BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013G11

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007222997.1|  hypothetical protein PRUPE_ppa010004mg             214   1e-64   
ref|XP_008390990.1|  PREDICTED: chlorophyllase-2, chloroplastic         211   8e-64   
ref|XP_009343942.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    212   4e-63   Pyrus x bretschneideri [bai li]
gb|KDO74483.1|  hypothetical protein CISIN_1g020950mg                   211   4e-63   Citrus sinensis [apfelsine]
ref|XP_009597039.1|  PREDICTED: chlorophyllase-2, chloroplastic         211   5e-63   Nicotiana tomentosiformis
ref|XP_010034594.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    209   2e-62   Eucalyptus grandis [rose gum]
ref|XP_002279285.1|  PREDICTED: chlorophyllase-2, chloroplastic         209   3e-62   Vitis vinifera
ref|XP_006489443.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    209   3e-62   Citrus sinensis [apfelsine]
ref|XP_006420011.1|  hypothetical protein CICLE_v10005453mg             209   3e-62   Citrus clementina [clementine]
ref|XP_008224250.1|  PREDICTED: chlorophyllase-2, chloroplastic         209   5e-62   Prunus mume [ume]
gb|ABY19383.1|  putative chlorophyllase                                 208   8e-62   Nicotiana tabacum [American tobacco]
gb|KDP40227.1|  hypothetical protein JCGZ_02225                         208   1e-61   Jatropha curcas
ref|XP_010092435.1|  Chlorophyllase-2                                   210   1e-61   
gb|KJB72301.1|  hypothetical protein B456_011G170100                    207   2e-61   Gossypium raimondii
ref|XP_009800026.1|  PREDICTED: chlorophyllase-2, chloroplastic         205   9e-61   Nicotiana sylvestris
ref|XP_009795214.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    201   9e-61   Nicotiana sylvestris
ref|XP_007145911.1|  hypothetical protein PHAVU_007G278100g             203   6e-60   Phaseolus vulgaris [French bean]
ref|XP_006350651.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    202   1e-59   Solanum tuberosum [potatoes]
ref|XP_008344678.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    200   2e-59   
gb|KEH41057.1|  chlorophyllase enzyme                                   201   2e-59   Medicago truncatula
ref|XP_004241041.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    201   2e-59   Solanum lycopersicum
ref|XP_004296572.2|  PREDICTED: chlorophyllase-2, chloroplastic         203   3e-59   Fragaria vesca subsp. vesca
ref|XP_006363484.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    201   3e-59   Solanum tuberosum [potatoes]
ref|XP_003537121.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    201   3e-59   Glycine max [soybeans]
dbj|BAF43703.1|  Chlorophyllase 1                                       201   3e-59   Glycine max [soybeans]
ref|XP_011030633.1|  PREDICTED: chlorophyllase-2, chloroplastic         201   5e-59   Populus euphratica
ref|XP_002315752.2|  Chlorophyllase 1 family protein                    201   9e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009393050.1|  PREDICTED: chlorophyllase-2, chloroplastic         199   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF43705.1|  Chlorophyllase 3                                       199   2e-58   Glycine max [soybeans]
ref|XP_010042520.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    197   2e-58   Eucalyptus grandis [rose gum]
emb|CDO99104.1|  unnamed protein product                                199   4e-58   Coffea canephora [robusta coffee]
ref|XP_010034577.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    198   4e-58   Eucalyptus grandis [rose gum]
gb|ADZ24715.1|  chlorophyllase                                          198   5e-58   Solanum pennellii
gb|ACJ85964.1|  unknown                                                 197   6e-58   Medicago truncatula
ref|XP_010932817.1|  PREDICTED: chlorophyllase-2, chloroplastic         198   6e-58   Elaeis guineensis
ref|XP_002517075.1|  Chlorophyllase-2, chloroplast precursor, put...    197   1e-57   Ricinus communis
ref|XP_010256174.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    196   4e-57   
ref|XP_008775648.1|  PREDICTED: chlorophyllase-2, chloroplastic         196   4e-57   Phoenix dactylifera
ref|XP_010256171.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    196   5e-57   
ref|XP_010256173.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    196   6e-57   
emb|CDO99123.1|  unnamed protein product                                203   9e-57   Coffea canephora [robusta coffee]
ref|XP_010695290.1|  PREDICTED: chlorophyllase-2, chloroplastic         195   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010256170.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    195   3e-56   Nelumbo nucifera [Indian lotus]
gb|AHZ35334.1|  chlorophyllase                                          192   8e-56   Picrorhiza kurrooa
gb|KEH41056.1|  chlorophyllase                                          192   1e-55   Medicago truncatula
ref|XP_007034857.1|  Chlorophyllase isoform 2                           192   1e-55   
ref|XP_007034856.1|  Chlorophyllase isoform 1                           192   1e-55   
emb|CDY32929.1|  BnaA09g16640D                                          191   3e-55   Brassica napus [oilseed rape]
ref|XP_009113977.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    191   5e-55   Brassica rapa
emb|CDY50811.1|  BnaCnng19750D                                          190   1e-54   Brassica napus [oilseed rape]
ref|XP_010481816.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    189   2e-54   Camelina sativa [gold-of-pleasure]
gb|EYU41443.1|  hypothetical protein MIMGU_mgv1a010077mg                188   5e-54   Erythranthe guttata [common monkey flower]
ref|XP_010441975.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    187   1e-53   Camelina sativa [gold-of-pleasure]
emb|CDX96924.1|  BnaC02g30620D                                          186   1e-53   
ref|XP_002865397.1|  chlorophyll-chlorophyllido hydrolase 2             187   1e-53   
ref|XP_004145391.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    186   3e-53   Cucumis sativus [cucumbers]
gb|AAP44978.1|  chlorophyllase                                          186   4e-53   Ginkgo biloba [ginkgo]
ref|XP_010326690.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    185   5e-53   Solanum lycopersicum
ref|XP_009123914.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    185   8e-53   Brassica rapa
ref|XP_010034586.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    184   1e-52   Eucalyptus grandis [rose gum]
ref|XP_006838958.1|  hypothetical protein AMTR_s00002p00270990          184   2e-52   Amborella trichopoda
ref|XP_010494369.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    184   2e-52   Camelina sativa [gold-of-pleasure]
gb|AAN51934.1|AF337545_1  chlorophyllase 2                              182   1e-51   Brassica oleracea
ref|NP_199199.1|  chlorophyllase 2                                      181   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAO22714.1|  putative AtCLH2 protein                                 181   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403171.1|  hypothetical protein EUTSA_v10003248mg             181   3e-51   
ref|XP_006282250.1|  hypothetical protein CARUB_v10028524mg             179   1e-50   Capsella rubella
gb|ACN40275.1|  unknown                                                 179   2e-50   Picea sitchensis
ref|XP_008449319.1|  PREDICTED: chlorophyllase-2, chloroplastic         178   2e-50   Cucumis melo [Oriental melon]
ref|XP_011090675.1|  PREDICTED: chlorophyllase-2, chloroplastic         178   2e-50   Sesamum indicum [beniseed]
ref|XP_003571791.2|  PREDICTED: chlorophyllase-2, chloroplastic-like    176   2e-49   Brachypodium distachyon [annual false brome]
gb|KFK31694.1|  hypothetical protein AALP_AA6G147200                    176   2e-49   Arabis alpina [alpine rockcress]
dbj|BAJ89583.1|  predicted protein                                      174   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010481814.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    172   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010441977.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    171   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010495652.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    171   2e-47   Camelina sativa [gold-of-pleasure]
gb|EMS51443.1|  Chlorophyllase-2, chloroplastic                         169   4e-47   Triticum urartu
ref|XP_009123919.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    169   1e-46   Brassica rapa
ref|XP_007200272.1|  hypothetical protein PRUPE_ppa014909mg             169   1e-46   Prunus persica
ref|XP_002467217.1|  hypothetical protein SORBIDRAFT_01g021520          168   6e-46   Sorghum bicolor [broomcorn]
ref|XP_002273926.1|  PREDICTED: chlorophyllase-1                        167   7e-46   Vitis vinifera
ref|XP_008235366.1|  PREDICTED: chlorophyllase-1                        166   9e-46   Prunus mume [ume]
ref|XP_002271974.1|  PREDICTED: chlorophyllase-1                        166   1e-45   Vitis vinifera
emb|CDJ26436.1|  unnamed protein product                                164   6e-45   Triticum aestivum [Canadian hard winter wheat]
gb|ACO50428.1|  chlorophyllase 1                                        164   7e-45   Pachira macrocarpa
gb|AEO19902.1|  chlorophyllase 1                                        162   3e-44   Pyrus x bretschneideri [bai li]
ref|XP_010096444.1|  hypothetical protein L484_002352                   162   4e-44   Morus notabilis
ref|XP_003528958.1|  PREDICTED: chlorophyllase-1                        162   5e-44   
gb|KFK44086.1|  hypothetical protein AALP_AA1G214200                    160   1e-43   Arabis alpina [alpine rockcress]
ref|XP_008355440.1|  PREDICTED: chlorophyllase-1-like                   160   2e-43   
gb|AAP92160.2|  chlorophyllase                                          160   2e-43   Piper betle
gb|AAN51933.1|AF337544_1  chlorophyllase 1                              160   2e-43   Brassica oleracea
emb|CDY38340.1|  BnaA02g18330D                                          160   3e-43   Brassica napus [oilseed rape]
ref|XP_004983205.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    160   3e-43   Setaria italica
gb|ACU24105.1|  unknown                                                 159   3e-43   Glycine max [soybeans]
gb|EPS63536.1|  hypothetical protein M569_11246                         158   3e-43   Genlisea aurea
ref|XP_008345193.1|  PREDICTED: chlorophyllase-1-like                   157   7e-43   
ref|XP_009149451.1|  PREDICTED: chlorophyllase-1                        158   1e-42   Brassica rapa
ref|XP_009370779.1|  PREDICTED: chlorophyllase-1-like                   158   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_010477190.1|  PREDICTED: chlorophyllase-1-like                   157   2e-42   Camelina sativa [gold-of-pleasure]
gb|ABR16879.1|  unknown                                                 157   4e-42   Picea sitchensis
gb|ABE01079.1|  chlorophyllase                                          156   5e-42   Piper betle
gb|ACO50429.1|  chlorophyllase 2                                        156   6e-42   Pachira macrocarpa
emb|CDP03668.1|  unnamed protein product                                155   6e-42   Coffea canephora [robusta coffee]
emb|CDY29413.1|  BnaA06g13830D                                          156   7e-42   Brassica napus [oilseed rape]
ref|XP_010498391.1|  PREDICTED: chlorophyllase-1-like                   156   8e-42   Camelina sativa [gold-of-pleasure]
gb|KHN44574.1|  Chlorophyllase-1                                        155   1e-41   Glycine soja [wild soybean]
ref|NP_001130783.1|  chlorophyllase-2                                   155   3e-41   Zea mays [maize]
ref|XP_004290630.1|  PREDICTED: chlorophyllase-1                        154   3e-41   Fragaria vesca subsp. vesca
ref|XP_006416475.1|  hypothetical protein EUTSA_v10008201mg             154   4e-41   Eutrema salsugineum [saltwater cress]
gb|ACG44273.1|  chlorophyllase-2                                        154   5e-41   Zea mays [maize]
gb|KDP21409.1|  hypothetical protein JCGZ_21880                         154   6e-41   Jatropha curcas
ref|XP_002893060.1|  coronatine-induced protein 1                       152   2e-40   
ref|XP_004956217.1|  PREDICTED: chlorophyllase-1-like                   152   2e-40   Setaria italica
ref|XP_010459642.1|  PREDICTED: chlorophyllase-1-like                   152   2e-40   Camelina sativa [gold-of-pleasure]
gb|AFK44490.1|  unknown                                                 147   2e-40   Lotus japonicus
emb|CBI28741.3|  unnamed protein product                                158   2e-40   Vitis vinifera
ref|XP_004512891.1|  PREDICTED: chlorophyllase-1-like                   152   3e-40   Cicer arietinum [garbanzo]
ref|NP_564094.1|  chlorophyllase 1                                      152   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003534159.1|  PREDICTED: chlorophyllase-1-like                   151   5e-40   Glycine max [soybeans]
ref|XP_003620408.1|  Chlorophyllase-1                                   151   5e-40   Medicago truncatula
ref|XP_001753563.1|  predicted protein                                  151   6e-40   
ref|XP_007152724.1|  hypothetical protein PHAVU_004G154100g             149   2e-39   Phaseolus vulgaris [French bean]
ref|XP_006304020.1|  hypothetical protein CARUB_v10009755mg             149   3e-39   Capsella rubella
gb|AEK97328.1|  chromoplast chlorophyllase                              145   4e-39   Brassica rapa var. parachinensis [cai xin]
ref|XP_002459848.1|  hypothetical protein SORBIDRAFT_02g012300          148   6e-39   
ref|XP_003528959.1|  PREDICTED: chlorophyllase-1-like                   148   6e-39   Glycine max [soybeans]
gb|AHJ14565.1|  chlorophyllase                                          148   9e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010523688.1|  PREDICTED: chlorophyllase-1                        148   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_008652459.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    147   2e-38   Zea mays [maize]
ref|XP_008465739.1|  PREDICTED: chlorophyllase-1-like                   147   2e-38   Cucumis melo [Oriental melon]
ref|XP_008787534.1|  PREDICTED: chlorophyllase-1                        146   4e-38   Phoenix dactylifera
ref|XP_010934773.1|  PREDICTED: chlorophyllase-1-like                   146   4e-38   Elaeis guineensis
ref|XP_002520936.1|  Chlorophyllase-1, putative                         143   9e-38   
ref|XP_009376014.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    139   1e-37   Pyrus x bretschneideri [bai li]
gb|EMT19932.1|  Chlorophyllase-1                                        144   2e-37   
ref|XP_010256231.1|  PREDICTED: chlorophyllase-1-like                   145   5e-37   
ref|NP_001064620.1|  Os10g0419600                                       144   8e-37   
gb|EMS62705.1|  Chlorophyllase-1                                        142   1e-36   Triticum urartu
ref|XP_003576870.1|  PREDICTED: chlorophyllase-1-like                   142   1e-36   Brachypodium distachyon [annual false brome]
ref|XP_003565235.1|  PREDICTED: chlorophyllase-1-like                   142   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_008449344.1|  PREDICTED: chlorophyllase-1-like                   142   2e-36   
gb|KCW84161.1|  hypothetical protein EUGRSUZ_B01023                     139   4e-36   Eucalyptus grandis [rose gum]
ref|XP_008386540.1|  PREDICTED: LOW QUALITY PROTEIN: chlorophylla...    140   1e-35   
ref|XP_004143780.1|  PREDICTED: chlorophyllase-1-like                   139   3e-35   Cucumis sativus [cucumbers]
gb|EMS58425.1|  Chlorophyllase-2, chloroplastic                         139   3e-35   Triticum urartu
gb|KDP21408.1|  hypothetical protein JCGZ_21879                         139   4e-35   Jatropha curcas
ref|XP_002271936.2|  PREDICTED: chlorophyllase-1                        138   4e-35   Vitis vinifera
ref|XP_003632330.1|  PREDICTED: chlorophyllase-1-like                   137   1e-34   Vitis vinifera
gb|EEE50970.1|  hypothetical protein OsJ_31546                          136   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002273956.1|  PREDICTED: chlorophyllase-1-like                   135   5e-34   Vitis vinifera
emb|CBI28744.3|  unnamed protein product                                138   5e-34   Vitis vinifera
gb|EYU46277.1|  hypothetical protein MIMGU_mgv1a022687mg                135   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_009760775.1|  PREDICTED: chlorophyllase-1-like                   132   4e-33   Nicotiana sylvestris
ref|XP_011090376.1|  PREDICTED: chlorophyllase-1-like                   133   5e-33   Sesamum indicum [beniseed]
gb|EYU43828.1|  hypothetical protein MIMGU_mgv1a009904mg                132   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_009777296.1|  PREDICTED: chlorophyllase-1-like isoform X2        130   1e-32   Nicotiana sylvestris
emb|CAN82816.1|  hypothetical protein VITISV_044164                     131   1e-32   Vitis vinifera
ref|XP_009777295.1|  PREDICTED: chlorophyllase-1-like isoform X1        130   3e-32   Nicotiana sylvestris
gb|EMT11146.1|  Chlorophyllase-2, chloroplastic                         128   4e-32   
ref|XP_009791851.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    129   1e-31   Nicotiana sylvestris
ref|XP_002444588.1|  hypothetical protein SORBIDRAFT_07g024090          129   1e-31   Sorghum bicolor [broomcorn]
emb|CBI28739.3|  unnamed protein product                                128   4e-31   Vitis vinifera
ref|XP_002963743.1|  hypothetical protein SELMODRAFT_66990              125   1e-30   
ref|XP_006388207.1|  hypothetical protein POPTR_0284s00200g             127   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_002974826.1|  hypothetical protein SELMODRAFT_57004              124   2e-30   
ref|XP_003572503.1|  PREDICTED: chlorophyllase type 0-like              124   5e-30   Brachypodium distachyon [annual false brome]
ref|XP_010326402.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    124   6e-30   Solanum lycopersicum
ref|XP_004247197.1|  PREDICTED: chlorophyllase-2, chloroplastic i...    124   6e-30   Solanum lycopersicum
ref|XP_002306793.2|  hypothetical protein POPTR_0005s23590g             125   7e-30   Populus trichocarpa [western balsam poplar]
gb|ACI06105.1|  chlorophyllase                                          124   7e-30   Citrus limon [lemon]
ref|XP_009588380.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    124   8e-30   Nicotiana tomentosiformis
sp|Q94LX1.1|CLH1_CITUN  RecName: Full=Chlorophyllase-1, chloropla...    124   8e-30   Citrus unshiu [satsuma mandarin]
ref|NP_001169192.1|  uncharacterized protein LOC100383045               123   9e-30   
gb|ACN32030.1|  unknown                                                 124   1e-29   Zea mays [maize]
ref|NP_001275819.1|  chlorophyllase-1, chloroplastic                    123   2e-29   Citrus sinensis [apfelsine]
ref|XP_006443995.1|  hypothetical protein CICLE_v10021103mg             123   3e-29   Citrus clementina [clementine]
ref|XP_006441463.1|  hypothetical protein CICLE_v10021095mg             120   2e-28   Citrus clementina [clementine]
ref|XP_006494924.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    120   3e-28   
ref|XP_006478133.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    120   3e-28   Citrus sinensis [apfelsine]
sp|Q9LE89.1|CLH0_CHEAL  RecName: Full=Chlorophyllase type 0; AltN...    120   4e-28   Chenopodium album [lamb's-quarters]
ref|XP_011032645.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    119   5e-28   Populus euphratica
ref|XP_006838962.1|  hypothetical protein AMTR_s00002p00271040          117   5e-28   
ref|XP_006349715.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    118   8e-28   
ref|XP_002978190.1|  hypothetical protein SELMODRAFT_176680             117   2e-27   Selaginella moellendorffii
ref|XP_002966376.1|  hypothetical protein SELMODRAFT_85435              115   4e-27   
ref|XP_002520934.1|  Chlorophyllase-1, putative                         114   1e-26   
gb|AFX87349.1|  chlorophyllase 1                                        111   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87353.1|  chlorophyllase 1                                        111   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87076.1|  chlorophyllase 1                                        111   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87231.1|  chlorophyllase 1                                        110   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87140.1|  chlorophyllase 1                                        110   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87080.1|  chlorophyllase 1                                        110   2e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87074.1|  chlorophyllase 1                                        110   3e-26   Arabidopsis lyrata subsp. petraea
ref|XP_002966378.1|  hypothetical protein SELMODRAFT_86398              114   3e-26   
gb|AFX87361.1|  chlorophyllase 1                                        110   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AFX87198.1|  chlorophyllase 1                                        110   3e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87374.1|  chlorophyllase 1                                        110   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AFX87318.1|  chlorophyllase 1                                        110   5e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87077.1|  chlorophyllase 1                                        109   5e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87357.1|  chlorophyllase 1                                        109   6e-26   Arabidopsis lyrata subsp. petraea
gb|AFX87079.1|  chlorophyllase 1                                        109   8e-26   Arabidopsis lyrata subsp. petraea
gb|AFR54123.1|  chlorophyllase                                          110   9e-26   Populus deltoides x Populus tremuloides
gb|AFX87110.1|  chlorophyllase 1                                        108   1e-25   Arabidopsis lyrata subsp. petraea
gb|KDP21407.1|  hypothetical protein JCGZ_21878                         112   2e-25   Jatropha curcas
ref|XP_011080324.1|  PREDICTED: chlorophyllase-1, chloroplastic-like    112   2e-25   
gb|KJB25943.1|  hypothetical protein B456_004G217500                    110   4e-25   Gossypium raimondii
ref|XP_010669257.1|  PREDICTED: chlorophyllase type 0-like isofor...    110   1e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO37483.1|  hypothetical protein CISIN_1g043492mg                   108   2e-24   Citrus sinensis [apfelsine]
ref|XP_006443996.1|  hypothetical protein CICLE_v10024279mg             107   2e-24   
ref|XP_004964134.1|  PREDICTED: chlorophyllase-1-like                   106   3e-24   
ref|XP_010096443.1|  Chlorophyllase-1                                   107   1e-23   
ref|XP_006363512.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    104   8e-23   Solanum tuberosum [potatoes]
ref|XP_004251483.1|  PREDICTED: chlorophyllase-2, chloroplastic-like    102   6e-22   Solanum lycopersicum
gb|KDP21405.1|  hypothetical protein JCGZ_21876                         100   6e-22   Jatropha curcas
gb|ABK26334.1|  unknown                                               99.0    1e-20   Picea sitchensis
gb|EEC66959.1|  hypothetical protein OsI_33606                        98.2    2e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009594424.1|  PREDICTED: chlorophyllase-1-like                 95.1    2e-20   
ref|XP_002459847.1|  hypothetical protein SORBIDRAFT_02g012201        96.7    2e-20   
ref|XP_008355464.1|  PREDICTED: chlorophyllase-1-like                 93.6    2e-20   
ref|XP_011032785.1|  PREDICTED: chlorophyllase type 0-like            92.8    2e-19   Populus euphratica
gb|KGN61685.1|  hypothetical protein Csa_2G224250                     93.2    2e-19   Cucumis sativus [cucumbers]
dbj|BAG55223.1|  chlorophyllase                                       90.1    4e-19   Sesbania rostrata
ref|XP_010669258.1|  PREDICTED: chlorophyllase type 0-like isofor...  90.1    9e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002978187.1|  hypothetical protein SELMODRAFT_107983           89.0    2e-17   
ref|XP_010326403.1|  PREDICTED: chlorophyllase-1 isoform X3           88.2    3e-17   Solanum lycopersicum
gb|AFK36235.1|  unknown                                               84.3    3e-16   Medicago truncatula
gb|KHN00266.1|  Chlorophyllase-2, chloroplastic                       77.0    1e-14   Glycine soja [wild soybean]
emb|CDP11312.1|  unnamed protein product                              74.7    9e-14   Coffea canephora [robusta coffee]
dbj|BAO47884.1|  chlorophyllase                                       72.8    5e-13   Dianthus caryophyllus [carnation]
ref|XP_010326404.1|  PREDICTED: chlorophyllase-2, chloroplastic i...  68.2    2e-10   
gb|KCW84158.1|  hypothetical protein EUGRSUZ_B01020                   63.9    6e-10   Eucalyptus grandis [rose gum]
dbj|BAD21503.1|  hypothetical protein                                 61.2    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ22614.1|  hypothetical protein OsJ_06283                        61.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004345599.1|  hypothetical protein CAOG_06009                  63.5    3e-08   Capsaspora owczarzaki ATCC 30864
tpg|DAA48625.1|  TPA: hypothetical protein ZEAMMB73_996983            60.8    4e-08   
gb|EGV18485.1|  amidohydrolase 2                                      61.2    2e-07   Thiocapsa marina 5811
ref|WP_040731129.1|  hypothetical protein                             61.2    2e-07   
ref|XP_005650113.1|  alpha/beta-hydrolase                             55.8    8e-06   Coccomyxa subellipsoidea C-169
ref|WP_015746913.1|  chlorophyllase                                   51.6    2e-04   Nakamurella multipartita
ref|XP_005824997.1|  hypothetical protein GUITHDRAFT_165302           50.1    0.001   Guillardia theta CCMP2712



