMRN KT+++SCPSCGRTLF++QE + E+R +  HLPGV+IAIMGCIVNG G
Sbjct  689  SLDILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEVRRRIGHLPGVTIAIMGCIVNGIG  748

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            EMADADFGYVGG+PGK+DLYV K +++R I  DQA D LI+LIK+H +WV+PP
Sbjct  749  EMADADFGYVGGSPGKVDLYVKKQLIERNIPKDQACDKLIELIKKHNKWVEPP  801



>ref|WP_011175290.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
 sp|Q6MD85.1|ISPG_PARUW RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23464.1| probable gcpE protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=654

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  ++PVI  + F      +D ++ A    G+LL DGLG+GV LE P  D  F+R  
Sbjct  481  LQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLEGP-YDILFLRQL  537

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV IAIMGCIVNGPG
Sbjct  538  SFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVKIAIMGCIVNGPG  597

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGRW++P T
Sbjct  598  EMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGRWIEPQT  651



>gb|KIC72391.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=657

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  ++PVI  + F      +D ++ A    G+LL DGLG+GV LE P  D  F+R  
Sbjct  484  LQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLEGP-YDILFLRQL  540

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV IAIMGCIVNGPG
Sbjct  541  SFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVKIAIMGCIVNGPG  600

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGRW++P T
Sbjct  601  EMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGRWIEPQT  654



>ref|WP_039357656.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia amoebophila]
Length=654

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  ++PVI  + F      +D ++ A    G+LL DGLG+GV LE P  D  F+R  
Sbjct  481  LQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGVWLEGP-YDILFLRQL  537

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV IAIMGCIVNGPG
Sbjct  538  SFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVKIAIMGCIVNGPG  597

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGRW++P T
Sbjct  598  EMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGRWIEPQT  651



>ref|WP_042282293.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Candidatus 
Protochlamydia sp. R18]
Length=654

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N  ++PVI  + F      +D ++ A    G+LL DGLG+G+ LE P  D  F+R  
Sbjct  481  LQQNQLNYPVI--LNFTYQGENEDTILLASMECGSLLCDGLGEGIWLEGP-YDILFLRQL  537

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV IAIMGCIVNGPG
Sbjct  538  SFSILQAARLRMSKTDFISCPSCGRTLFNLQDVTKRIQSRTSHLPGVKIAIMGCIVNGPG  597

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            EMADADFGYVG  PGKIDLYVGK  V++ I    A D L++LI+ HGRW++P T
Sbjct  598  EMADADFGYVGSKPGKIDLYVGKECVEKDIDFADADDRLVNLIRAHGRWIEPQT  651



>ref|WP_035395035.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Chlamydia sp. 'Diamant']
Length=638

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            + EN    PVI +  +  D  ++D+ + A    G LL DGLG+G+ LE P  + DF+R  
Sbjct  470  VRENQLACPVILNFAYSGD--KEDVTLLASMECGALLCDGLGEGLWLEGP-YEIDFLRQL  526

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  RMR +KT+++SCPSCGRTLF+LQ+++  I+ +TSHLPGV IAIMGCIVNGPG
Sbjct  527  SFSILQAARMRMSKTDFISCPSCGRTLFNLQDVTKRIQARTSHLPGVKIAIMGCIVNGPG  586

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG  PG IDLYVGK  V+R I    A D LI+LIK HGRWV+P
Sbjct  587  EMADADFGYVGSKPGMIDLYVGKECVERNIDFADADDRLIELIKTHGRWVEP  638



>gb|EMR00731.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cesiribacter 
andamanensis AMV16]
Length=186

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 114/176 (65%), Gaps = 11/176 (6%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISAGSNAGTllv-----dglgdgvlLEAPD-----SDFDFIR  490
            PVI H  + + +  D+L + A ++AG LL+       +      EAP       D   + 
Sbjct  8    PVIIHTTYSQ-LSADELQLWAATDAGGLLIDGLGDGLMLSLDYAEAPQPEQRLQDLRRLN  66

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
            N  F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNG
Sbjct  67   NLGFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRQRTDHLKGVKIGIMGCIVNG  126

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            PGEMADAD+GYVG   GKI LY G+ VV+R +  +QA D LI LI+E GRW++P T
Sbjct  127  PGEMADADYGYVGSGKGKITLYRGQEVVERNVPSEQAVDKLIGLIREDGRWIEPAT  182



>ref|WP_043587352.1| hypothetical protein [Diplosphaera colitermitum]
Length=143

 Score =   171 bits (434),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -1

Query  513  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            ++D D  R T  ++N+LQG   R +KTEYV+CPSCGRTLFDLQ  +  IREKT HL GV 
Sbjct  4    ETDPDPTRATKLAYNILQGAGARVSKTEYVACPSCGRTLFDLQTTTQRIREKTGHLKGVK  63

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGKT V+  I   +A   LI LIKEHG+
Sbjct  64   LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKTCVQYNIPQAEADARLIALIKEHGK  123

Query  159  WVDP  148
            W++P
Sbjct  124  WMEP  127



>ref|WP_042240386.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Neochlamydia 
sp. S13]
Length=638

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L +N    PVI  + F     ++DLVI +    G L  DGLG+G+ L+ P  D +++R+ 
Sbjct  467  LKQNQIGIPVI--LNFHYSGSQEDLVIQSSMEYGALFCDGLGEGIWLDVP-HDINYLRHL  523

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  RMR  KT+++SCPSCGRTLFDLQE++  IRE+TSHLPGV IAIMGCIVNGPG
Sbjct  524  SFSILQAARMRMVKTDFISCPSCGRTLFDLQEVTKRIRERTSHLPGVKIAIMGCIVNGPG  583

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   G IDLYVGK  V++ I   +A D L++L+K +GRW +P
Sbjct  584  EMADADFGYVGSKAGMIDLYVGKECVQKNIPFAEADDKLVELLKSYGRWQEP  635



>ref|XP_952048.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
annulata strain Ankara]
 emb|CAI74316.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase, putative 
[Theileria annulata]
Length=808

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 126/172 (73%), Gaps = 1/172 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L++   D PVIH + FP   ++ D+++ +    G  L+D +G+G+++++     D     
Sbjct  637  LNKTKSDLPVIHQLNFPSLENQQDMLVDSCCLLGCNLIDKMGEGIIIKSK-LPIDITNKL  695

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            S ++LQ  RMRN KT+++SCPSCGRTLF++QE + E+R +  HLPGV+IAIMGCIVNG G
Sbjct  696  SLDILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEVRRRVGHLPGVTIAIMGCIVNGIG  755

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGG+PGK+DLYV K +++R I  +QA D LI+LIK+H +WV+P
Sbjct  756  EMADADFGYVGGSPGKVDLYVKKQLIERNIPKEQACDKLIELIKKHDKWVEP  807



>ref|XP_009690697.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
 dbj|BAM40396.1| 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Theileria 
orientalis strain Shintoku]
Length=834

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/172 (50%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            +++ + D PVIH ++FP    + D+++ +    G  L+D +G+G+++++           
Sbjct  657  INKTNCDLPVIHQLKFPNLEDQQDMLVKSCCLLGCNLIDKMGEGIIIKS-KLPIQITNQL  715