>ref|XP_007222997.1| hypothetical protein PRUPE_ppa010004mg [Prunus persica]
 gb|EMJ24196.1| hypothetical protein PRUPE_ppa010004mg [Prunus persica]
Length=268

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 131/180 (73%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKV+FALALGK    + KFSA+IG+DPV G      T P VL   P  FDL+M
Sbjct  86   LAGHSRGGKVSFALALGKEGNTNRKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLDM  145

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+++C+ PAC  VAKDYGH DMLDD+T+G 
Sbjct  146  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKPACYFVAKDYGHLDMLDDETKG-  204

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIID-QTETAPVELQPV  221
            +RG  TYC+CKNG +R PMR FVGG VVAFL+ +LE D + LM I D   ET PVELQ V
Sbjct  205  IRGKSTYCLCKNGKSREPMRKFVGGVVVAFLQAYLEGDNSHLMAIRDGLDETVPVELQIV  264



>ref|XP_008390990.1| PREDICTED: chlorophyllase-2, chloroplastic [Malus domestica]
Length=255

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT-ADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGKV+FALALGK      LKFSA+IG+DPV G      T P VL   P  FDL+
Sbjct  73   LAGHSRGGKVSFALALGKEEIGTSLKFSALIGIDPVDGMDKGKQTPPPVLTYAPHSFDLD  132

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  MVIGSGLG+VKKN L   CAPKG N+  F+++CR PAC  VAKDYGH DMLDD+T+G
Sbjct  133  MAVMVIGSGLGEVKKNPLFPXCAPKGVNHEDFFNECRKPACYFVAKDYGHLDMLDDETKG  192

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             +RG  TYC+CKNG +R PMR FVGG VVAF++ +LE D + L+ I +  ET P+ELQ V
Sbjct  193  -IRGKATYCLCKNGQSREPMRRFVGGVVVAFIKAYLEGDSSHLLAIREGVETLPIELQXV  251



>ref|XP_009343942.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic 
[Pyrus x bretschneideri]
Length=351

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 130/178 (73%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT-ADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGKV+FALALGK  T   LKFSA+IG+DPV G      T P VL   P  FDL+
Sbjct  169  LAGHSRGGKVSFALALGKXETGTSLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLD  228

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  MVIGSGLG+VKKN L  PCAPKG N+  F+++CR  AC  VAKDYGH DMLDD+T+G
Sbjct  229  MAVMVIGSGLGEVKKNPLFPPCAPKGVNHEDFFNECRKWACYFVAKDYGHLDMLDDETKG  288

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG  TYC+CKNG +R PMR FVGG VVAF++ +LE D + L+ I +  ET P+ELQ
Sbjct  289  -IRGKATYCLCKNGKSREPMRRFVGGVVVAFIKAYLEGDSSHLLAIREGVETLPIELQ  345



>gb|KDO74483.1| hypothetical protein CISIN_1g020950mg [Citrus sinensis]
Length=319

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K AT  LK+SA+IGVDPV G      T P VL   P  FDL M
Sbjct  139  LAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTYIPHSFDLGM  197

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIGSGLG++KKN L  PCAPKG N+  F+++CR PAC  V KDYGH DMLDDDT+G 
Sbjct  198  PVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLDMLDDDTKG-  256

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR  +GG +VAF++ +L+ D+  LM I  + ETAP E + V+
Sbjct  257  IRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIRKEQETAPAEFETVE  316



>ref|XP_009597039.1| PREDICTED: chlorophyllase-2, chloroplastic [Nicotiana tomentosiformis]
Length=318

 Score =   211 bits (537),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 130/182 (71%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGKVAFALALGK A  + +LKFSA+IGVDPV G      T P VL  TP  F+L
Sbjct  135  LAGHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTPHSFNL  194

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  MVIGSGLG+VKKNLL   CAP G N+  FYS+C  PAC  VAKDYGH DMLDD+T+
Sbjct  195  DMSVMVIGSGLGEVKKNLLFPACAPNGVNHRDFYSECCKPACYFVAKDYGHNDMLDDETK  254

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE   + LM I D   T PVELQ 
Sbjct  255  G-IRGKATYCLCKKGKSREPMRRFVGGFLVAFLEAYLEGKSSELMAIRDGNFTLPVELQD  313

Query  223  VD  218
            +D
Sbjct  314  ID  315



>ref|XP_010034594.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
Length=321

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 131/181 (72%), Gaps = 8/181 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            ++GHSRGGK AFALALGK+AT   L FSA++G+DPV G      T P VL   P  FDL 
Sbjct  139  VAGHSRGGKAAFALALGKSATPLALPFSALLGIDPVDGMDKGKQTPPPVLTYAPRSFDLG  198