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            + N+LQ  RMRN KT+++SCPSCGRTLF++QE + EIR++  HLPGV+IAIMGCIVNG G
Sbjct  716  ALNILQNSRMRNIKTDFISCPSCGRTLFNIQETTEEIRKRVGHLPGVTIAIMGCIVNGIG  775

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGG+PGK+DLYV K +++R I  ++A D LI+LIK+H +WV+P
Sbjct  776  EMADADFGYVGGSPGKVDLYVKKKLIERNIPKEKACDKLIELIKQHNKWVEP  827



>ref|XP_004829307.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi]
 gb|AFZ79641.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Babesia equi strain WA]
Length=770

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 5/174 (3%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGS--NAGTllvdglgdgvlLEAPDSDFDFIR  490
            L   + + PVIH ++       +D+V++A +  +   +   G G       P  + + I 
Sbjct  600  LVRANSNIPVIHQLDLTSYKDHEDVVVAASTLVSCHLVDKLGEGLICKTSLPLQESNAI-  658

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
              S N+LQ  RMR+ KT+++SCPSCGRTLFD+Q+ + EI+++T HLPGV+IAIMGCIVNG
Sbjct  659  --SLNILQNARMRSFKTDFISCPSCGRTLFDIQKTTEEIKKRTGHLPGVTIAIMGCIVNG  716

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
             GEMADADFGYVGG+PGK+DLYV K +V+R I  DQA D LIDLIK+HGRW+DP
Sbjct  717  IGEMADADFGYVGGSPGKVDLYVKKQLVERGIPNDQACDRLIDLIKKHGRWIDP  770



>ref|WP_043128162.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase, partial 
[Opitutaceae bacterium TAV1]
Length=147

 Score =   170 bits (430),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -1

Query  513  DSDFDFIR--NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            ++D D +R    ++N+LQG   R TKTEYV+CPSCGRTLFDLQ  +  IR+KT HL GV 
Sbjct  22   ETDPDPVRANKLAYNILQGAGARVTKTEYVACPSCGRTLFDLQTTTQRIRQKTGHLKGVK  81

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V+  I   +A   LIDLIKEHG+
Sbjct  82   LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKNCVQYNIPQAEADARLIDLIKEHGK  141

Query  159  WVDP  148
            W +P
Sbjct  142  WQEP  145



>ref|WP_008101242.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Verrucomicrobiae 
bacterium DG1235]
 gb|EDY83124.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobiae 
bacterium DG1235]
Length=678

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 2/124 (2%)
 Frame = -1

Query  513  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            +S+ D +R+T  ++N+LQG   R TKTE+V+CPSCGRTLFDLQ  +  IREKT HL GV 
Sbjct  549  ESETDLVRSTRLTYNVLQGAGSRITKTEFVACPSCGRTLFDLQSTTQRIREKTGHLKGVK  608

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            IAIMGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLI+EHG+
Sbjct  609  IAIMGCIVNGPGEMADADFGYVGGAPAKINLYVGKTCVKYNIPQAEADERLIDLIREHGK  668

Query  159  WVDP  148
            WVDP
Sbjct  669  WVDP  672



>ref|XP_002768617.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
 gb|EER01335.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, putative 
[Perkinsus marinus ATCC 50983]
Length=798

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -1

Query  492  RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVN  313
            R+   NL+QG RMR +KTE++SCPSCGRTLFDLQ+ +  IR+KT HL G+ IA+MGC+VN
Sbjct  677  RDVGLNLMQGSRMRLSKTEFISCPSCGRTLFDLQDTTERIRKKTGHLSGLRIAVMGCVVN  736

Query  312  GPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            GPGEMADADFGYVG  PGK+DLYVGK  V+RA+  D+A D L+DLIK  G WVDPP
Sbjct  737  GPGEMADADFGYVGSLPGKVDLYVGKQCVRRAVDYDKAEDVLVDLIKSEGLWVDPP  792



>dbj|BAG14389.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Perkinsus 
marinus]
Length=798

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -1

Query  492  RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVN  313
            R+   NL+QG RMR +KTE++SCPSCGRTLFDLQ+ +  IR+KT HL G+ IA+MGC+VN
Sbjct  677  RDVGLNLMQGSRMRLSKTEFISCPSCGRTLFDLQDTTERIRKKTGHLSGLRIAVMGCVVN  736

Query  312  GPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPP  145
            GPGEMADADFGYVG  PGK+DLYVGK  V+RA+  D+A D L+DLIK  G WVDPP
Sbjct  737  GPGEMADADFGYVGSLPGKVDLYVGKQCVRRAVDYDKAEDVLVDLIKSEGLWVDPP  792



>ref|WP_013044727.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Coraliomargarita 
akajimensis]
 gb|ADE56011.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Coraliomargarita 
akajimensis DSM 45221]
Length=681

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 95/112 (85%), Gaps = 0/112 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            ++N+LQG R R +KTE+V+CPSCGRTLFDLQ ++  IR +T HL GV+IAIMGCIVNGPG
Sbjct  569  AYNILQGARARISKTEFVACPSCGRTLFDLQSVTQRIRSRTDHLKGVTIAIMGCIVNGPG  628

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVGGAPGKI+LYVGK  VK  +  ++A D LIDLIKEHG+WV+P
Sbjct  629  EMADADFGYVGGAPGKINLYVGKECVKYNVPSNEALDRLIDLIKEHGKWVEP  680



>ref|XP_006378965.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
 gb|ERP56762.1| hypothetical protein POPTR_0009s01900g [Populus trichocarpa]
Length=678

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            L+EN+ + PVIHH++FPK IHRD+LVI AG+NAG LLVDGLGDGVL+EAPD DFDF+RNT
Sbjct  565  LAENALNVPVIHHLQFPKGIHRDELVIGAGTNAGALLVDGLGDGVLIEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  337
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISA+IREKTSHLPGVS+
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAQIREKTSHLPGVSV  673



>ref|WP_013943315.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis]
 emb|CCB88848.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Simkania 
negevensis Z]
Length=604

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 115/174 (66%), Gaps = 9/174 (5%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTll---vdglgdgvlLEAPDSDFDFI  493
            + ++  D PVI  + +  D+  +D VI A +  G LL               P  +    
Sbjct  430  IQQSKLDIPVILVVSY--DLSEEDTVIHAAAELGALLGDGYGEGILLRTRLTPGQN----  483

Query  492  RNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVN  313
            R+ SFN+LQ CR+R +KTE+++CP CGRTLFDLQE++  IR KTSHLPGV IAIMGCIVN
Sbjct  484  RSLSFNILQACRLRASKTEFIACPGCGRTLFDLQEVTKRIRLKTSHLPGVKIAIMGCIVN  543

Query  312  GPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            GPGEMADADFGYVG   GK+DLYVGK  V+R I  D A + LI+LIK H RW++
Sbjct  544  GPGEMADADFGYVGSRAGKVDLYVGKECVERNIDFDAADERLIELIKAHDRWIE  597



>ref|XP_006424584.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
 gb|ESR37824.1| hypothetical protein CICLE_v10027881mg [Citrus clementina]
Length=676

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/109 (86%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSEN+ +FPVIHHI+FP  IHRDDLVI AGSN G LLVDGLGDG+LLEAP  DFDF+R+T
Sbjct  566  LSENNLNFPVIHHIQFPNGIHRDDLVIGAGSNVGALLVDGLGDGLLLEAPGQDFDFLRDT  625