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP +V+GSGLG+V+KN L   CAP+G N+A F+++CR PAC  VA+ YGH DMLDD+T G
Sbjct  199  MPVVVVGSGLGEVRKNPLFPACAPRGVNHADFFAECRPPACYFVAEKYGHLDMLDDETEG  258

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             LRG  TYC+CKNG AR PMR FVGG VVAFLR +LE D   LMG+ D  E APVELQ V
Sbjct  259  -LRGKATYCLCKNGRAREPMRRFVGGVVVAFLRAYLEGDDAALMGLRDGHEVAPVELQKV  317

Query  220  D  218
            +
Sbjct  318  E  318



>ref|XP_002279285.1| PREDICTED: chlorophyllase-2, chloroplastic [Vitis vinifera]
 emb|CBI26305.3| unnamed protein product [Vitis vinifera]
Length=322

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 131/180 (73%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K +T+ LKFSA+IG+DPV G      T P VL   P  FDL+M
Sbjct  142  LAGHSRGGKTAFALALRKASTS-LKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLDM  200

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+ +CR PAC  +AKDYGH DMLDD+T G 
Sbjct  201  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECREPACYFLAKDYGHLDMLDDETNG-  259

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  T+C+C+NG +R PMR FVGG V+AF++ +LE D + L+ I D   TAPVELQ V+
Sbjct  260  IRGKATHCLCRNGKSREPMRRFVGGIVIAFMKAYLEGDNSSLISIRDGHATAPVELQNVE  319



>ref|XP_006489443.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Citrus sinensis]
Length=319

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 128/180 (71%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K AT  LK+SA+IGVDPV G      T P VL   P  FDL M
Sbjct  139  LAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTYIPHSFDLGM  197

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIGSGLG++KKN L  PCAPKG N+  F+++CR PAC  V KDYGH DMLDDDT+G 
Sbjct  198  PVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLDMLDDDTKG-  256

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR  +GG +VAF++ +L+ D+  LM I    ETAP E + V+
Sbjct  257  IRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIRKGQETAPAEFETVE  316



>ref|XP_006420011.1| hypothetical protein CICLE_v10005453mg [Citrus clementina]
 gb|ESR33251.1| hypothetical protein CICLE_v10005453mg [Citrus clementina]
Length=319

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 128/180 (71%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K AT  LK+SA+IGVDPV G      T P VL   P  FDL M
Sbjct  139  LAGHSRGGKAAFALALKKGATT-LKYSALIGVDPVDGMDKGKQTPPPVLTYIPHSFDLGM  197

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIGSGLG++KKN L  PCAPKG N+  F+++CR PAC  V KDYGH DMLDDDT+G 
Sbjct  198  PVMVIGSGLGEIKKNPLFPPCAPKGVNHKDFFNECRTPACHFVVKDYGHLDMLDDDTKG-  256

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR  +GG +VAF++ +L+ D+  LM I    ETAP E + V+
Sbjct  257  IRGKATYCLCKNGKSREPMRRSIGGIIVAFMKAYLDGDITDLMAIRKGQETAPAEFETVE  316



>ref|XP_008224250.1| PREDICTED: chlorophyllase-2, chloroplastic [Prunus mume]
Length=329

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKV+FALA G+    + KFSA+IG+DPV G      T P VL   P  FDL+M
Sbjct  147  LAGHSRGGKVSFALAFGQEGNTNRKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLDM  206

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+++C+ PAC  VAKDYGH DMLDD+T+G 
Sbjct  207  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKPACYFVAKDYGHLDMLDDETKG-  265

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIID-QTETAPVELQPV  221
            +RG  TYC+CKNG +R PMR FVGG VVAFL+ +LE D + L  I D   ET PVELQ V
Sbjct  266  IRGKSTYCVCKNGKSREPMRKFVGGVVVAFLQAYLEGDSSHLTAIKDGLDETVPVELQIV  325



>gb|ABY19383.1| putative chlorophyllase [Nicotiana tabacum]
Length=318

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 129/182 (71%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGKVAFALALGK A  + +LKFSA+IGVDPV G      T P VL  TP  F+L
Sbjct  135  LAGHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTPHSFNL  194

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  MVIGSGLG+VKKN L   CAP G N+  FYS+C  PAC  VAKDYGH DMLDD+T+
Sbjct  195  DMAVMVIGSGLGEVKKNPLFPACAPNGVNHCDFYSECCKPACYFVAKDYGHNDMLDDETK  254

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE   + LM I D   T PVELQ 
Sbjct  255  G-IRGKATYCLCKKGKSREPMRRFVGGILVAFLEAYLEGKSSELMAIRDGNVTLPVELQD  313

Query  223  VD  218
            +D
Sbjct  314  ID  315



>gb|KDP40227.1| hypothetical protein JCGZ_02225 [Jatropha curcas]
Length=320

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 127/177 (72%), Gaps = 9/177 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            ++GHSRGGK AFALAL KTAT  LKFSAIIGVDPV G      T P VL   P  FDL+M
Sbjct  141  IAGHSRGGKAAFALALRKTATT-LKFSAIIGVDPVDGMDKGKQTPPPVLTYVPHSFDLDM  199

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
             AMVIGSGLG++K+N +  PCAPKG N+  FY +C  PAC  V KDYGH DMLDDDT+G 
Sbjct  200  AAMVIGSGLGELKRNPMFPPCAPKGVNHEDFYKECEKPACYFVVKDYGHLDMLDDDTKG-  258

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            +RG  TYC+C NG +R PMR F+GG +VAFLR +LE D + LM  I   +T PVELQ
Sbjct  259  IRGKSTYCLCVNGKSREPMRRFIGGVIVAFLRAYLEDDGSDLMA-IGNGQTGPVELQ  314



>ref|XP_010092435.1| Chlorophyllase-2 [Morus notabilis]
 gb|EXB51153.1| Chlorophyllase-2 [Morus notabilis]
Length=418

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 126/182 (69%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK +FALAL K     LKFSA+IG+DPV G      T P VL   P  FDL M
Sbjct  235  LAGHSRGGKTSFALALSKETITTLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLGM  294

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MV+GSGLG+VK+N L  PCAPKG N+  F+ +CR PAC  V KDYGH DMLDD+T+G 
Sbjct  295  PVMVVGSGLGEVKRNPLFPPCAPKGVNHEDFFKECREPACYFVVKDYGHVDMLDDETKG-  353

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA--PVELQP  224
            +RG  TYC+CKNG  R PMR FVGG V+AF++ +LE D   LM I +++     PVEL+ 
Sbjct  354  IRGKTTYCLCKNGKTREPMRKFVGGVVIAFMKAYLEGDKRSLMAIRERSSDGDLPVELKT  413

Query  223  VD  218
            ++
Sbjct  414  IE  415



>gb|KJB72301.1| hypothetical protein B456_011G170100 [Gossypium raimondii]
Length=310

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 127/180 (71%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKVAFALAL KT T  LKFS +IG+DPV G      T P VL   P  FDL+M
Sbjct  130  LAGHSRGGKVAFALALQKTMT-KLKFSTLIGIDPVDGMDKGKQTPPPVLTYIPHSFDLDM  188

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+ +CR PAC +VAKDYGH DMLDD+T G 
Sbjct  189  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECRKPACHIVAKDYGHLDMLDDETNG-  247

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             RG  +YC+CKNG AR PMR FVGG VVA ++ +L  D   L+ I D  E APVEL+ ++
Sbjct  248  FRGRSSYCLCKNGEAREPMRRFVGGVVVASMKAYLNGDNTDLIAIKDGHEAAPVELKTIE  307



>ref|XP_009800026.1| PREDICTED: chlorophyllase-2, chloroplastic [Nicotiana sylvestris]
Length=319

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 128/182 (70%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGKVAFALALGK A  + +LKFSA+IGVDPV G      T P VL  T   F+L
Sbjct  136  LAGHSRGGKVAFALALGKIANISTNLKFSALIGVDPVDGMDKGKQTPPAVLTYTRHSFNL  195

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  MVIGSGLG+VKKN L   CAP G N+  FYS+C  PAC  VAKDYGH DMLDD+T+
Sbjct  196  DMAVMVIGSGLGEVKKNPLFPACAPNGVNHRDFYSECCKPACYFVAKDYGHNDMLDDETK  255

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE   + LM I D   T PVELQ 
Sbjct  256  G-IRGKATYCLCKKGKSREPMRRFVGGILVAFLEAYLEGKSSELMAIRDGNVTLPVELQD  314

Query  223  VD  218
            +D
Sbjct  315  ID  316



>ref|XP_009795214.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic-like 
[Nicotiana sylvestris]
Length=202

 Score =   201 bits (512),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 127/182 (70%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGKVAFALALGK A  + +LKFSA+IGVD V G      T P VL  TP  F+L
Sbjct  19   LAGHSRGGKVAFALALGKIANISTNLKFSALIGVDLVDGMDKGKQTPPSVLTYTPYSFNL  78

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  MVIGSGLG+VKKN L   CAP G N+  FY +C  PAC  VAKDYGH DMLDD+T+
Sbjct  79   DMAVMVIGSGLGEVKKNPLFPACAPNGVNHRNFYRECCKPACYFVAKDYGHNDMLDDETK  138

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE   + LM I D   T PVELQ 
Sbjct  139  G-IRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGKSSELMAIRDGNVTLPVELQD  197

Query  223  VD  218
            +D
Sbjct  198  ID  199



>ref|XP_007145911.1| hypothetical protein PHAVU_007G278100g [Phaseolus vulgaris]
 gb|ESW17905.1| hypothetical protein PHAVU_007G278100g [Phaseolus vulgaris]
Length=313

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 126/178 (71%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFAL+L +   + D+KFSA+IGVDPV G        P VL   P  FDL+
Sbjct  132  LSGHSRGGKTAFALSLRRLNISTDIKFSALIGVDPVDGMDKGKQIPPPVLTYVPHSFDLD  191

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP MVIGSGLG+VK+N L  PCAPKG N+  F+ +C+ PA   VAKDYGH+DMLDDDT+G
Sbjct  192  MPVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFKECKKPAWYFVAKDYGHSDMLDDDTKG  251

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG  TYC+CKNG +R PMR FVGG +VAFL+ +L+ D   L+ I D   + P+E +
Sbjct  252  -IRGKATYCLCKNGDSRKPMRRFVGGVIVAFLKAYLQDDYGDLLAIRDMHVSLPLEFK  308



>ref|XP_006350651.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=315

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFD-  587
            L+GHSRGGKVAF+LALG+ A  + DLKFSA+IGVDPV G      T P VL   P  F+ 
Sbjct  131  LAGHSRGGKVAFSLALGRLANISTDLKFSALIGVDPVDGMDKGKQTPPSVLTYVPRSFNN  190

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            L+MP MVIGSGLG+VKKN L   CAPKG N+  FY++C  PAC  VAKDYGH DMLDD+T
Sbjct  191  LDMPVMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDDET  250

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            +G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE + + L+ I D   T PVELQ
Sbjct  251  KG-IRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSDLIAIRDGHVTLPVELQ  309

Query  226  PVD  218
              D
Sbjct  310  DTD  312



>ref|XP_008344678.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic-like 
[Malus domestica]
Length=245

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 125/182 (69%), Gaps = 10/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK---TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFD  587
            L GHSR GKV+FALALGK     +  LKFSA+IG+DPV G      T P VL      F 
Sbjct  61   LVGHSRRGKVSFALALGKGKEETSXSLKFSALIGIDPVDGMDTGKQTPPPVLTYVLQSFH  120

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            L MP MVIGSGLG+VK+N L  PCAPKG N+  F+++CR  AC  VA DYGH DMLDDDT
Sbjct  121  LEMPVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECRKLACYFVAXDYGHLDMLDDDT  180

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            +G + G  TYC+CKNG +R PMR FVGG VVAF++ +LE D + L+ I +  ET P+ELQ
Sbjct  181  KG-ITGKATYCLCKNGKSREPMRRFVGGVVVAFIKAYLEGDSSHLLAIREGVETLPIELQ  239

Query  226  PV  221
             V
Sbjct  240  IV  241



>gb|KEH41057.1| chlorophyllase enzyme [Medicago truncatula]
Length=306

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 125/178 (70%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L GHSRGGK +FA+AL K   T DLKFSAIIGVDPV G      T P +L   P  FD +
Sbjct  125  LGGHSRGGKTSFAVALRKLNMTTDLKFSAIIGVDPVDGMDKGKQTSPPILTYVPHSFDYD  184

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  +VIGSGLGDVKKN L  PCAPKG N+  F+S+C  P+   VAKDYGH DMLDDDT+G
Sbjct  185  MATLVIGSGLGDVKKNPLFPPCAPKGVNHEDFFSECEKPSWYFVAKDYGHVDMLDDDTKG  244

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG ++YC+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I D+  + P+E++
Sbjct  245  -VRGKVSYCLCKNGESRKPMRMFVGGVMVAFLKAYLHGDNVDLLAIRDKNLSVPIEMK  301



>ref|XP_004241041.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum lycopersicum]
Length=312

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 130/181 (72%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYF-DLN  581
            L+GHSRGGKVAF+LALG+ A+ DLKFSA+IGVDPV G      T P VL   P  F +L+
Sbjct  131  LAGHSRGGKVAFSLALGRLAS-DLKFSALIGVDPVDGMEKGKQTPPSVLTYVPRSFINLD  189

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP MVIGSGLG+VKKN L   CAPKG N+  FY++C  PAC  VAKDYGH DMLD++T+G
Sbjct  190  MPVMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDEETKG  249

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             +RG  TYC+CK G +R PMR FVGG +VAFL  +LE + + L+ I D     PVELQ +
Sbjct  250  -IRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSHLIAIRDGHVALPVELQDI  308

Query  220  D  218
            D
Sbjct  309  D  309



>ref|XP_004296572.2| PREDICTED: chlorophyllase-2, chloroplastic [Fragaria vesca subsp. 
vesca]
 ref|XP_011462452.1| PREDICTED: chlorophyllase-2, chloroplastic [Fragaria vesca subsp. 
vesca]
 ref|XP_011462453.1| PREDICTED: chlorophyllase-2, chloroplastic [Fragaria vesca subsp. 
vesca]
 ref|XP_011462454.1| PREDICTED: chlorophyllase-2, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=363