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  337
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS+
Sbjct  626  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSV  674



>ref|NP_001119467.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
 gb|AED97355.1| 4-hydroxy-3-methylbut-2-enyl diphosphate synthase [Arabidopsis 
thaliana]
Length=717

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNT  484
            LSENS +FPVIHHI FP  IHRD+LVI AG+ AG LLVDGLGDGV+LEAPD DFDF+RNT
Sbjct  565  LSENSVNFPVIHHINFPTGIHRDELVIHAGTYAGGLLVDGLGDGVMLEAPDQDFDFLRNT  624

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSI  337
            SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS+
Sbjct  625  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSV  673



>ref|WP_028788241.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Terrimonas 
ferruginea]
Length=670

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
            +F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR +T HL GV IAIMGC
Sbjct  552  EFVNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRSRTHHLKGVKIAIMGC  611

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            IVNGPGEMADADFGYVG  PGKI LY GK VVK+ +  + A D LI+L+KE+  WVDP
Sbjct  612  IVNGPGEMADADFGYVGSGPGKITLYKGKEVVKKNVNSETAVDELINLLKENEAWVDP  669



>ref|WP_020152560.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA300-N18]
Length=535

 Score =   173 bits (438),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -1

Query  504  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  325
             D  R  ++N+LQG R R +KTE+V+CPSCGRTLFDLQ  + +++E TSHL GV+IA+MG
Sbjct  417  LDRNRGLAYNVLQGARARISKTEFVACPSCGRTLFDLQSTTQKVKEATSHLKGVTIAVMG  476

Query  324  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            CIVNGPGEMADADFGYVG  PGKIDLYVGK  VK AI  + A D L+DLI+E G+W++P
Sbjct  477  CIVNGPGEMADADFGYVGSGPGKIDLYVGKNRVKSAIPENDAVDRLVDLIQEEGKWIEP  535



>ref|WP_041873442.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-O14]
Length=256

 Score =   167 bits (422),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  129  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  184

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI EHG
Sbjct  185  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLICEHG  244

Query  162  RWVDPPTE  139
            RWVD P +
Sbjct  245  RWVDAPEQ  252



>ref|WP_000541454.1| hypothetical protein, partial [Leptospira interrogans]
Length=268

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  146  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  205

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  206  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  265

Query  147  PTE  139
              +
Sbjct  266  SND  268



>ref|WP_026768257.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sediminibacterium 
sp. OR53]
Length=670

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
             F+  T+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A IRE T+HL GV IAIMGC
Sbjct  550  QFVNATAFSILQATRTRISKTEYISCPSCGRTLFDLQETTARIREVTNHLKGVKIAIMGC  609

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            IVNGPGEMADADFGYVG   GKI LY GK +VKR +  + A D LI+++KEHG WV+P
Sbjct  610  IVNGPGEMADADFGYVGSGVGKITLYKGKEIVKRNVESEVAVDELINILKEHGAWVEP  667



>ref|WP_026772720.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Sediminibacterium 
sp. OR43]
Length=670

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
             F+  T+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A IRE T+HL GV IAIMGC
Sbjct  550  QFVNATAFSILQATRTRISKTEYISCPSCGRTLFDLQETTARIREVTNHLKGVKIAIMGC  609

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            IVNGPGEMADADFGYVG   GKI LY GK +VKR +  + A D LI+++KEHG WV+P
Sbjct  610  IVNGPGEMADADFGYVGSGVGKITLYKGKEIVKRNVESEVAVDELINILKEHGAWVEP  667



>ref|WP_025298932.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Niabella 
soli]
 gb|AHF15883.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Niabella 
soli DSM 19437]
Length=674

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -1

Query  513  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  334
            +S   F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE + +IR  T+HL GV IA
Sbjct  553  NSVHQFLNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTTKIRSVTNHLKGVKIA  612

Query  333  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  154
            IMGCIVNGPGEMADADFGYVG  PGKI LY GK VVKR +  D A + LI+L+KE+  W+
Sbjct  613  IMGCIVNGPGEMADADFGYVGSGPGKITLYKGKEVVKRNVNSDIAVEELINLLKENEAWI  672

Query  153  DP  148
            +P
Sbjct  673  EP  674



>emb|CDR94010.1| gcpE protein, putative [Babesia bigemina]
Length=780

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 117/184 (64%), Gaps = 12/184 (7%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTll-------vdglgdgvlLEAPDSD  505
            L +N    PVIH ++  +    +++VI   +   T L       +       L E+ D  
Sbjct  596  LIKNGSKLPVIHQVDATECFDHEEVVIRVSAALSTHLIDKLGEGLIIKSRLPLSESNDIA  655

Query  504  FDFIR-----NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
               ++     N S   LQ  RMR+ KTE++SCPSCGRTLFD+Q+ +  I+++  HLPGVS
Sbjct  656  LSTLQVFNSVNPSIPRLQAARMRSFKTEFISCPSCGRTLFDIQKTTENIKKRVGHLPGVS  715

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            IAIMGCIVNG GEMADADFGYVGGAP K+DLYV K +V+R I  ++A D LIDLIK HG+
Sbjct  716  IAIMGCIVNGIGEMADADFGYVGGAPNKVDLYVKKKLVERNIPHEEACDRLIDLIKRHGK  775

Query  159  WVDP  148
            WVDP
Sbjct  776  WVDP  779



>ref|WP_018627269.1| hypothetical protein [Niabella aurantiaca]
Length=665

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
             F+ NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE + +IR  T HL GV IAIMGC
Sbjct  548  QFMNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTTKIRSVTHHLKGVKIAIMGC  607

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            IVNGPGEMADADFGYVG  PGKI LY GK VVKR +  D A D LI+L+KE+  W++P
Sbjct  608  IVNGPGEMADADFGYVGSGPGKITLYKGKDVVKRNVNSDIAVDELINLLKENEAWIEP  665



>ref|WP_035071223.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Anditalea 
andensis]
 gb|KEO74886.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Anditalea 
andensis]
Length=663

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 9/177 (5%)
 Frame = -1

Query  639  PVIHHIEFPKDIHRDDLVISA---------GSNAGTllvdglgdgvlLEAPDSDFDFIRN  487
            PV+  + +P   +   ++ +A         G   G ++          E   +      +
Sbjct  485  PVVFQVSYPDQDNDKTMLYAATDVGGLLIDGQGDGVMISMSKSKKQNREEIFAQIKLHNS  544

Query  486  TSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGP  307
             SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGP
Sbjct  545  VSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGP  604

Query  306  GEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            GEMADAD+GYVG   GKI LY GK V+KR+++ D+A D LI++IK+ G+W++P TE+
Sbjct  605  GEMADADYGYVGSGKGKITLYKGKEVMKRSVSSDRAVDELINIIKKDGQWIEPETEK  661



>ref|WP_009508000.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutaceae 
bacterium TAV5]
 gb|AHF93002.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutaceae 
bacterium TAV5]
Length=738

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -1

Query  513  DSDFDFIR--NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            ++D D +R    ++N+LQG   R TKTEYV+CPSCGRTLFDLQ  +  IR+KT HL GV 
Sbjct  606  ETDPDPVRANKLAYNILQGAGARVTKTEYVACPSCGRTLFDLQTTTQRIRQKTGHLKGVK  665

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V+  I   +A   LI+LIK+HG+
Sbjct  666  LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKNCVQYNIPQAEADARLIELIKQHGK  725

Query  159  WVDP  148
            W++P
Sbjct  726  WMEP  729



>ref|WP_020149813.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-M04]
Length=590

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 94/128 (73%), Gaps = 4/128 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  463  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  518

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI+EHG
Sbjct  519  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLIREHG  578

Query  162  RWVDPPTE  139
            RWVD P +
Sbjct  579  RWVDAPEQ  586



>ref|WP_028261665.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobia 
bacterium SCGC AAA027-I19]
Length=592

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = -1

Query  519  APDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            AP   F      S+N+LQ   +R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV 
Sbjct  466  APGQSFRL----SYNILQAAGVRIFKTDYVACPSCGRTLFNLQSTTQKIRAATGHLKGVR  521

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGKT VK  I  D+A   LIDLI EHG+
Sbjct  522  IAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKTAVKFNIPEDEAVSRLIDLITEHGK  581

Query  159  WVDPP  145
            WVD P
Sbjct  582  WVDAP  586



>ref|WP_002702180.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Microscilla 
marina]
 gb|EAY25803.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Microscilla 
marina ATCC 23134]
Length=664

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            + N SF +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIV
Sbjct  545  LNNLSFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIV  604

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            NGPGEMADAD+GYVG   GKI LY  KTVVKR +  + A D LI+LI+E GRW++  +E
Sbjct  605  NGPGEMADADYGYVGSGKGKITLYRSKTVVKRGVPSEHAVDELIELIREDGRWLERTSE  663



>gb|AEA43526.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Fluviicola 
taffensis DSM 16823]
Length=644

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            + + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE + +IRE+TSHL G+ I IMGCIV
Sbjct  527  LNSLSFGILQATRTRISKTEYISCPSCGRTLFDLQETTGKIRERTSHLKGLKIGIMGCIV  586

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            NGPGEMADAD+GYVG  PGKI+LY  KTVVK+ ++ ++A DALI LI+++G W++P
Sbjct  587  NGPGEMADADYGYVGTGPGKINLYKEKTVVKKNVSEEEAVDALIQLIRDNGDWIEP  642



>ref|WP_015265930.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis]
 gb|AGA78371.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
vietnamensis DSM 17526]
Length=661

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 5/133 (4%)
 Frame = -1

Query  519  APDSD-----FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSH  355
            APD D          + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T H
Sbjct  529  APDRDALMETIKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDH  588

Query  354  LPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLI  175
            L GV I IMGCIVNGPGEMADAD+GYVG   GKI LY GK VVKRA+  +QA D LI++I
Sbjct  589  LKGVKIGIMGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVVKRAVPSEQAVDELINII  648

Query  174  KEHGRWVDPPTEE  136
            +E G+W++P   E
Sbjct  649  REDGQWIEPEAVE  661



>ref|WP_043024168.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Fluviicola 
taffensis]
Length=632

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            + + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE + +IRE+TSHL G+ I IMGCIV
Sbjct  515  LNSLSFGILQATRTRISKTEYISCPSCGRTLFDLQETTGKIRERTSHLKGLKIGIMGCIV  574

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            NGPGEMADAD+GYVG  PGKI+LY  KTVVK+ ++ ++A DALI LI+++G W++P
Sbjct  575  NGPGEMADADYGYVGTGPGKINLYKEKTVVKKNVSEEEAVDALIQLIRDNGDWIEP  630



>gb|EOQ87425.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
yanagawae serovar Saopaulo str. Sao Paulo = ATCC 700523]
Length=654

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -1

Query  645  DFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQ  466
            D+P++  +    D ++D L+ +A   AG  L+DG+GD + L   D + +   + SF++LQ
Sbjct  491  DYPIVLQV---TDQNKDQLMYNASIKAGGSLLDGIGDVIRLSYGDGEAEECLHLSFDILQ  547

Query  465  GCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADAD  286
              R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+MGCIVNGPGEMADAD
Sbjct  548  ATRLRLTKTEYISCPSCGRTMFDLQTTTAKIKEKTGHLKGVKIAVMGCIVNGPGEMADAD  607

Query  285  FGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            FGYVG   GK+ LY GK +VK+ ++  +A + LI+LI+E+G W DP
Sbjct  608  FGYVGAGVGKVHLYKGKEIVKKGVSEVEAPELLIELIRENGMWNDP  653



>ref|WP_039929258.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
yanagawae]
Length=675

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = -1

Query  645  DFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQ  466
            D+P++  +    D ++D L+ +A   AG  L+DG+GD + L   D + +   + SF++LQ
Sbjct  512  DYPIVLQV---TDQNKDQLMYNASIKAGGSLLDGIGDVIRLSYGDGEAEECLHLSFDILQ  568

Query  465  GCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADAD  286
              R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+MGCIVNGPGEMADAD
Sbjct  569  ATRLRLTKTEYISCPSCGRTMFDLQTTTAKIKEKTGHLKGVKIAVMGCIVNGPGEMADAD  628

Query  285  FGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            FGYVG   GK+ LY GK +VK+ ++  +A + LI+LI+E+G W DP
Sbjct  629  FGYVGAGVGKVHLYKGKEIVKKGVSEVEAPELLIELIRENGMWNDP  674



>ref|WP_012377418.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutus 
terrae]
 ref|YP_001821504.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutus 
terrae PB90-1]
 gb|ACB77904.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Opitutus 
terrae PB90-1]
Length=677

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 2/124 (2%)
 Frame = -1

Query  513  DSDFDFIRNT--SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVS  340
            +++ D +R T  ++N+LQG   R +KTE+V+CPSCGRTLFDLQ  +  IR +T HL GV 
Sbjct  549  ETEADPVRATKLAYNVLQGAGARTSKTEFVACPSCGRTLFDLQTTTQRIRAQTGHLKGVK  608

Query  339  IAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGR  160
            +AIMGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  V   I   +A   LI LIKEHG+
Sbjct  609  LAIMGCIVNGPGEMADADFGYVGGAPGKINLYVGKQCVAYNIPQAEADARLIALIKEHGK  668

Query  159  WVDP  148
            WVDP
Sbjct  669  WVDP  672



>ref|WP_008627688.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus]
 gb|EMS33361.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Mariniradius 
saccharolyticus AK6]
Length=663

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 110/181 (61%), Gaps = 9/181 (5%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISA---------GSNAGTllvdglgdgvlLEAPD  511
            L EN    PV+  +++P       ++ +A         G   G ++          E   
Sbjct  477  LMENHSQIPVVVKVDYPAQTQDKTMLYAATDVGGLLVDGLGEGIMIGLEAYREAPREVLL  536

Query  510  SDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAI  331
                   + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I I
Sbjct  537  EQVKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGI  596

Query  330  MGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            MGCIVNGPGEMADAD+GYVG   GKI LY GK VVKR++A ++A D LI++I++ G W++
Sbjct  597  MGCIVNGPGEMADADYGYVGSGKGKITLYKGKEVVKRSVASEKAVDELIEIIRKDGMWIE  656

Query  150  P  148
            P
Sbjct  657  P  657



>ref|WP_009036471.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus]
 gb|EOZ95046.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Indibacter 
alkaliphilus LW1]
Length=659

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 118/182 (65%), Gaps = 11/182 (6%)
 Frame = -1