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 130/183 (71%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGKV+FALALGK   T  LKFSA+IG+DPV G      T P VL   P  FDL 
Sbjct  179  LAGHSRGGKVSFALALGKEGITTSLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFDLE  238

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             M  MVIG+GLG+VK+N L   CAPKG N+  F+++CR PAC  VAKDYGH DMLDD+T+
Sbjct  239  GMAVMVIGTGLGEVKRNPLFPACAPKGVNHEDFFNECRKPACYFVAKDYGHLDMLDDETK  298

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  TYC+CKNG +R PMR FVGG VVAF++ +L  D N LM I +   + AP+ELQ
Sbjct  299  G-VRGKATYCLCKNGKSREPMRKFVGGVVVAFIKAYLGGDSNELMAISEAGYDAAPIELQ  357

Query  226  PVD  218
             V+
Sbjct  358  SVE  360



>ref|XP_006363484.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=318

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 129/184 (70%), Gaps = 9/184 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA--TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGK AFALALGK A  T +LKFSA+IG+DPV G      T P VL   P  F+L
Sbjct  135  LAGHSRGGKAAFALALGKVANVTTNLKFSALIGIDPVDGVDKGIQTTPPVLTYIPQSFNL  194

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  +VIGSGLG+VK+N L   CAP G N+  FY++C  P C +VAKDYGH DMLDD+T+
Sbjct  195  DMAVLVIGSGLGEVKRNPLFPACAPNGVNHRDFYNECCRPVCYVVAKDYGHVDMLDDETK  254

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TYC+CKNG +R PMR FVGG VVAFL  +L+ + + LM I D   T PVELQ 
Sbjct  255  G-VRGKATYCLCKNGKSREPMRRFVGGIVVAFLEDYLKGNSSDLMAIKDGYITLPVELQD  313

Query  223  VDSK  212
             D +
Sbjct  314  ADFR  317



>ref|XP_003537121.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Glycine max]
 gb|KHN10078.1| Chlorophyllase-2, chloroplastic [Glycine soja]
Length=326

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 127/178 (71%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGK AFALAL K   T +LKFSA+IGVDPV G      T P VL   P+ FD +
Sbjct  145  LAGHSRGGKTAFALALRKLNITTNLKFSALIGVDPVDGMDKGKQTPPPVLTYVPNSFDFD  204

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  MVIGSGLG+VK+N L  PCAPKG N+  F+++C+ PA   VAKDYGH+DMLDDDT+G
Sbjct  205  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNECKKPAWYFVAKDYGHSDMLDDDTKG  264

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG  T C+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I D+  + PVE++
Sbjct  265  -IRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLHDDNEDLLTIRDRHVSLPVEIK  321



>dbj|BAF43703.1| Chlorophyllase 1 [Glycine max]
Length=326

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 127/178 (71%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGK AFALAL K   T +LKFSA+IGVDPV G      T P VL   P+ FD +
Sbjct  145  LAGHSRGGKTAFALALRKLNITTNLKFSALIGVDPVDGMDKGKQTPPPVLTYVPNSFDFD  204

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  MVIGSGLG+VK+N L  PCAPKG N+  F+++C+ PA   VAKDYGH+DMLDDDT+G
Sbjct  205  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNECKKPAWYFVAKDYGHSDMLDDDTKG  264

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG  T C+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I D+  + PVE++
Sbjct  265  -IRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLHDDNEDLLTIRDRHVSLPVEIK  321



>ref|XP_011030633.1| PREDICTED: chlorophyllase-2, chloroplastic [Populus euphratica]
Length=334

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K AT  LKFSA+IGVDPV G      T P VL   P  FDL+M
Sbjct  155  LAGHSRGGKTAFALALEKAATT-LKFSALIGVDPVDGMDKGKQTPPPVLTYVPHSFDLDM  213

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG++KKN L  PCAP+G N+  F+ +C+ PA   V KDYGH DMLDDDT G 
Sbjct  214  ATMVIGSGLGELKKNPLFPPCAPEGVNHKDFFKECKGPASYFVVKDYGHLDMLDDDTEG-  272

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR F+GG VVAF++ +L  D + LM  I   +T PVELQ V+
Sbjct  273  IRGKATYCLCKNGKSREPMRKFIGGVVVAFMKAYLGGDSSDLMA-IKGGQTGPVELQTVE  331



>ref|XP_002315752.2| Chlorophyllase 1 family protein [Populus trichocarpa]
 gb|EEF01923.2| Chlorophyllase 1 family protein [Populus trichocarpa]
Length=334

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 126/180 (70%), Gaps = 9/180 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGK AFALAL K A A LKFSA+IGVDPV G      T P VL   P  FDL+M
Sbjct  155  LAGHSRGGKTAFALALEKAA-ATLKFSALIGVDPVDGMDKGKQTPPPVLTYVPHSFDLDM  213

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG++KKN L  PCAP+G N+  F+ +C+ PA   V KDYGH DMLDDDT G 
Sbjct  214  AIMVIGSGLGELKKNPLFPPCAPEGVNHKDFFKECKGPASYFVVKDYGHLDMLDDDTEG-  272

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR F+GG VVAF++ +L  D + LM  I   +T PVELQ V+
Sbjct  273  IRGKTTYCLCKNGKSREPMRKFIGGVVVAFMKAYLGGDSSDLMA-IKGGQTGPVELQTVE  331



>ref|XP_009393050.1| PREDICTED: chlorophyllase-2, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            + GHSRGGKVAFALALG   T  L+FSA+IGV PV G      T P +L   P  FDL M
Sbjct  126  IGGHSRGGKVAFALALGHAKTT-LEFSALIGVGPVDGMEKGKQTRPPILTYVPHSFDLKM  184

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
             A+VIGSGLG++KK+ L   CAPKG N+  F+ +CR PA   VAK+YGH DMLDD+T G 
Sbjct  185  AALVIGSGLGELKKSPLFPACAPKGVNHQDFFDECRPPAYHFVAKEYGHQDMLDDETSG-  243

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CK GP+R PMRAFVGGA+VAF++ +LE D   L  I+D  + +PVEL    
Sbjct  244  VRGKATYCLCKKGPSRKPMRAFVGGAMVAFMKSYLEGDTQFLTAIVDDPQISPVELSTAT  303

Query  217  SKDL  206
            S +L
Sbjct  304  SLEL  307



>dbj|BAF43705.1| Chlorophyllase 3 [Glycine max]
Length=326

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 126/178 (71%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGK AFAL L K   T +LKFSA+IGVDPV G      T P VL   P+ FD +
Sbjct  145  LAGHSRGGKTAFALTLRKLNITTNLKFSALIGVDPVDGMNKGKQTPPPVLTYVPNSFDFD  204

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  MVIGSGLG+VK+N L  PCAPKG N+  F+++C+ PA   VAKDYGH+DMLDDDT+G
Sbjct  205  MAVMVIGSGLGEVKRNPLFPPCAPKGVNHENFFNECKKPAWYFVAKDYGHSDMLDDDTKG  264

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG  T C+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I D+  + PVE++
Sbjct  265  -IRGKATNCLCKNGESRKPMRRFVGGVIVAFLKAYLHDDNEDLLTIRDRHVSLPVEIK  321



>ref|XP_010042520.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
Length=249

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 128/180 (71%), Gaps = 11/180 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG---------TCPDVLNSTPDYF  590
            L+GHSRGGK AFALALGK++T   L FSA++G+DPV G         T P VL      F
Sbjct  65   LAGHSRGGKGAFALALGKSSTPLALSFSALLGIDPVDGAASCCCKFQTKPPVLTKVAQSF  124

Query  589  DLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            DLNMP MV+GSGLG+ KK  +   CAPKG N+AAF+ +CR+PA   VAKDYGH DMLDDD
Sbjct  125  DLNMPVMVVGSGLGEDKKYKVFPACAPKGLNHAAFFEECRSPAWHFVAKDYGHMDMLDDD  184

Query  409  TRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            T+G +RG+++YCMC+NG +R PMR FVGGA VAFLR ++  D   LM + D  + APV++
Sbjct  185  TKG-IRGVVSYCMCENGSSREPMRRFVGGAAVAFLRAYVGGDDGDLMALQDTPDIAPVQI  243



>emb|CDO99104.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGKVAFA+ALGK  T+ LKFSA++GVDPV G      T P +L   P  F+++M
Sbjct  137  LSGHSRGGKVAFAVALGKAITS-LKFSALVGVDPVDGMDKGKQTPPPILTYIPHSFNIDM  195

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              +VIGSGLG+VK+N L  PCAPKG N+  F+++C+ PA   VAKDYGH DML+DDT G 
Sbjct  196  AVLVIGSGLGEVKRNPLFPPCAPKGVNHEDFFNECQKPAYHFVAKDYGHVDMLNDDTTG-  254

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG +R PMR FV G  VAFLR +LE + N L  I D    APV LQ  D
Sbjct  255  IRGKTTYCLCKNGVSREPMRRFVAGISVAFLRAYLEDNSNDLEAIKDGHLVAPVVLQKAD  314



>ref|XP_010034577.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW84159.1| hypothetical protein EUGRSUZ_B01021 [Eucalyptus grandis]
Length=312

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 128/180 (71%), Gaps = 11/180 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTC---------PDVLNSTPDYF  590
            L+GHSRGGK AFALALGK++T   L FSA++G+DPV GT          P VL      F
Sbjct  128  LAGHSRGGKGAFALALGKSSTPLALSFSALLGIDPVDGTASCCCKFQTKPPVLTKVAQSF  187

Query  589  DLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            DLNMP MV+GSGLG+ KK  +   CAPKG N+AAF+ +CR+PA   VAKDYGH DMLDDD
Sbjct  188  DLNMPVMVVGSGLGEDKKYKVFPACAPKGLNHAAFFEECRSPAWHFVAKDYGHMDMLDDD  247

Query  409  TRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            T+G +RG+++YCMC+NG +R PMR FVGGA VAFLR ++  D   LM + D  + APV++
Sbjct  248  TKG-IRGVVSYCMCENGSSREPMRRFVGGAAVAFLRAYVGGDDGDLMALQDTPDIAPVQI  306



>gb|ADZ24715.1| chlorophyllase [Solanum pennellii]
Length=315

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 127/183 (69%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT--ADLKFSAIIGVDPVGG------TCPDVLNSTPDYF-D  587
            L+GHSRGGK AF+LALG+ AT   DLKFSA+IGVDPV G      T P VL   P  F +
Sbjct  131  LAGHSRGGKAAFSLALGRLATISTDLKFSALIGVDPVDGMEKGKQTPPSVLTYVPRSFIN  190

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            L+MP MVIGSGLG+VKKN L   CAPKG N+  FY++C  PAC  VAKDYGH DMLDD+T
Sbjct  191  LDMPVMVIGSGLGEVKKNPLFPACAPKGVNHRDFYNECCKPACYFVAKDYGHNDMLDDET  250

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             G +RG  TYC+CK G +R PMR FVGG +VAFL  +LE + + L+ I       PVELQ
Sbjct  251  EG-IRGKATYCLCKKGKSREPMRRFVGGVLVAFLEAYLEGNSSHLIAIRYGHVALPVELQ  309

Query  226  PVD  218
             +D
Sbjct  310  DID  312



>gb|ACJ85964.1| unknown [Medicago truncatula]
Length=306

 Score =   197 bits (502),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L GHSRGGK +FA+AL K   T DLKFSAIIGVDPV G      T P +    P  FD +
Sbjct  125  LGGHSRGGKTSFAVALRKLNMTTDLKFSAIIGVDPVDGMDKGKQTSPPIFTYVPHSFDYD  184

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M  +VIG GLGDVKKN L  PCAPKG N+  F+S+C  P+   VAKDYGH DMLDDDT+G
Sbjct  185  MATLVIGFGLGDVKKNPLFPPCAPKGVNHEDFFSECEKPSWYFVAKDYGHVDMLDDDTKG  244

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             +RG ++YC+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I D+  + P+E++
Sbjct  245  -VRGKVSYCLCKNGESRKPMRMFVGGVMVAFLKAYLHGDNVDLLAIRDKNLSVPIEMK  301



>ref|XP_010932817.1| PREDICTED: chlorophyllase-2, chloroplastic [Elaeis guineensis]
Length=316

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 8/176 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKVAFALALG   T  LKFSA+IG+DPV G      T P +L   P  F+LNM
Sbjct  128  LAGHSRGGKVAFALALGHAKTT-LKFSALIGIDPVDGMDKGKQTHPPILTYVPHSFNLNM  186

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              +VIGSGLG++K+N    PCAPKG ++  F+ +C  PA   VAKDYGH DMLDD+T+G 
Sbjct  187  AVLVIGSGLGELKRNPFFPPCAPKGVSHQEFFDECCPPAYHFVAKDYGHLDMLDDETKG-  245

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            LRG  TYC+CKNG AR PMR FVGG +VAF++ +LE +   L+ + D  E APVEL
Sbjct  246  LRGKSTYCLCKNGKARKPMRMFVGGVMVAFMKAYLEGETQILVALKDNPEIAPVEL  301



>ref|XP_002517075.1| Chlorophyllase-2, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45238.1| Chlorophyllase-2, chloroplast precursor, putative [Ricinus communis]
Length=313

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 126/181 (70%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD-LKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGK AFALAL K   +  LKFSA+IGVDPV G      T P VL  TP  FDL+
Sbjct  132  LAGHSRGGKAAFALALQKAGISTALKFSALIGVDPVDGMDKGKQTPPPVLTYTPHSFDLD  191

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            M AMVIGSGLG+VK+N +  PCAPKG N+  F+ +C+ PA   V KDYGH DMLDDDT G
Sbjct  192  MAAMVIGSGLGEVKRNPMFPPCAPKGVNHEDFFKECKKPAYYFVVKDYGHLDMLDDDTNG  251

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             +RG  TYC+C NG +R PMR FVGG +VAFL+ +L  D + LM I D  +T PVELQ  
Sbjct  252  -IRGKATYCLCVNGKSREPMRRFVGGVLVAFLKAYLGGDSSDLMTITD-GQTGPVELQAA  309

Query  220  D  218
            +
Sbjct  310  E  310



>ref|XP_010256174.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X4 [Nelumbo 
nucifera]
Length=301

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 12/185 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDY  593
            L+GHSRGGK AFALALG      + ++ LKFSA++G+DPV G      T P VL   P  
Sbjct  115  LAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTYVPRS  174

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            F+L+M  +V+GSGLG VK+N L  PCAPKG N+  F+++CR PA   V KDYGH DMLDD
Sbjct  175  FNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHADMLDD  234