Query  663  LSENSXDFPVIHHIEFPKDIHRDDLVISAGSNAGTllv-------dglgdgvlLEAPDSD  505
            L E + D PV+  + +P D  +D  +++A ++AG +LV                +   S 
Sbjct  477  LLEQNIDIPVVIKLNYP-DQDKDQTMLNAATDAGGMLVDGLGDGIMLGISAKTSQEKLSI  535

Query  504  FDFIR---NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  334
             D ++   + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I 
Sbjct  536  LDTVKLHNSVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIG  595

Query  333  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  154
            IMGCIVNGPGEMADADFGYVG   GKI LY GK VVKR++  ++A D LI++IK+ G W 
Sbjct  596  IMGCIVNGPGEMADADFGYVGSGKGKITLYRGKEVVKRSVPSEKAVDELIEIIKKDGMWN  655

Query  153  DP  148
            +P
Sbjct  656  EP  657



>ref|WP_012388276.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
biflexa]
 gb|ABZ93753.1| Deoxyxylulose biosynthesis protein [Leptospira biflexa serovar 
Patoc strain 'Patoc 1 (Ames)']
 gb|ABZ97395.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase) [Leptospira 
biflexa serovar Patoc strain 'Patoc 1 (Paris)']
Length=675

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 119/166 (72%), Gaps = 3/166 (2%)
 Frame = -1

Query  645  DFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQ  466
            D+P++ ++      ++D L+  A   AG  L+DG+GD + L   D + +   + SF++LQ
Sbjct  512  DYPIVLNVSAK---NKDQLMYDASIKAGGSLLDGIGDVIRLSFGDGEAEECLHLSFDILQ  568

Query  465  GCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADAD  286
              R+R TKTEY+SCPSCGRT+FDLQ  +A+I+EKT HL GV IA+MGCIVNGPGEMADAD
Sbjct  569  ATRLRLTKTEYISCPSCGRTMFDLQSTTAKIKEKTGHLKGVKIAVMGCIVNGPGEMADAD  628

Query  285  FGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            FGYVG   GK+ LY GK +VK+ ++  +A D LI+LI+E+G W DP
Sbjct  629  FGYVGAGVGKVHLYKGKEIVKKGVSETEAPDLLIELIRENGMWNDP  674



>gb|EMJ86182.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri serovar Semaranga str. Veldrot Semarang 173]
Length=661

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  645  DFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNL  472
            D+P+I  HH E      +D+L+  +  + G  L+DG+GD V L   D + +   + SF++
Sbjct  498  DYPIILVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDGEPEESLHLSFDI  552

Query  471  LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMAD  292
            LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+MGCIVNGPGEMAD
Sbjct  553  LQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVMGCIVNGPGEMAD  612

Query  291  ADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            ADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  613  ADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  660



>ref|WP_014681066.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Solitalea 
canadensis]
 gb|AFD07839.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Solitalea 
canadensis DSM 3403]
Length=670

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 113/166 (68%), Gaps = 1/166 (1%)
 Frame = -1

Query  645  DFPVIHHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNLLQ  466
            D PVI       D+  +D  + A ++ G LL DGLGDG+ ++        I +T+F +LQ
Sbjct  502  DIPVIIK-RIYADVSEEDFQLEASTDVGALLTDGLGDGLWIQCDSVSSKVINSTAFGILQ  560

Query  465  GCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADAD  286
              R R +KTEY+SCPSCGRTLFDLQE +  IR +T HL G+ I IMGCIVNGPGEMADAD
Sbjct  561  ATRTRISKTEYISCPSCGRTLFDLQETTQLIRSRTDHLKGIKIGIMGCIVNGPGEMADAD  620

Query  285  FGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            +GYVG  PG I LY  K VVKR +A + A D LI+LIKE+G WVDP
Sbjct  621  YGYVGTGPGVITLYKEKEVVKRNVAAEHAVDELINLIKENGDWVDP  666



>ref|WP_029998282.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marinimicrobia 
bacterium SCGC AAA003-L08]
Length=645

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -1

Query  504  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  325
             D +  TSF +LQ  R R TKTEY+SCPSCGRTLFDLQE++A IR KT HL G+ I IMG
Sbjct  527  LDKVNRTSFGILQATRTRITKTEYISCPSCGRTLFDLQEVTARIRSKTQHLKGLKIGIMG  586

Query  324  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            CIVNGPGEMADAD+GYVG    KI LY    V+++ + MDQA +ALI+LIKE+G W+DP
Sbjct  587  CIVNGPGEMADADYGYVGTGIEKISLYKKHNVIQKDVPMDQADEALINLIKENGDWIDP  645



>ref|WP_035983785.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri]
Length=681

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  645  DFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNL  472
            D+P+I  HH E      +D+L+  +  + G  L+DG+GD V L   D + +   + SF++
Sbjct  518  DYPIILVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDGEPEESLHLSFDI  572

Query  471  LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMAD  292
            LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+MGCIVNGPGEMAD
Sbjct  573  LQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVMGCIVNGPGEMAD  632

Query  291  ADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            ADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  633  ADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  680



>ref|WP_039126529.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
sp. ZG627]
 gb|KIC92210.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
sp. ZG627]
Length=667

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
             F  NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR  T HL GV IAIMGC
Sbjct  548  QFTNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRSVTHHLKGVKIAIMGC  607

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            IVNGPGEMADADFGYVG  PGKI LY GK VVKR +  + A   LI+L+KE+  WV+P
Sbjct  608  IVNGPGEMADADFGYVGSGPGKITLYKGKEVVKRNVDSEVAVAELINLLKENEAWVEP  665



>ref|WP_038162080.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobium 
sp. BvORR106]
Length=596

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP   F      S+N+LQ    R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV
Sbjct  468  EAPGQSF----RISYNILQAAGTRIFKTDYVACPSCGRTLFNLQTTTQKIRAATGHLKGV  523

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLIKEH 
Sbjct  524  RIAVMGCIVNGPGEMADADFGYVGGAPDKINLYVGKTAVKFNIPEGEAVERLIDLIKEHN  583

Query  162  RWVDPPT  142
            RWVD PT
Sbjct  584  RWVDAPT  590



>ref|WP_016194246.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Arcticibacter 
svalbardensis]
 gb|EOR95689.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Arcticibacter 
svalbardensis MN12-7]
Length=672

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            I +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +  IR +TSHL GV IAIMGCIV
Sbjct  551  IVSTSFVILQATRSRISKTEYISCPSCGRTLFDLQETTQMIRSRTSHLKGVKIAIMGCIV  610

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            NGPGEMADAD+GYVG  PGKI LY GK VVK+++  D A D LID+I+E G W++
Sbjct  611  NGPGEMADADYGYVGMGPGKITLYRGKEVVKKSVNKDNALDELIDIIREDGNWIE  665



>ref|WP_028831439.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Proteobacteria 
bacterium JGI 0000113-E04]
Length=638

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            I +T+F +LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR+ T HL GV I IMGCIV
Sbjct  522  INSTAFGILQASRTRISKTEYISCPSCGRTLFDLQETTAKIRKVTDHLKGVKIGIMGCIV  581

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            NGPGEMADAD+GYVG  PGKI LY  KTVVK+ I  + A  ALIDLIKEHG W D
Sbjct  582  NGPGEMADADYGYVGTRPGKITLYKEKTVVKKNIDEELAVHALIDLIKEHGDWTD  636



>ref|WP_001011572.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EJP04903.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bulgarica str. Mallika]
Length=663

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_009965977.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Verrucomicrobium 
spinosum]
Length=596

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP   F      S+N+LQ    R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV
Sbjct  468  EAPGQSF----RISYNILQAAGTRIFKTDYVACPSCGRTLFNLQTTTQKIRAATGHLKGV  523

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAP KI+LYVGKT VK  I   +A + LIDLIKEH 
Sbjct  524  RIAVMGCIVNGPGEMADADFGYVGGAPDKINLYVGKTAVKFNIPEGEAVERLIDLIKEHN  583

Query  162  RWVDPPT  142
            RWVD PT
Sbjct  584  RWVDAPT  590



>ref|WP_001011575.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EKO04935.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. C10069]
 gb|EKO96673.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. Brem 329]
 gb|EKR15531.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. 2006006960]
 gb|EMN30563.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. L0374]
 gb|EMN53644.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Autumnalis str. LP101]
 gb|EMN64626.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. R168]
 gb|EMP04908.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pyrogenes str. 200701872]
Length=663

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_001011584.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EKO89042.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. Andaman]
 gb|EKP83542.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. 2006006986]
 gb|EKR57322.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 12758]
Length=663

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_019111293.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA164-L15]
Length=590

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  463  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  518

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI EHG
Sbjct  519  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLICEHG  578

Query  162  RWVDPPTE  139
            RWVD P +
Sbjct  579  RWVDAPEQ  586



>gb|EKJ85057.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri serovar Hardjo str. Went 5]
Length=661

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  645  DFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNL  472
            D+P++  HH E      +D+L+  +  + G  L+DG+GD V L   D + +   + SF++
Sbjct  498  DYPIVLVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDGEPEESLHLSFDI  552

Query  471  LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMAD  292
            LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+MGCIVNGPGEMAD
Sbjct  553  LQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVMGCIVNGPGEMAD  612

Query  291  ADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            ADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  613  ADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  660



>ref|WP_038131498.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase, partial 
[Verrucomicrobia bacterium SCGC AAA168-F10]
Length=589

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 4/128 (3%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EAP          S+N+LQ    R  KT+YV+CPSCGRTLF+LQE + +IRE T HL GV
Sbjct  463  EAPGQSLRL----SYNILQAAGARIFKTDYVACPSCGRTLFNLQETTQKIREATGHLKGV  518

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             IA+MGCIVNGPGEMADADFGYVGGAPGKI+LYVGK  VK  I   +A + L DLI EHG
Sbjct  519  RIAVMGCIVNGPGEMADADFGYVGGAPGKINLYVGKKAVKFNIPEGEAVERLQDLICEHG  578

Query  162  RWVDPPTE  139
            RWVD P +
Sbjct  579  RWVDAPEQ  586



>ref|WP_001011574.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMM80390.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2006001854]
Length=663

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_002101771.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans]
 gb|EKR27856.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bataviae str. L1111]
Length=663

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY+GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYLGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_012925967.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale]
 gb|ADB37416.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Spirosoma 
linguale DSM 74]
Length=678

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  513  DSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIA  334
            D+D   + N SF +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I 
Sbjct  551  DADLKRLNNLSFGILQAARTRITKTEYISCPSCGRTLFDLQETTALIRQRTDHLKGVKIG  610

Query  333  IMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWV  154
            IMGCIVNGPGEMADAD+GYVG    KI LY G+ V+K+++  D+A D LI+LI+E  RW+
Sbjct  611  IMGCIVNGPGEMADADYGYVGIGRDKIALYRGQQVIKKSVPADRAVDELIELIREDNRWL  670

Query  153  DPPTE  139
            +P  E
Sbjct  671  EPTFE  675



>ref|WP_040917603.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
meyeri]
Length=681

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = -1

Query  645  DFPVI--HHIEFPKDIHRDDLVISAGSNAGTllvdglgdgvlLEAPDSDFDFIRNTSFNL  472
            D+P++  HH E      +D+L+  +  + G  L+DG+GD V L   D + +   + SF++
Sbjct  518  DYPIVLVHHSE-----DKDELLYESSIHVGGSLLDGIGDVVRLSYGDGEPEESLHLSFDI  572

Query  471  LQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMAD  292
            LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I++KT HL GV IA+MGCIVNGPGEMAD
Sbjct  573  LQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKQKTGHLKGVKIAVMGCIVNGPGEMAD  632

Query  291  ADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            ADFGYVG   GK+ LY GK +VK+ ++  +A D LIDLI+E+G W DP
Sbjct  633  ADFGYVGAGIGKVHLYKGKEIVKKGVSETEAADLLIDLIRENGMWNDP  680



>ref|WP_020888417.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
qasimii]
 gb|EPR65220.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
qasimii M12-11B]
Length=663

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -1

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
            + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNG
Sbjct  544  SVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTALIRKRTDHLKGVKIGIMGCIVNG  603

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            PGEMADAD+GYVG   GKI LY GK V+KR++  + A D LID+IKE G+W++P T
Sbjct  604  PGEMADADYGYVGSGKGKITLYKGKEVMKRSVPSENAVDELIDIIKEDGQWIEPET  659



>ref|WP_014020335.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cyclobacterium 
marinum]
 gb|AEL26042.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cyclobacterium 
marinum DSM 745]
Length=663

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -1

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
            + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNG
Sbjct  544  SVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTALIRKRTDHLKGVKIGIMGCIVNG  603

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            PGEMADAD+GYVG   GKI LY GK V+KR++  + A D LID+IKE G+W++P T
Sbjct  604  PGEMADADYGYVGSGKGKITLYKGKEVMKRSVPSENAVDELIDIIKEDGQWIEPET  659



>ref|WP_014772391.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica]
 gb|AFL84411.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Belliella 
baltica DSM 15883]
Length=659

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPG
Sbjct  546  SFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPG  605

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   GKI LY GK VVKR++  ++A D LI++IK+ G W+DP
Sbjct  606  EMADADFGYVGSGKGKITLYKGKEVVKRSVPSEKAVDELIEIIKKDGMWIDP  657



>ref|WP_038029147.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Thermonema 
rossianum]
Length=661

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            +   +   +F +LQ  R R TKTEY++CPSCGRTLFDLQE +A IR  T HL GV I IM
Sbjct  537  ELKQLNQLAFGILQASRTRTTKTEYIACPSCGRTLFDLQETTAMIRRHTEHLKGVKIGIM  596

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADAD+GYVG   GKI LY GK VV+R +  ++A  ALI+LI+E GRW++P
Sbjct  597  GCIVNGPGEMADADYGYVGSGKGKITLYRGKEVVRRNVPSEEAVQALIELIREDGRWIEP  656

Query  147  P  145
            P
Sbjct  657  P  657



>ref|WP_015030917.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Emticicia 
oligotrophica]
 gb|AFK05229.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Emticicia 
oligotrophica DSM 17448]
Length=666

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            + +TSF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIV
Sbjct  544  VNSTSFGILQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIV  603

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            NGPGEMADAD+GYVG    KI LY G+TV+K+++  D A D LI+LIKE GRW +P   E
Sbjct  604  NGPGEMADADYGYVGIGKDKIALYRGQTVMKKSVHADNAVDELIELIKEDGRWFEPEVLE  663