Query  412  DTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
            DT+G +RG  TYC+CKNG +R PMR FV G VVAF+R +LE +   L  I D ++  PV+
Sbjct  235  DTKG-IRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGDGSQVPPVQ  293

Query  232  LQPVD  218
            LQ +D
Sbjct  294  LQTID  298



>ref|XP_008775648.1| PREDICTED: chlorophyllase-2, chloroplastic [Phoenix dactylifera]
Length=316

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 127/183 (69%), Gaps = 8/183 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKVAFALALG   TA L FSA++G+DPV G      T P +L   P  F+LNM
Sbjct  128  LAGHSRGGKVAFALALGHAKTA-LNFSALMGIDPVDGMDKGKQTHPPILTYAPHSFNLNM  186

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              +VIGSGLG++K+NL+  PCAPKG ++  F+ +CR PA   VAKDYGH DMLDD+T+G 
Sbjct  187  AVLVIGSGLGELKRNLVFPPCAPKGVSHQEFFDECRPPAYHFVAKDYGHLDMLDDETKG-  245

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            LRG  TYC+C +G AR PMR FVGG +VAF++ +LE +   L+ + D  E  PV+L  + 
Sbjct  246  LRGKATYCLCTSGRARKPMRMFVGGVMVAFMKAYLEGETQILVALKDNPEIPPVDLLTIT  305

Query  217  SKD  209
              D
Sbjct  306  YLD  308



>ref|XP_010256171.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Nelumbo 
nucifera]
 ref|XP_010256172.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=333

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 12/185 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDY  593
            L+GHSRGGK AFALALG      + ++ LKFSA++G+DPV G      T P VL   P  
Sbjct  147  LAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTYVPRS  206

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            F+L+M  +V+GSGLG VK+N L  PCAPKG N+  F+++CR PA   V KDYGH DMLDD
Sbjct  207  FNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHADMLDD  266

Query  412  DTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
            DT+G +RG  TYC+CKNG +R PMR FV G VVAF+R +LE +   L  I D ++  PV+
Sbjct  267  DTKG-IRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGDGSQVPPVQ  325

Query  232  LQPVD  218
            LQ +D
Sbjct  326  LQTID  330



>ref|XP_010256173.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X3 [Nelumbo 
nucifera]
Length=317

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 12/185 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDY  593
            L+GHSRGGK AFALALG      + ++ LKFSA++G+DPV G      T P VL   P  
Sbjct  131  LAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTYVPRS  190

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            F+L+M  +V+GSGLG VK+N L  PCAPKG N+  F+++CR PA   V KDYGH DMLDD
Sbjct  191  FNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHADMLDD  250

Query  412  DTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
            DT+G +RG  TYC+CKNG +R PMR FV G VVAF+R +LE +   L  I D ++  PV+
Sbjct  251  DTKG-IRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGDGSQVPPVQ  309

Query  232  LQPVD  218
            LQ +D
Sbjct  310  LQTID  314



>emb|CDO99123.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 125/179 (70%), Gaps = 7/179 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPV-----GGTCPDVLNSTPDYFDLNMP  575
            L+GHSRGGKVAF +ALGK  T+ LKFSA+IG+DPV     G   P +L   P  F+L+M 
Sbjct  500  LAGHSRGGKVAFGVALGKAVTS-LKFSALIGIDPVDGVEKGKQMPPILTYNPHSFNLDMA  558

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              +IGSGLG+++ N L  P APKG N+  FY++C+ PAC  VA+DYGH DMLDDDT G L
Sbjct  559  VSIIGSGLGELRSNFLFPPSAPKGVNHKDFYNECQKPACYFVARDYGHLDMLDDDTSG-L  617

Query  394  RGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            RG  TYC+CKNG +R PMR FVGG +VAF+R +LE +   L  I     TAPVELQ VD
Sbjct  618  RGKATYCLCKNGESRDPMRRFVGGIMVAFMRNYLEGNSRDLQAIRHGHLTAPVELQNVD  676



>ref|XP_010695290.1| PREDICTED: chlorophyllase-2, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=322

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 126/183 (69%), Gaps = 8/183 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN-  581
            LSGHSRGGKVAFALAL K  T+ LK SA+IG+DPV G      T P VL   P  F L+ 
Sbjct  140  LSGHSRGGKVAFALALKKVTTSPLKISALIGIDPVDGMGKKNQTPPPVLTHLPQSFKLDG  199

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP +VIGSG G +KKN L  PCAP+G N+  FY++ + PA   + KDYGH DMLDD T+G
Sbjct  200  MPVLVIGSGFGAIKKNPLFPPCAPEGVNHENFYNESQNPAWYFLVKDYGHLDMLDDCTKG  259

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             +RG+ TYC+CKNG +R PMR FVGG +VAFL  +L++D + L+ I D  ET PV+   V
Sbjct  260  -VRGVSTYCLCKNGQSREPMRKFVGGVIVAFLNAYLKADESMLVSIRDGEETIPVKFDKV  318

Query  220  DSK  212
            D +
Sbjct  319  DVR  321



>ref|XP_010256170.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=360

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 12/185 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDY  593
            L+GHSRGGK AFALALG      + ++ LKFSA++G+DPV G      T P VL   P  
Sbjct  174  LAGHSRGGKAAFALALGLVTGGTSTSSSLKFSALMGIDPVDGMGKGKQTPPPVLTYVPRS  233

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            F+L+M  +V+GSGLG VK+N L  PCAPKG N+  F+++CR PA   V KDYGH DMLDD
Sbjct  234  FNLDMGVLVVGSGLGQVKRNPLFPPCAPKGVNHEDFFNECRPPAFYFVVKDYGHADMLDD  293

Query  412  DTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
            DT+G +RG  TYC+CKNG +R PMR FV G VVAF+R +LE +   L  I D ++  PV+
Sbjct  294  DTKG-IRGKATYCLCKNGKSREPMRRFVAGIVVAFMRAYLEGNAADLTAIGDGSQVPPVQ  352

Query  232  LQPVD  218
            LQ +D
Sbjct  353  LQTID  357



>gb|AHZ35334.1| chlorophyllase [Picrorhiza kurrooa]
Length=315

 Score =   192 bits (489),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 129/180 (72%), Gaps = 10/180 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKT-ATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGKVAFALAL K+  T+ LKFSA+IG+DPV G      T P VL   P  F+L+
Sbjct  131  LAGHSRGGKVAFALALNKSHTTSPLKFSALIGIDPVDGMDKGKQTPPPVLTYVPHSFNLD  190

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
              P +VIGSGLG+VKKN L  PCAPKG N+  FY++C  PA   +AKDYGH D+LDDDT+
Sbjct  191  GTPVLVIGSGLGEVKKNPLFPPCAPKGVNHEDFYNECCKPAYYFLAKDYGHLDVLDDDTK  250

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQT-ETAPVELQ  227
            G +RG  TYC+CKNG +R PMR FV G VVAF++ +L+ D + L+ I + T E  P+ELQ
Sbjct  251  G-IRGKSTYCVCKNGESREPMRKFVAGVVVAFMKAYLDGDSSDLLAIREGTHEMVPLELQ  309



>gb|KEH41056.1| chlorophyllase [Medicago truncatula]
Length=306

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 121/181 (67%), Gaps = 8/181 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L GHSRGGK +FA+AL K   T DLKFSAI+G+DPV G      T P +L   P  FD +
Sbjct  125  LGGHSRGGKTSFAIALRKLNITIDLKFSAILGIDPVDGLGEGIQTSPPILTYVPHSFDFD  184

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP +VIGS LGDV+KNLL  PCAPKG N+  F+S+C  P+   +AKDYGH DMLDD T G
Sbjct  185  MPTLVIGSSLGDVRKNLLFPPCAPKGINHEDFFSECEKPSWYFLAKDYGHFDMLDDYTPG  244

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
              RG LTYC+CKNG +R PMR FVGG +VAFL+ +L  D   L+ I +     P+ ++  
Sbjct  245  -FRGKLTYCLCKNGESRKPMRTFVGGVMVAFLKAYLYGDNVDLLAIREGKVRVPIAIKSD  303

Query  220  D  218
            D
Sbjct  304  D  304



>ref|XP_007034857.1| Chlorophyllase isoform 2 [Theobroma cacao]
 gb|EOY05783.1| Chlorophyllase isoform 2 [Theobroma cacao]
Length=311

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKVAFALAL K  T  LKFSA+IGVDPV G      T P VL   P  F+L+M
Sbjct  131  LAGHSRGGKVAFALALEKAMTT-LKFSALIGVDPVDGMDKGKQTPPPVLTYVPYSFNLDM  189

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+ +CR PAC  VAKDYGH DMLDDDT+G 
Sbjct  190  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECRKPACYFVAKDYGHLDMLDDDTKG-  248

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  +YC+CKNG AR PMR FVGG VVAF+  +L  D   L+ I D  ETAPVEL+ V+
Sbjct  249  IRGRSSYCLCKNGKAREPMRRFVGGVVVAFVEAYLNGDHTDLIAIRDGYETAPVELKTVE  308



>ref|XP_007034856.1| Chlorophyllase isoform 1 [Theobroma cacao]
 gb|EOY05782.1| Chlorophyllase isoform 1 [Theobroma cacao]
Length=310

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 129/180 (72%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L+GHSRGGKVAFALAL K  T  LKFSA+IGVDPV G      T P VL   P  F+L+M
Sbjct  130  LAGHSRGGKVAFALALEKAMTT-LKFSALIGVDPVDGMDKGKQTPPPVLTYVPYSFNLDM  188

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              MVIGSGLG+VK+N L  PCAPKG N+  F+ +CR PAC  VAKDYGH DMLDDDT+G 
Sbjct  189  AVMVIGSGLGEVKRNPLFPPCAPKGVNHEDFFKECRKPACYFVAKDYGHLDMLDDDTKG-  247

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  +YC+CKNG AR PMR FVGG VVAF+  +L  D   L+ I D  ETAPVEL+ V+
Sbjct  248  IRGRSSYCLCKNGKAREPMRRFVGGVVVAFVEAYLNGDHTDLIAIRDGYETAPVELKTVE  307



>emb|CDY32929.1| BnaA09g16640D [Brassica napus]
Length=333

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AF++AL K   ++DLK SA+IG+DPV G      T P VL   P+ FDL+
Sbjct  149  LSGHSRGGKTAFSVALKKFGYSSDLKISALIGIDPVDGMGKGKQTPPPVLTYEPNSFDLD  208

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++  NLL  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT 
Sbjct  209  KMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFFRECQGPAWHFVAKDYGHLDMLDDDTE  268

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQT-ETAPVELQ  227
            G +RG ++Y +CKNG  R PMR FVGG++VAFL  +LE D + L+ I D++ E  PVE+Q
Sbjct  269  G-IRGKISYYLCKNGEERRPMRRFVGGSIVAFLMAYLEGDDSELVKIKDKSHEGVPVEIQ  327

Query  226  PVDSKD  209
              + K+
Sbjct  328  EFEVKN  333



>ref|XP_009113977.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Brassica rapa]
Length=333

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 130/186 (70%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK SA+IG+DPV G      T P VL   P+ FDL+
Sbjct  149  LSGHSRGGKTAFAVALKKFGYSSDLKISALIGIDPVDGMGKGKQTPPPVLTYEPNSFDLD  208

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++  NLL  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT 
Sbjct  209  KMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFFQECQGPAWHFVAKDYGHLDMLDDDTE  268

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQT-ETAPVELQ  227
            G +RG +++ +CKNG  R PMR FVGG++VAFL  +LE D + L+ I D++ E  PVE+Q
Sbjct  269  G-IRGKISHYLCKNGEERRPMRRFVGGSIVAFLMAYLEGDDSELVKIKDKSHEGVPVEIQ  327

Query  226  PVDSKD  209
              + K+
Sbjct  328  EFEVKN  333



>emb|CDY50811.1| BnaCnng19750D [Brassica napus]
Length=333

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 129/186 (69%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFALAL K   ++ LK SA+IG+DPV G      T P VL   P+ FDL+
Sbjct  149  LSGHSRGGKTAFALALKKFGYSSYLKISALIGIDPVDGMGKGKQTPPPVLTYEPNSFDLD  208

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++  NLL  PCAP G N+  FY +C+ PA   VAKDYGH DMLDDDT 
Sbjct  209  KMPVLVIGSGLGEISPNLLFPPCAPPGVNHRDFYRECQGPAWHFVAKDYGHLDMLDDDTE  268

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQT-ETAPVELQ  227
            G +RG +++ +CKNG  R PMR FVGG++VAFL  +LE D + L+ I D++ E  PVE+Q
Sbjct  269  G-IRGKISHYLCKNGEERRPMRRFVGGSIVAFLIAYLEGDDSELVKIKDKSHEGVPVEIQ  327

Query  226  PVDSKD  209
              + K+
Sbjct  328  EFEFKN  333



>ref|XP_010481816.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=318

 Score =   189 bits (480),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 126/183 (69%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  134  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPVLAYEPNSFDLD  193

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +NLL  PCAP G N+  F+ +C++PA   VAKDYGH DMLDDDT+
Sbjct  194  KMPVLVIGSGLGETARNLLFPPCAPPGMNHREFFRECQSPAWHFVAKDYGHLDMLDDDTK  253

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  254  G-IRGKSSYCLCKNGEERRPMRRFVGGVVVSFLKAYLEGDDFELVKIRDGCHEGVPVEIQ  312

Query  226  PVD  218
              +
Sbjct  313  EFE  315



>gb|EYU41443.1| hypothetical protein MIMGU_mgv1a010077mg [Erythranthe guttata]
Length=323

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 123/183 (67%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG--KTATADLKFSAIIGVDPVGGTCPD------VLNSTPDYFDL  584
            L+GHSRGGKVAFA AL   + +   LKFSA+IGVDPV GT         V   TP  FDL
Sbjct  139  LAGHSRGGKVAFASALNNKQKSPTSLKFSALIGVDPVDGTGKGEQHPLPVFTYTPHSFDL  198

Query  583  N-MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            + M  +++GSGLG+VK+N L  PCAPKG N+  FY++C  P    VAKDYGH DMLDD T
Sbjct  199  DGMGVLIVGSGLGEVKRNPLFPPCAPKGVNHEDFYNECSKPVHYFVAKDYGHLDMLDDGT  258

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            +G +RG  +YC+CKNG +R PMR FVGG  VAFLRG+LE D   L+ I +     P+ELQ
Sbjct  259  KG-IRGKASYCLCKNGESREPMRRFVGGVSVAFLRGYLEGDFKELVAIREGHMVLPLELQ  317