>ref|WP_033412090.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Segetibacter 
koreensis]
Length=693

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = -1

Query  501  DFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGC  322
             FI +T+F++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR  T+HL GV IAIMGC
Sbjct  572  QFINSTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRAVTNHLKGVKIAIMGC  631

Query  321  IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPT  142
            IVNGPGEMADADFGYVG   GKI LY+GK VVKR +  D A   LI L+KE   WV+P  
Sbjct  632  IVNGPGEMADADFGYVGSGVGKITLYMGKEVVKRNVNSDIAVSELIRLLKESDAWVEPAA  691

Query  141  EE  136
             E
Sbjct  692  VE  693



>ref|WP_001011587.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMN47606.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. L1207]
Length=663

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + + ++ A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKGIVLKNVPIEIADEKLVQLIKDNGLWQDP  660



>ref|WP_018477847.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Pontibacter 
roseus]
Length=657

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -1

Query  504  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  325
             D + N SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMG
Sbjct  534  IDKLNNLSFGILQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMG  593

Query  324  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            CIVNGPGEMADAD+GYVG    KI LY G+TVVK+++  D+A D LI+LI+E  RW++P
Sbjct  594  CIVNGPGEMADADYGYVGVGKDKIALYRGQTVVKKSVPADRAVDELIELIREDARWIEP  652



>ref|WP_033418316.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cytophaga 
aurantiaca]
Length=657

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  510  SDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAI  331
            ++   + N +F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I I
Sbjct  531  TNLKALNNLAFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGI  590

Query  330  MGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            MGCIVNGPGEMADAD+GYVG    KI LY G+TVV +A+  D+A D LI++IKE G+W++
Sbjct  591  MGCIVNGPGEMADADYGYVGVGKDKIALYRGQTVVNKAVPSDRAVDELINIIKEDGKWLE  650

Query  150  PPTEE  136
            P   E
Sbjct  651  PVVSE  655



>ref|WP_027000276.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flexibacter 
elegans]
Length=684

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 0/115 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNGPG
Sbjct  565  SFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGVKIGIMGCIVNGPG  624

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTE  139
            EMADAD+GYVG    KI LY G  VVKRA+  D+A D LI LI+E G+W++ P+E
Sbjct  625  EMADADYGYVGSGKDKITLYRGMNVVKRAVPSDKAVDELIALIREDGKWIERPSE  679



>ref|WP_015681381.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira wolbachii]
 gb|EOQ96025.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira wolbachii serovar Codice str. CDC]
Length=683

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I+++T HL GV IA+MGCIVNGPG
Sbjct  571  SFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKKRTGHLKGVKIAVMGCIVNGPG  630

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   GK+ LY GK +VK+ ++ ++A D LIDLI+E+G W DP
Sbjct  631  EMADADFGYVGAGIGKVHLYKGKEIVKKGVSEEEAADQLIDLIRENGMWNDP  682



>ref|WP_013452189.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Marivirga 
tractuosa]
 gb|ADR20038.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Marivirga 
tractuosa DSM 4126]
Length=651

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 92/116 (79%), Gaps = 0/116 (0%)
 Frame = -1

Query  495  IRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIV  316
            I  T+FN+LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR +T+HL GV I IMGCIV
Sbjct  533  INETAFNILQASRTRISKTEYISCPSCGRTLFDLQETTAMIRNRTNHLKGVKIGIMGCIV  592

Query  315  NGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            NGPGEMADAD+GYVG   GKI LY G+ V+KR +  ++A D LID+I++ G+W++P
Sbjct  593  NGPGEMADADYGYVGSGKGKITLYKGQEVMKRGVPSERAVDELIDIIRQDGKWLEP  648



>ref|WP_014222823.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Niastella 
koreensis]
 gb|AEW02913.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Niastella 
koreensis GR20-10]
Length=665

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  510  SDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAI  331
            S+  FI NTSF++LQ  R R +KTEY+SCPSCGRTLFDLQE +A+IR  T HL GV IAI
Sbjct  543  SNHQFINNTSFSILQATRTRISKTEYISCPSCGRTLFDLQETTAKIRSVTHHLKGVKIAI  602

Query  330  MGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            MGCIVNGPGEMADADFGYVG   GKI LY GK +VKR +    A + LI+L+KE+  WV+
Sbjct  603  MGCIVNGPGEMADADFGYVGSGVGKITLYKGKEIVKRNVDSAIAVEELINLLKENNAWVE  662



>gb|ABG59455.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Cytophaga 
hutchinsonii ATCC 33406]
Length=665

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EA  +    + N  F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV
Sbjct  535  EALLAYLKSVNNLGFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGV  594

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             I IMGCIVNGPGEMADAD+GYVG    KI LY G+TVV +A+  D+A D LI++IKE G
Sbjct  595  KIGIMGCIVNGPGEMADADYGYVGVGKDKIALYRGQTVVNKAVHSDKAVDELINIIKEDG  654

Query  162  RWVDPPTEE  136
            +W++P   E
Sbjct  655  KWLEPVVSE  663



>ref|WP_039139364.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
solisilvae]
 gb|KIC94714.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Flavihumibacter 
solisilvae]
Length=674

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -1

Query  504  FDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMG  325
            + F  NT+F++LQ  R R +KTEY+SCPSCGRTLFDLQE ++ IR  T+HL GV IAIMG
Sbjct  555  YQFTNNTAFSILQATRTRISKTEYISCPSCGRTLFDLQETTSRIRSVTNHLKGVKIAIMG  614

Query  324  CIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            CIVNGPGEMADADFGYVG  PGKI LY GK VVKR +  + A D LI+L++E   WV+
Sbjct  615  CIVNGPGEMADADFGYVGSGPGKITLYKGKEVVKRNVDSEVAVDELINLLRESDVWVE  672



>ref|WP_035610064.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Haloferula 
sp. BvORR071]
Length=590

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            S+N+LQ    R  KT+YV+CPSCGRTLF+LQ  + +IR  T HL GV IA+MGCIVNGPG
Sbjct  471  SYNILQAAGTRIFKTDYVACPSCGRTLFNLQSTTQKIRASTGHLKGVRIAVMGCIVNGPG  530

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            EMADADFGYVGGAPGKI+LYVGK  VK  I   +A + LIDLI+EHG+W+D P  E
Sbjct  531  EMADADFGYVGGAPGKINLYVGKQAVKFNIPEGEAVERLIDLIREHGKWIDAPAGE  586



>ref|WP_001011579.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EKR82657.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 08452]
 gb|EMJ38684.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. FPW1039]
 gb|EMN35904.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Medanensis str. L0448]
 gb|EMN38444.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. L0996]
 gb|EMN93492.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Medanensis str. UT053]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_001011576.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 ref|NP_713340.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leptospira 
interrogans serovar Lai str. 56601]
 sp|Q8F1H5.1|ISPG_LEPIN RecName: Full=4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
(flavodoxin); AltName: Full=1-hydroxy-2-methyl-2-(E)-butenyl 
4-diphosphate synthase [Leptospira interrogans serovar 
Lai str. 56601]
 gb|AAN50358.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leptospira 
interrogans serovar Lai str. 56601]
 gb|AER03326.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leptospira 
interrogans serovar Lai str. IPAV]
 gb|EKN86938.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000624]
 gb|EKO26646.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 12621]
 gb|EKO70636.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Canicola str. Fiocruz LV133]
 gb|EKQ37056.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000621]
 gb|EKQ46493.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000623]
 gb|EKR46950.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. UI 08368]
 gb|EMF41762.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Lora str. TE 1992]
 gb|EMJ68955.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2003000735]
 gb|EMJ74223.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000632]
 gb|EMJ80626.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000631]
 gb|EMK20669.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. Kito]
 gb|EMN08932.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Muenchen str. Brem 129]
 gb|EMN77326.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 09600]
 gb|EMN81046.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. UI 12764]
 gb|EMN85330.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. UI 12769]
 gb|EMO95403.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. UI 13372]
 gb|EMY03801.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. 2002000626]
 gb|EMY26781.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Australis str. 200703203]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_041932708.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Cytophaga 
hutchinsonii]
Length=657