Query  226  PVD  218
             V+
Sbjct  318  RVE  320



>ref|XP_010441975.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Camelina 
sativa]
 ref|XP_010441976.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Camelina 
sativa]
Length=318

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 125/183 (68%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  134  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPVLAYEPNSFDLD  193

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +N L  PCAP G N+  F+ +C++PA   VAKDYGH DMLDDDT+
Sbjct  194  KMPVLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQSPAWHFVAKDYGHLDMLDDDTK  253

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  254  G-IRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDKFELVKIKDGCHEGVPVEIQ  312

Query  226  PVD  218
              +
Sbjct  313  EFE  315



>emb|CDX96924.1| BnaC02g30620D [Brassica napus]
Length=296

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 125/185 (68%), Gaps = 10/185 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGGK AFA+AL K   +++LK SA+IGVDPV GT       P VL   P+ F+L 
Sbjct  112  LTGHSRGGKTAFAVALKKFGYSSELKISALIGVDPVDGTGKGKQTPPPVLTYEPNSFNLE  171

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++ +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+
Sbjct  172  KMPVLVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDMLDDDTK  231

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G LRG  +YC+CKNG  R PMR F+GG VV+FL  +LE D   LM I D   E  PVE+Q
Sbjct  232  G-LRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELMKIKDGCHEGVPVEIQ  290

Query  226  PVDSK  212
              + K
Sbjct  291  EFEVK  295



>ref|XP_002865397.1| chlorophyll-chlorophyllido hydrolase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41656.1| chlorophyll-chlorophyllido hydrolase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=318

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 124/183 (68%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  134  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGKQTPPPVLTYEPNSFDLD  193

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             +P +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDTR
Sbjct  194  KIPMLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDYGHLDMLDDDTR  253

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  254  G-IRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDRELVKIKDGCHEGVPVEIQ  312

Query  226  PVD  218
              +
Sbjct  313  EFE  315



>ref|XP_004145391.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Cucumis sativus]
 ref|XP_004168544.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Cucumis sativus]
 gb|KGN61666.1| hypothetical protein Csa_2G222090 [Cucumis sativus]
Length=316

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 122/181 (67%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            L+GHSRGGK +FALAL K++    K SA+IG+DPV GT       P VL   P  FDL +
Sbjct  139  LAGHSRGGKTSFALALQKSS----KLSALIGLDPVDGTGSGKQTHPPVLKYIPQSFDLGI  194

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIGSGLG++K+N L  PCAPKG N+  F+ +CR+PA   V KDYGH D+LDD+T G 
Sbjct  195  PVLVIGSGLGELKRNPLFPPCAPKGINHEEFFKECRSPAYHFVVKDYGHLDLLDDET-GG  253

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG ++YC+CKNG +R PMR FVGGAVVAFL+  L  +   L  I D     PV LQ  +
Sbjct  254  IRGKVSYCLCKNGESREPMRRFVGGAVVAFLKSRLNGEEGDLKAIEDGDLILPVHLQTSE  313

Query  217  S  215
            S
Sbjct  314  S  314



>gb|AAP44978.1| chlorophyllase [Ginkgo biloba]
Length=342

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 121/181 (67%), Gaps = 7/181 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTP------DYFDLNM  578
            L+GHSRGGKVAFALALG+ +   LK+SA++G+DPV G   D   S P        FDL M
Sbjct  143  LAGHSRGGKVAFALALGRVSQPSLKYSALVGLDPVDGMGKDQQTSHPILSYREHSFDLGM  202

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +V+GSGLG  K+N L  PCAP+G N+  F+ +C APA   VA DYGH D LDDDT+G 
Sbjct  203  PTLVVGSGLGPCKRNPLFPPCAPQGVNHHDFFYECVAPAYHFVASDYGHLDFLDDDTKG-  261

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG  TYC+CKNG AR PMR F GG VVAFL+ FL  +   L  I+     APV+++P +
Sbjct  262  IRGKATYCLCKNGEAREPMRKFSGGIVVAFLQAFLGDNRGALNDIMVYPSHAPVKIEPPE  321

Query  217  S  215
            S
Sbjct  322  S  322



>ref|XP_010326690.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-2, chloroplastic 
[Solanum lycopersicum]
Length=314

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 124/184 (67%), Gaps = 12/184 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK--TATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L+GHSRGGK AFAL LGK    T DLKF    G+DPV G      T P VL   P  F+L
Sbjct  134  LAGHSRGGKAAFALTLGKVTNVTTDLKFX---GIDPVDGLGNGKQTTPPVLTYIPQSFNL  190

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +M  MVIGS LG+VK+N L   CAPKG N+  FY++C  PAC +VAKDYGH DMLDD+T+
Sbjct  191  DMAVMVIGSSLGEVKRNPLFPACAPKGVNHRDFYNECVRPACYVVAKDYGHVDMLDDETK  250

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            G +RG  TY +CKNG +R PMR FVGG V+AFL  +L+ + + LM I D   T PVEL+ 
Sbjct  251  G-VRGKATYGLCKNGKSREPMRRFVGGIVIAFLDDYLKGNSSDLMPIKDGYVTLPVELRD  309

Query  223  VDSK  212
            VD +
Sbjct  310  VDFR  313



>ref|XP_009123914.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123915.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123917.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
 ref|XP_009123918.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Brassica 
rapa]
Length=339

 Score =   185 bits (470),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 125/185 (68%), Gaps = 10/185 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGGK AFA+AL K   +++LK SA+IGVDPV GT       P VL   P+ F+L 
Sbjct  155  LTGHSRGGKTAFAVALKKFGYSSELKISALIGVDPVDGTGKGKQTPPPVLTYEPNSFNLE  214

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++ +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+
Sbjct  215  KMPVLVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDMLDDDTK  274

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G LRG  +YC+CKNG  R PMR F+GG VV+FL  +LE D   LM I D   E  PVE+Q
Sbjct  275  G-LRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELMKIKDGCHEGVPVEIQ  333

Query  226  PVDSK  212
              + K
Sbjct  334  EFEVK  338



>ref|XP_010034586.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW84160.1| hypothetical protein EUGRSUZ_B01022 [Eucalyptus grandis]
Length=309

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 120/180 (67%), Gaps = 12/180 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG---------TCPDVLNSTPDYF  590
            L+GHSRGGK AFALALGK+ T   L FSA++G+DPV G         T P VL   P  F
Sbjct  126  LAGHSRGGKDAFALALGKSWTPLTLSFSALLGIDPVEGLALCCCKFQTKPPVLTEGPQSF  185

Query  589  DLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            DLNMP MV+GSGLG+ KK  +   CAPKG N+  FY KCR+PA   VAKDYGH DM+DD 
Sbjct  186  DLNMPVMVVGSGLGEDKKYNVLPACAPKGLNHVKFYEKCRSPAWHFVAKDYGHMDMVDDV  245

Query  409  TRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            T G  RG++  C C++G +R PMR FVGGA VAFLR +L  D   LM + D  + APV++
Sbjct  246  TNG--RGVVLTCTCESGSSREPMRRFVGGAAVAFLRAYLGGDDRDLMALQDTPDIAPVQI  303



>ref|XP_006838958.1| hypothetical protein AMTR_s00002p00270990 [Amborella trichopoda]
 gb|ERN01527.1| hypothetical protein AMTR_s00002p00270990 [Amborella trichopoda]
Length=314

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            +SGHSRG K AFALALG + T  LK+SA++ +DPV G      + P VL   P+     M
Sbjct  132  ISGHSRGAKTAFALALGISTTTTLKYSALLAIDPVDGPAPGQQSTPPVLTHEPNSLVTQM  191

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +V+GSGLG +KKN L  PCAP G N+A F+ +C+ PA   V  DYGH DMLDD T G 
Sbjct  192  PVLVVGSGLGHLKKNPLFPPCAPNGVNHADFFRECQPPAWYFVPSDYGHLDMLDDQTDG-  250

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            +RG  TYC+CKNG  R PMR FVGG +VAF RG+L+     L  +I+   T+PV+L+
Sbjct  251  IRGRATYCLCKNGATRQPMRRFVGGVMVAFARGYLQGHFGDLRALIEDPGTSPVKLE  307



>ref|XP_010494369.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=335

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 124/183 (68%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  151  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPVLAYEPNSFDLD  210

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +N L  PCAP   N+  F+ +C++PA   VAKDYGH DMLDDDT+
Sbjct  211  KMPVLVIGSGLGETARNPLFPPCAPPRVNHREFFRECQSPAWHFVAKDYGHLDMLDDDTK  270

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  271  G-IRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDFELVKIKDGCHEGVPVEIQ  329

Query  226  PVD  218
              +
Sbjct  330  EFE  332



>gb|AAN51934.1|AF337545_1 chlorophyllase 2 [Brassica oleracea]
Length=321

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 124/185 (67%), Gaps = 10/185 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGGK AFA+AL K   +++LK SAIIGVDPV GT       P VL   P+ F+L 
Sbjct  137  LTGHSRGGKTAFAVALKKFGYSSELKISAIIGVDPVDGTGKGKQTPPPVLTYEPNSFNLE  196

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG++ +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+
Sbjct  197  KMPVLVIGSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDMLDDDTK  256

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G LRG  +YC+CKNG  R PMR F+GG VV+FL  +LE D   L+ I     E  PVE+Q
Sbjct  257  G-LRGKSSYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELVKIKAGCHEGVPVEIQ  315

Query  226  PVDSK  212
              + K
Sbjct  316  EFEVK  320



>ref|NP_199199.1| chlorophyllase 2 [Arabidopsis thaliana]
 sp|Q9M7I7.1|CLH2_ARATH RecName: Full=Chlorophyllase-2, chloroplastic; Short=AtCLH2; 
AltName: Full=Chlorophyll-chlorophyllido hydrolase 2; Short=Chlase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF27046.1|AF134302_1 AtCLH2 [Arabidopsis thaliana]
 dbj|BAB11315.1| AtCLH2 [Arabidopsis thaliana]
 gb|AED95018.1| chlorophyllase 2 [Arabidopsis thaliana]
Length=318

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 123/183 (67%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   +++LK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  134  LSGHSRGGKTAFAVALKKFGYSSNLKISTLIGIDPVDGTGKGKQTPPPVLAYLPNSFDLD  193

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
              P +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+
Sbjct  194  KTPILVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDYGHLDMLDDDTK  253

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  254  G-IRGKSSYCLCKNGEERRPMRRFVGGLVVSFLKAYLEGDDRELVKIKDGCHEDVPVEIQ  312

Query  226  PVD  218
              +
Sbjct  313  EFE  315



>gb|AAO22714.1| putative AtCLH2 protein [Arabidopsis thaliana]
Length=293

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 123/183 (67%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   +++LK S +IG+DPV GT       P VL   P+ FDL+
Sbjct  109  LSGHSRGGKTAFAVALKKFGYSSNLKISTLIGIDPVDGTGKGKQTPPPVLAYLPNSFDLD  168

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
              P +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+
Sbjct  169  KTPILVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDYGHLDMLDDDTK  228

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  229  G-IRGKSSYCLCKNGEERRPMRRFVGGLVVSFLKAYLEGDDRELVKIKDGCHEDVPVEIQ  287

Query  226  PVD  218
              +
Sbjct  288  EFE  290



>ref|XP_006403171.1| hypothetical protein EUTSA_v10003248mg [Eutrema salsugineum]
 dbj|BAJ34423.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44624.1| hypothetical protein EUTSA_v10003248mg [Eutrema salsugineum]
Length=317

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 123/185 (66%), Gaps = 10/185 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFA AL K   ++DLK S +IG+DPV G      T P VL   P+ FDL+
Sbjct  133  LSGHSRGGKTAFAAALKKFGYSSDLKISTLIGIDPVDGMGKGKQTPPPVLTYEPNSFDLD  192

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   VA+DYGH DMLDDDT+
Sbjct  193  KMPILVIGSGLGETARNPLFPPCAPPGVNHRDFFRECQGPAWHFVAQDYGHLDMLDDDTK  252

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTET-APVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VVAFL  +LE D + L+ I D +     +E+Q
Sbjct  253  G-IRGKSSYCLCKNGEGRRPMRRFVGGIVVAFLMAYLEGDNSELVKIKDGSHDGVSIEIQ  311

Query  226  PVDSK  212
              + K
Sbjct  312  EFEVK  316



>ref|XP_006282250.1| hypothetical protein CARUB_v10028524mg [Capsella rubella]
 gb|EOA15148.1| hypothetical protein CARUB_v10028524mg [Capsella rubella]
Length=319

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 123/183 (67%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K    +DLK S +IG+DPV GT       P VL+  P+ FDL+
Sbjct  135  LSGHSRGGKTAFAVALKKFGYLSDLKISTLIGIDPVDGTGKGKQTPPPVLSYEPNSFDLD  194

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   V KD+GH DMLDDDT+
Sbjct  195  KMPVLVIGSGLGETARNPLFPPCAPPGVNHREFFRECQRPAWHFVVKDHGHLDMLDDDTK  254

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQ  227
            G +RG  +YC+CKNG  R PMR FV G VV+FL+ +LE D   L+ I D   E  PVE+Q
Sbjct  255  G-IRGKSSYCLCKNGEERRPMRRFVSGMVVSFLKAYLEGDDCELVKIKDGCHEGVPVEIQ  313

Query  226  PVD  218
             ++
Sbjct  314  ELE  316



>gb|ACN40275.1| unknown [Picea sitchensis]
Length=329

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 123/182 (68%), Gaps = 8/182 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            ++GHSRGGKVAF LAL +T+ T +LKFSA++GVDPV G      T P +L   P  FD  
Sbjct  131  MAGHSRGGKVAFGLALDRTSQTTELKFSALVGVDPVDGMARGRQTQPRILTYKPHSFDSV  190

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +P +++GSGLG VK+N L  PCAP+G ++  F+S+C APA   VA DYGH D LDD+T G
Sbjct  191  IPTLIVGSGLGAVKRNPLFPPCAPEGVSHREFFSECSAPAYHFVASDYGHMDFLDDET-G  249

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             ++G  +YC+CKNG AR PMR F GG +VAFL   L++D      ++     APV+L+P 
Sbjct  250  GVKGQSSYCLCKNGVAREPMRRFCGGIIVAFLNVCLQNDSGAFNDLLVHPSHAPVKLEPP  309

Query  220  DS  215
            +S
Sbjct  310  ES  311



>ref|XP_008449319.1| PREDICTED: chlorophyllase-2, chloroplastic [Cucumis melo]
Length=319