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  522  EAPDSDFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGV  343
            EA  +    + N  F +LQ  R R TKTEY+SCPSCGRTLFDLQE +A IR++T HL GV
Sbjct  527  EALLAYLKSVNNLGFGILQAARTRMTKTEYISCPSCGRTLFDLQETTAMIRKRTDHLKGV  586

Query  342  SIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHG  163
             I IMGCIVNGPGEMADAD+GYVG    KI LY G+TVV +A+  D+A D LI++IKE G
Sbjct  587  KIGIMGCIVNGPGEMADADYGYVGVGKDKIALYRGQTVVNKAVHSDKAVDELINIIKEDG  646

Query  162  RWVDPPTEE  136
            +W++P   E
Sbjct  647  KWLEPVVSE  655



>ref|WP_001011581.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMM97799.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Zanoni str. LT2156]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_001011580.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EMN69039.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Grippotyphosa str. UI 08434]
 gb|EMN72160.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Bataviae str. UI 08561]
 gb|AJR15281.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Leptospira 
interrogans serovar Linhai str. 56609]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_004765637.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri]
 gb|EKO15499.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. H1]
 gb|EKO61584.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. H2]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGARLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_020763499.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri]
 gb|EMK23946.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Bulgarica str. Nikolaevo]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGARLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_001011585.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EJP17843.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans str. FPW2026]
 gb|EMN99920.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. UT364]
 gb|KGE27600.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans serovar Lai]
Length=663

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_018472954.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Echinicola 
pacifica]
Length=662

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -1

Query  489  NTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNG  310
            + SF +LQ  R R +KTEY+SCPSCGRTLFDLQE +A IR++T HL GV I IMGCIVNG
Sbjct  545  SVSFGVLQAARTRMSKTEYISCPSCGRTLFDLQETTAMIRQRTDHLKGVKIGIMGCIVNG  604

Query  309  PGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDPPTEE  136
            PGEMADAD+GYVG   GKI LY GK V+KR++  +QA D LI++I++ G+W++P + E
Sbjct  605  PGEMADADYGYVGSGKGKITLYKGKEVMKRSVPSEQAVDELIEIIRQGGQWIEPESVE  662



>ref|WP_002974114.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
terpstrae]
 gb|EMY61439.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
terpstrae serovar Hualin str. LT 11-33 = ATCC 700639]
Length=683

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I+++T HL GV IA+MGCIVNGPG
Sbjct  571  SFDVLQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKKRTGHLKGVKIAVMGCIVNGPG  630

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   GK+ LY GK +VK+ ++ ++A D LIDLI+E+G W DP
Sbjct  631  EMADADFGYVGAGIGKVHLYKGKEIVKKGVSEEEAADQLIDLIRENGMWNDP  682



>ref|WP_020779677.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri]
 gb|EMJ85540.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. JB]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_016752197.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
kirschneri]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_002725099.1| MULTISPECIES: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira]
 gb|EKP14663.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. 200801926]
 gb|EKQ92343.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. UI 09149]
 gb|EKQ99858.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Castellonis str. 200801910]
 gb|EMG00560.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. 200701203]
 gb|EMK12317.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
sp. serovar Kenya str. Sh9]
 gb|EMN13424.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. Brem 307]
 gb|EMN19026.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. Brem 328]
 gb|EMN56445.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Javanica str. MK146]
 gb|EMO09698.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii str. Noumea 25]
 gb|ENO64211.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Mini str. 201000851]
 gb|EPG58824.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Javanica str. UI 09931]
 gb|KGE22700.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
borgpetersenii serovar Ballum]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLF+LQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFNLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVD  151
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L++LIK+HG W D
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVMKNVPSEVADEKLVELIKKHGLWQD  659



>ref|WP_004783178.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri]
 gb|EKP03627.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. 2008720114]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_001011586.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
interrogans]
 gb|EJO79099.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. Kennewicki LC82-25]
 gb|EKN97067.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. Pomona]
 gb|EKR34029.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Hebdomadis str. R499]
 gb|EMF34738.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. Fox 32256]
 gb|EMI70557.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. CSL10083]
 gb|EMJ59015.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira interrogans serovar Pomona str. CSL4002]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWQDP  660



>ref|WP_004755752.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
kirschneri]
 gb|EJO68225.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Grippotyphosa str. RM52]
 gb|EMK04678.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. MMD1493]
 gb|EPG48222.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Cynopteri str. 3522 CT]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_004756563.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
kirschneri]
 gb|EKO52627.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. 200802841]
 gb|EMK14184.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Bim str. PUO 1247]
 gb|EMN06861.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Bim str. 1051]
 gb|EMN26937.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri serovar Sokoine str. RM1]
 gb|EMO68831.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. 200803703]
 gb|EMO78633.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira kirschneri str. 200801774]
 gb|KGR67200.1| 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Leptospira 
kirschneri serovar Mozdok]
Length=663

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



>ref|WP_002981464.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira vanthielii]
 gb|EMY69991.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira vanthielii serovar Holland str. Waz Holland = ATCC 
700522]
Length=679

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -1

Query  483  SFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPG  304
            SF++LQ  R+R TKTEY+SCPSCGRT+FDLQ  +A I+++T HL GV IA+MGCIVNGPG
Sbjct  567  SFDILQATRLRLTKTEYISCPSCGRTMFDLQSTTAMIKKRTGHLKGVKIAVMGCIVNGPG  626

Query  303  EMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            EMADADFGYVG   GK+ LY GK +VK+ ++ ++A D LIDLI+E+G W DP
Sbjct  627  EMADADFGYVGAGIGKVHLYKGKEIVKKGVSEEEAADQLIDLIRENGMWNDP  678



>ref|WP_020765666.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira santarosai]
 gb|EMK08546.1| putative 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase 
[Leptospira santarosai str. CBC613]
Length=663

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = -1

Query  507  DFDFIRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIM  328
            D + I   S++LLQG R+R TKTEY+SCPSCGRTLFDLQE +A I+ +T HL GV IA+M
Sbjct  541  DIEEIFQLSYDLLQGTRLRLTKTEYISCPSCGRTLFDLQETTARIKSRTGHLKGVKIAVM  600

Query  327  GCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAMDQATDALIDLIKEHGRWVDP  148
            GCIVNGPGEMADADFGYVG  PGK+ LY GK +V + +  + A + L+ LIK++G W DP
Sbjct  601  GCIVNGPGEMADADFGYVGAGPGKVHLYRGKEIVLKNVPSEIADEKLVQLIKDNGLWSDP  660



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140