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 118/181 (65%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            L+GHSRGGK +FALAL K+     K SA+IG+DPV GT       P VL   P   DL +
Sbjct  142  LAGHSRGGKTSFALALQKSP----KLSALIGLDPVDGTGSGKQTHPPVLKYIPQSLDLGI  197

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIGSGLG++K N L  PCAPKG N+  F+ +CR PA   V KDYGH D+LDD+T G 
Sbjct  198  PVLVIGSGLGELKMNPLFPPCAPKGINHEEFFKECRNPAYHFVVKDYGHMDLLDDET-GG  256

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            +RG ++YC+CKNG +R PMR FVGGAVVAFL+  L  +   L  I       PV LQ ++
Sbjct  257  IRGKVSYCLCKNGESREPMRRFVGGAVVAFLKSCLNGEEGDLKAIEGGDLILPVHLQTIE  316

Query  217  S  215
            S
Sbjct  317  S  317



>ref|XP_011090675.1| PREDICTED: chlorophyllase-2, chloroplastic [Sesamum indicum]
Length=315

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 123/181 (68%), Gaps = 12/181 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN-  581
            L+GHSRGGKVAFALAL K+    LK SA+IG+DPV G      T P VL  TP  F+L+ 
Sbjct  137  LAGHSRGGKVAFALALTKS----LKLSALIGIDPVDGMDIGKQTPPPVLTYTPHSFNLDG  192

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +  ++IGSGLG+VK+N L   CAPKG N+  FY +C +PA   V KDYGH D+LDDDT+G
Sbjct  193  VGVLIIGSGLGEVKRNALFPACAPKGVNHEDFYKECCSPAYYFVVKDYGHLDVLDDDTKG  252

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
             +RG  TYC+CKNG  R PMR FVGGA+VAFL+ +L  +   L  I +     PVELQ V
Sbjct  253  -IRGKATYCLCKNGECREPMRRFVGGALVAFLKAYLGGNSRDLADIREGHGMLPVELQRV  311

Query  220  D  218
            +
Sbjct  312  E  312



>ref|XP_003571791.2| PREDICTED: chlorophyllase-2, chloroplastic-like [Brachypodium 
distachyon]
Length=337

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 124/183 (68%), Gaps = 8/183 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            +SGHSRGGKVAFALALG   T+ L  +A+I VDPV G      T P +L +      +  
Sbjct  152  ISGHSRGGKVAFALALGHAKTS-LPLAALIAVDPVDGMAVGKQTPPPILTNKRSSLRVPA  210

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            PAMVIGSGLG   +N L  PCAP G ++AAFY +C   AC LVA+DYGHTDM+DD TRG+
Sbjct  211  PAMVIGSGLGSEPRNALFSPCAPLGVSHAAFYDECAGAACHLVARDYGHTDMMDDVTRGA  270

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             +G+ T  +CK+G ARAPMR FVGGA+VAFL+ ++E     L GI ++ E APV L  V+
Sbjct  271  -KGLATRAVCKSGEARAPMRRFVGGAMVAFLKKWVEGRPEWLDGIRERPEVAPVFLSVVE  329

Query  217  SKD  209
             +D
Sbjct  330  FQD  332



>gb|KFK31694.1| hypothetical protein AALP_AA6G147200 [Arabis alpina]
Length=317

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 120/183 (66%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   +  LK   +IG+DPV G      T P VL   P+ FDL+
Sbjct  133  LSGHSRGGKTAFAVALEKFGYSPKLKIKTLIGIDPVDGMAKGKQTPPPVLTYEPNSFDLD  192

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGLG+  +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDD+T+
Sbjct  193  KMPVLVIGSGLGETARNPLFPPCAPPGVNHRDFFRECQGPAWHFVAKDYGHLDMLDDETK  252

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA-PVELQ  227
            G +RG  +YC+CKNG  R PMR FVGG VV+FL+ +LE D   L+ I D      PVE+Q
Sbjct  253  G-IRGKSSYCLCKNGEERRPMRRFVGGIVVSFLKAYLEGDDCELVKIKDGCHKGLPVEIQ  311

Query  226  PVD  218
              +
Sbjct  312  EFE  314



>dbj|BAJ89583.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 123/183 (67%), Gaps = 8/183 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            +SGHSRGGKVAFAL LG   T+ L  +A+I VDPV GT       P +L   P+   +  
Sbjct  135  ISGHSRGGKVAFALGLGHAKTS-LPLAALIAVDPVDGTGMGNQTPPPILAYKPNAIRVPA  193

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIG+GLG++ +N L  PCAP G ++AAFY +C APAC LVA+DYGHTDM+DD T G+
Sbjct  194  PVMVIGTGLGELPRNALFPPCAPLGVSHAAFYDECAAPACHLVARDYGHTDMMDDVTTGA  253

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             +G+ T  +CK+G ARAPMR FV GA+VAFL  +++     L  + +QT  APV L  V+
Sbjct  254  -KGLATRALCKSGGARAPMRRFVAGAMVAFLNKWVQGKPEWLDAVREQTVAAPVVLSAVE  312

Query  217  SKD  209
             +D
Sbjct  313  FRD  315



>ref|XP_010481814.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 121/183 (66%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+  DL+
Sbjct  129  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPVLAYEPNSLDLD  188

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGL +  +N L  PCA  G N+  F+ +C++PA   VA DYGH DMLDDDT+
Sbjct  189  KMPVLVIGSGLVETARNSLFPPCAHPGVNHEEFFRECQSPAWHFVAGDYGHLDMLDDDTK  248

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA-PVELQ  227
            G +RG + YC+CKNG  R PMR FVGG +V+FL+ +LE D   L+ I D      P+++Q
Sbjct  249  G-IRGRILYCLCKNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGLPIKIQ  307

Query  226  PVD  218
             ++
Sbjct  308  EIE  310



>ref|XP_010441977.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 120/183 (66%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+  DL+
Sbjct  129  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTWKGQQTPPPVLAYEPNSLDLD  188

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             +P +VIGSGL +  +N L  PCAP G N+  F+ +C++P    VA+DYGH DMLDDDT+
Sbjct  189  KIPVLVIGSGLVETSRNSLFPPCAPPGVNHEEFFRECQSPVWHFVAEDYGHLDMLDDDTK  248

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA-PVELQ  227
            G +RG + YC+C NG  R PMR FVGG +V+FL+ +LE D   L+ I D      P+++Q
Sbjct  249  G-IRGKILYCLCMNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGLPIKIQ  307

Query  226  PVD  218
              +
Sbjct  308  EFE  310



>ref|XP_010495652.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Camelina sativa]
Length=313

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 121/183 (66%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+AL K   ++DLK S +IG+DPV GT       P VL   P+  DL+
Sbjct  129  LSGHSRGGKTAFAVALKKFGYSSDLKISTLIGIDPVDGTGKGQQTPPPVLAYEPNSLDLD  188

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIGSGL +   N L  PCA  G N+  F+ +C++PA   VA+DYGH DMLDD+T+
Sbjct  189  KMPVLVIGSGLVETAWNSLFPPCAHPGVNHEEFFRECQSPAWHFVAEDYGHLDMLDDNTK  248

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA-PVELQ  227
            G +RGM+ YC+CKNG  R PMR FVGG +V+FL+ +LE D   L+ I D      P+++Q
Sbjct  249  G-IRGMIFYCLCKNGEKRRPMRRFVGGILVSFLKAYLEGDDFELVKIKDGCHKGLPIKIQ  307

Query  226  PVD  218
              +
Sbjct  308  EFE  310



>gb|EMS51443.1| Chlorophyllase-2, chloroplastic [Triticum urartu]
Length=270

 Score =   169 bits (427),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 121/183 (66%), Gaps = 8/183 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            +SGHSRGGKVAFALALG   T  L  +A+I VDPV GT       P +L   P+   +  
Sbjct  89   ISGHSRGGKVAFALALGHAKTP-LPLAALIAVDPVDGTGMGDQTPPPILVYKPNALRVPA  147

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIG+GLG++ +N L  PCAP G ++A FY +C APAC LVA+DYGHTDM+DD T G+
Sbjct  148  PVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECSAPACHLVARDYGHTDMMDDVTTGA  207

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             +G+ T  +CK+G ARAPMR FV G +VAFL  ++E     L  + ++T+  PV L  V+
Sbjct  208  -KGLATRALCKSGGARAPMRRFVAGGMVAFLNKWVEGKPEWLDAMRERTDVTPVVLSVVE  266

Query  217  SKD  209
             +D
Sbjct  267  FRD  269



>ref|XP_009123919.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Brassica 
rapa]
Length=315

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 114/178 (64%), Gaps = 20/178 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVI  563
            L+GHSRGGK AFA+AL K   +++LK SA+IGVDPV GT                   VI
Sbjct  155  LTGHSRGGKTAFAVALKKFGYSSELKISALIGVDPVDGT-----------------GKVI  197

Query  562  GSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGML  383
            GSGLG++ +N L  PCAP G N+  F+ +C+ PA   VAKDYGH DMLDDDT+G LRG  
Sbjct  198  GSGLGELARNPLFPPCAPTGVNHREFFQECQGPAWHFVAKDYGHLDMLDDDTKG-LRGKS  256

Query  382  TYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ-TETAPVELQPVDSK  212
            +YC+CKNG  R PMR F+GG VV+FL  +LE D   LM I D   E  PVE+Q  + K
Sbjct  257  SYCLCKNGEERKPMRRFIGGIVVSFLMAYLEDDDCELMKIKDGCHEGVPVEIQEFEVK  314



>ref|XP_007200272.1| hypothetical protein PRUPE_ppa014909mg [Prunus persica]
 gb|EMJ01471.1| hypothetical protein PRUPE_ppa014909mg [Prunus persica]
Length=323

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 120/190 (63%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFALALG   TA  LKFS +IG+DPV G      T P +L   P  F+L+
Sbjct  138  LSGHSRGGKAAFALALGHAKTALSLKFSVLIGIDPVAGANQHCRTRPHILTYEPQSFNLS  197

Query  580  MPAMVIGSGLGDVKKNL-LSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  VIG+GLG  KKN  +S PCAP G N+  F+ +C+ P    V KDYGH DMLDDD  
Sbjct  198  IPVTVIGTGLGPEKKNACMSQPCAPNGVNHKEFFHECKPPCAHFVVKDYGHMDMLDDDPP  257

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G L G L+ CMCKNG   +  MR  VGG VVAFL+ +L  +   L+ I++    +P +L+
Sbjct  258  G-LVGALSGCMCKNGTGPKELMRKTVGGIVVAFLKAYLNGEDEDLVAIVEDPAVSPAKLE  316

Query  226  PVDSKDLVRA  197
            PV   + +RA
Sbjct  317  PV---EFIRA  323



>ref|XP_002467217.1| hypothetical protein SORBIDRAFT_01g021520 [Sorghum bicolor]
 gb|EER94215.1| hypothetical protein SORBIDRAFT_01g021520 [Sorghum bicolor]
Length=375

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 123/186 (66%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKT-ATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGKVAFALALG+  A   L   A++ VDPV G      T P VL        + 
Sbjct  161  VSGHSRGGKVAFALALGRAKAKLALPLVALVAVDPVDGMGVGKQTPPPVLTGRTTSLHVG  220

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKC--RAPACCLVAKDYGHTDMLDDDT  407
            +PAMVIG+GLG++ +  L  PCAP+G ++AAF+ +    APAC LVA+DYGHTDM+DDDT
Sbjct  221  VPAMVIGTGLGELPRGPLLPPCAPRGVSHAAFFDELDRAAPACHLVARDYGHTDMMDDDT  280

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             G+ RGMLT  +C++G ARAPMR FV GA VAFL  ++  D   + GI  + + APV L 
Sbjct  281  PGA-RGMLTRTVCRSGGARAPMRRFVAGATVAFLNKWVAGDAAAMDGIRTRPDQAPVALS  339

Query  226  PVDSKD  209
             V+ +D
Sbjct  340  VVEFRD  345



>ref|XP_002273926.1| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=319

 Score =   167 bits (422),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 115/181 (64%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGK AFALALG   T+ L FSA++G+DPVGG      T P +L   P  F+L +
Sbjct  137  LSGHSRGGKTAFALALGYADTS-LNFSALLGLDPVGGLSKCSQTVPKILTYVPHSFNLAI  195

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLGD  +N L+CPCAP G N+  F+S+C+ P    V  +YGH DMLDD   G 
Sbjct  196  PVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLSGC  255

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +  Y +CK+G   R PMR  VGG  VAFL+ +LE        I+D+ + APV+L PV
Sbjct  256  IGAISGY-ICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQTGDFKAIVDEPDLAPVKLDPV  314

Query  220  D  218
            +
Sbjct  315  E  315



>ref|XP_008235366.1| PREDICTED: chlorophyllase-1 [Prunus mume]
Length=319

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 119/190 (63%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            LSGHSRGGK AFALALG   TA  LKFS +IG+DPV G        P +L   P  F+L+
Sbjct  134  LSGHSRGGKAAFALALGHAKTALSLKFSVLIGIDPVAGANQHCTIRPHILTYEPQSFNLS  193

Query  580  MPAMVIGSGLGDVKKNL-LSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  VIG+GLG  KKN  +S PCAP G N+  F+ +C+ P    V KDYGH DMLDDD  
Sbjct  194  IPVTVIGTGLGPEKKNACISQPCAPNGVNHKEFFYECKPPCAHFVVKDYGHMDMLDDDPP  253

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G L G L+ CMCKNG   +  MR  VGG VVAFL+ +L  +   L+ I++    +P +L+
Sbjct  254  G-LVGALSGCMCKNGTGPKELMRKTVGGIVVAFLKAYLNGEDEDLVAIVEDPAVSPAKLE  312

Query  226  PVDSKDLVRA  197
            PV   + +RA
Sbjct  313  PV---EFIRA  319



>ref|XP_002271974.1| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=319

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 115/181 (64%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGK AFALALG   T+ L FSA++G+DPVGG      T P +L   P  F+L +
Sbjct  137  LSGHSRGGKTAFALALGYADTS-LNFSALLGLDPVGGLSKCCQTVPKILTYVPHSFNLAI  195

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLGD  +N L+CPCAP G N+  F+S+C+ P    V  +YGH DMLDD   G 
Sbjct  196  PVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLSGC  255

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +  Y +CK+G   R PMR  VGG  VAFL+ +LE        I+D+ + APV+L PV
Sbjct  256  IGAISGY-ICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQSGDFKAIVDEPDLAPVKLDPV  314

Query  220  D  218
            +
Sbjct  315  E  315



>emb|CDJ26436.1| unnamed protein product [Triticum aestivum]
Length=312

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 115/169 (68%), Gaps = 8/169 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            +SGHSRGGKVAFAL LG   T+ L  +A+I VDPV GT       P +L   P+   +  
Sbjct  131  ISGHSRGGKVAFALGLGHAKTS-LPLAALIAVDPVDGTGMGNQTPPPILVYKPNTLRVPA  189

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIG+GLG++ +N L  PCAP G ++A FY +C APAC LVA+DYGHTDM+DD T G+
Sbjct  190  PVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECSAPACHLVARDYGHTDMMDDVTTGA  249

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQT  251
             +G+ T  +CK+G ARAPMR FV GA+VAFL+ ++E     L  + +QT
Sbjct  250  -KGLATRALCKSGGARAPMRRFVAGAMVAFLKKWVEGKPEWLDAMREQT  297



>gb|ACO50428.1| chlorophyllase 1 [Pachira macrocarpa]
Length=338

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 118/191 (62%), Gaps = 13/191 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT-----CPDVLNSTPDYFDLNMP  575
            L+GHSRGGK AFALALG   T    FSA++G+DPV GT      P +L  TP+ FDL++P
Sbjct  148  LAGHSRGGKTAFALALGYAQTTQ-NFSALVGIDPVAGTRFGETSPKILTYTPESFDLSIP  206

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              VIG+GLG   K +LSCPCAPK  N+  F+++C+ P     AK+YGH D+LD+D  G L
Sbjct  207  VAVIGTGLGSESKGILSCPCAPKKYNHQEFFNECKPPRAHFDAKNYGHMDVLDNDPPG-L  265

Query  394  RGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             G ++  +C NG   R PMR  VGG VVAFL  F E++    + I+ +   APV+L  V 
Sbjct  266  VGKISDTICVNGKGPRDPMRRCVGGIVVAFLNYFFEAEKGDFLTIVKEPYVAPVKLDEVQ  325

Query  217  -----SKDLVR  200
                  KD VR
Sbjct  326  FDVEVYKDYVR  336



>gb|AEO19902.1| chlorophyllase 1, partial [Pyrus x bretschneideri]
Length=302

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 117/183 (64%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFA+ALG+  T+  LK S +IG+DPV G      T P +L  +P  FDL+
Sbjct  117  LSGHSRGGKTAFAIALGRAKTSLSLKISVLIGIDPVAGANRYCRTRPHILTYSPQSFDLS  176

Query  580  MPAMVIGSGLGDVKKNL-LSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  VIG+GLG   KN  +S PCAP G N+  F+ +C+ P    V KDYGH  MLDDD +
Sbjct  177  IPVTVIGTGLGPESKNACMSQPCAPDGVNHKEFFYECKPPCAHFVVKDYGHMGMLDDDPQ  236

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G ++ CMCKNG   R  MR  VGG VVAFL  +L  D   L+ I+   +++P +L+
Sbjct  237  GVV-GAVSGCMCKNGTGPREIMRKTVGGIVVAFLNAYLNGDDRYLLAIVGDPDSSPAKLE  295

Query  226  PVD  218
            PV+
Sbjct  296  PVE  298



>ref|XP_010096444.1| hypothetical protein L484_002352 [Morus notabilis]
 gb|EXB64219.1| hypothetical protein L484_002352 [Morus notabilis]
Length=320

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 116/181 (64%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT---CP---DVLNSTPDYFDLNM  578
            LSGHSRGGK AFALALG   T+ L FSA++G+DPV GT   CP    +L   P  F+ ++
Sbjct  138  LSGHSRGGKAAFALALGYAKTS-LNFSALLGIDPVAGTGKCCPTEPHILTYVPHSFNFSI  196

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLG  K   L+ PCAP+G N+  FY++C+ P    VAK+YGH DMLDD+  G 
Sbjct  197  PVAVIGTGLGPEKWIPLAPPCAPEGVNHDEFYNECKPPCAHFVAKEYGHMDMLDDNLPG-  255

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            + G L+ C+CKNG   +  MR  VGG  VAFLR +LESD   L  ++     AP +L PV
Sbjct  256  IIGKLSECICKNGSGPKDKMRRSVGGIAVAFLRAYLESDDEDLKAVVADPSLAPAKLDPV  315

Query  220  D  218
            +
Sbjct  316  E  316



>ref|XP_003528958.1| PREDICTED: chlorophyllase-1 [Glycine max]
 dbj|BAF43704.1| Chlorophyllase 2 [Glycine max]
 gb|KHN44571.1| Chlorophyllase-1 [Glycine soja]
Length=316

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 110/183 (60%), Gaps = 11/183 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG--------TCPDVLNSTPDYFDL  584
            L GHS+GGK AFA+ALG   T  LKFSA+IG+DPV G        + PD+L   P  F+L
Sbjct  130  LVGHSKGGKTAFAVALGYCKT-KLKFSALIGIDPVAGVSKCKPCRSLPDILTGVPRSFNL  188

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            N+P  VIG+GLG  K N L  PCAP G N+  F+S+C+ P+   VA DYGH DMLDD+T 
Sbjct  189  NIPVAVIGTGLGPEKANSLFPPCAPNGVNHKEFFSECKPPSAYFVATDYGHMDMLDDETP  248

Query  403  GSLRGMLTYCMCKNGPA--RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            G +  M++ CMCKNG    R  MR  VGG VVAFLR  L         I+     AP +L
Sbjct  249  GVIGTMMSKCMCKNGKKGPRDLMRRTVGGLVVAFLRAQLNEQWKDFDAILASPNLAPAKL  308

Query  229  QPV  221
              V
Sbjct  309  DDV  311



>gb|KFK44086.1| hypothetical protein AALP_AA1G214200 [Arabis alpina]
Length=324

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 115/181 (64%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  ++FSA+IG+DPV G      T P++L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSIEFSALIGIDPVAGPNKYLRTDPEILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG   KNL+  PCAP   N+  FY++C+A     VA DYGH DMLDDD  
Sbjct  194  DIPVAVVGTGLGPKMKNLMP-PCAPAEVNHVEFYNECKATKAHFVAADYGHMDMLDDDLP  252

Query  403  GSLRGMLTYCMCKNGPARA-PMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G +  CMCKNG  +   MR FVGG VVAFL+  L  D + +  I+     +PV++ 
Sbjct  253  GFV-GFMAGCMCKNGKGKKIEMRRFVGGIVVAFLKYSLWGDKSEIQRIVKDPSVSPVKID  311

Query  226  P  224
            P
Sbjct  312  P  312



>ref|XP_008355440.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=323

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 118/183 (64%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+GHSRGGK AFA+ALG+  T+  LK S +IG+DPV G      T P +L  +P  FDL+
Sbjct  138  LAGHSRGGKTAFAIALGRAKTSLSLKISLLIGIDPVAGANRYCRTRPRILTYSPQSFDLS  197

Query  580  MPAMVIGSGLGDVKKNL-LSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P +VIG+GLG   KN  +  PCAP G N+  F+ +C+ P    V KDYGH DMLDDD +
Sbjct  198  IPVIVIGAGLGPEGKNXCMXKPCAPDGXNHKXFFYECKPPCAHFVVKDYGHMDMLDDDPQ  257

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G ++ CMCKNG   R  MR  VGG VVAFL  +L  D   L+ I+   +++P +L+
Sbjct  258  G-MVGAVSGCMCKNGTGPRELMRKTVGGIVVAFLNAYLNGDDRDLVAIVGDPDSSPAKLE  316

Query  226  PVD  218
            PV+
Sbjct  317  PVE  319



>gb|AAP92160.2| chlorophyllase [Piper betle]
Length=306

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 110/182 (60%), Gaps = 12/182 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG-----------TCPDVLNSTPD  596
            L+GHSRGGK AF + LG   +   ++FS +IGVDPV G             P ++ +   
Sbjct  117  LAGHSRGGKAAFCMLLGLAGSPLTVQFSGLIGVDPVAGFQIPGINYKMEIPPKIITNNSK  176

Query  595  YFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLD  416
             FD+N+P ++IG+ LG+  K  L+ PCAP G NY  FY K + P+   VAK YGH DMLD
Sbjct  177  PFDINVPTLIIGTELGEEAKGCLAPPCAPAGLNYEQFYEKSKEPSYQFVAKGYGHVDMLD  236

Query  415  DDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPV  236
            D ++  L G LTYC+CKNG  R PMR   GG +VAFL+ F +   + L  I++  E AP+
Sbjct  237  DISKNDLMGKLTYCVCKNGKEREPMRRTAGGLMVAFLKAFSDGQRDDLDAILNDPELAPI  296

Query  235  EL  230
            +L
Sbjct  297  QL  298



>gb|AAN51933.1|AF337544_1 chlorophyllase 1 [Brassica oleracea]
 emb|CDY39361.1| BnaC05g15260D [Brassica napus]
Length=324

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  +KFSA++G+DPV G      T P++L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +MP  VIG+GLG  K N+L  PCAP   N+  FY +C+A     VA DYGH DMLDD+  
Sbjct  194  DMPVAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR+FVGG VVAFL+  +  +M+ +  I+     +P  L 
Sbjct  253  G-FVGFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSIWGEMSEIRQILKDPSVSPARLD  311

Query  226  P  224
            P
Sbjct  312  P  312



>emb|CDY38340.1| BnaA02g18330D [Brassica napus]
Length=324

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 114/181 (63%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  +KFSA++G+DPV G      T P++L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +MP  VIG+GLG  K N+L  PCAP   N+  FY +C+A     VA DYGH DMLDD+  
Sbjct  194  DMPVAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR+FVGG VVAFL+  +  +M+ +  I+     +P  L 
Sbjct  253  G-FVGFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSIWGEMSEIRQILKDPSVSPARLD  311

Query  226  P  224
            P
Sbjct  312  P  312



>ref|XP_004983205.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Setaria italica]
Length=347

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 121/183 (66%), Gaps = 11/183 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            +SGHSRGGKVAFALALG    A +  +A++ VDPV G      T P +L        ++ 
Sbjct  156  VSGHSRGGKVAFALALGHAKLA-IPLAALVAVDPVDGMGMGRQTPPPILTGRSGALRVSA  214

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSK---CRAPACCLVAKDYGHTDMLDDDT  407
            PAMVIG+GLG++ +  L  PCAP+G ++AAF  +     A AC LVA+DYGHTDM+DDDT
Sbjct  215  PAMVIGTGLGELPRGPLLPPCAPRGVSHAAFCDEMDPAAASACHLVARDYGHTDMMDDDT  274

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             G+ RG+LT  +C++G ARAPMR FVGGA VAFL+ ++  D   L GI  + E APV L 
Sbjct  275  PGA-RGILTRAICRSGGARAPMRRFVGGATVAFLKRWVGGDGAALDGIRARPEQAPVALS  333

Query  226  PVD  218
             V+
Sbjct  334  VVE  336



>gb|ACU24105.1| unknown [Glycine max]
Length=316

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 109/183 (60%), Gaps = 11/183 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG--------TCPDVLNSTPDYFDL  584
            L GHS+GGK AFA+ALG   T  LKFSA+IG+DPV G        + PD+L   P  F+L
Sbjct  130  LVGHSKGGKTAFAVALGYCKT-KLKFSALIGIDPVAGVSKCKPCRSLPDILTGVPRSFNL  188

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            N+P  VIG+GLG  K N L  PCAP G N+  F S+C+ P+   VA DYGH DMLDD+T 
Sbjct  189  NIPVAVIGTGLGPEKANSLFPPCAPNGVNHKEFSSECKPPSAYFVATDYGHMDMLDDETP  248

Query  403  GSLRGMLTYCMCKNGPA--RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
            G +  M++ CMCKNG    R  MR  VGG VVAFLR  L         I+     AP +L
Sbjct  249  GVIGTMMSKCMCKNGKKGPRDLMRRTVGGLVVAFLRAQLNEQWKDFDAILASPNLAPAKL  308

Query  229  QPV  221
              V
Sbjct  309  DDV  311



>gb|EPS63536.1| hypothetical protein M569_11246, partial [Genlisea aurea]
Length=267

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 111/159 (70%), Gaps = 8/159 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGKVAFALAL   +++  KFSAIIGVDPV G      T P VL   P  F LN 
Sbjct  98   LSGHSRGGKVAFALALSSLSSSCPKFSAIIGVDPVDGMDKGSQTSPPVLTYIPKSFQLNG  157

Query  577  PA-MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
             A M+IG+GLG+ ++N L   CAP+G N+  FY +CR P+   V KDYGH D+LDD+T G
Sbjct  158  TAVMIIGTGLGEERRNPLFPACAPRGVNHEDFYKECRKPSYYFVGKDYGHMDVLDDETNG  217

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESD  284
             +RG  +YC+CKNG +R PMR FVGG +VAFL+ +L SD
Sbjct  218  -IRGKASYCLCKNGESRGPMRRFVGGVLVAFLKAYLRSD  255



>ref|XP_008345193.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=272

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 112/176 (64%), Gaps = 3/176 (2%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVI  563
            LSGHS G   AFA+ALG+  T+  LK S +IG+DPV G   ++L  +P  FDL++P  VI
Sbjct  94   LSGHSXGRNTAFAIALGRAKTSLSLKISVLIGIDPVAGATRNILTYSPQSFDLSIPVTVI  153

Query  562  GSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGML  383
            G+GLG   KN    PCA  G+N+  F+ +C+ P    V KDYGH DMLDDD +G + G +
Sbjct  154  GTGLGPESKNPCMPPCAXXGANHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQG-MVGAV  212

Query  382  TYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            + CMCKNG   R  MR  VGG VVAFL  +L  D   L+ I+   +++P +L+PV+
Sbjct  213  SGCMCKNGTGPRELMRKTVGGIVVAFLNAYLNGDDKDLVAIVGDPDSSPAKLEPVE  268



>ref|XP_009149451.1| PREDICTED: chlorophyllase-1 [Brassica rapa]
Length=324

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  +KFSA++G+DPV G      T P++L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +MP  VIG+GLG  K N+L  PCAP   N+  FY +C+A     VA DYGH DMLDD+  
Sbjct  194  DMPIAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +  I+     +P  L 
Sbjct  253  G-FVGFMAGCMCKNGKRKKSEMRSFVGGIVVAFLKYSLWGEKSEIRQIVKDPSVSPARLD  311

Query  226  P  224
            P
Sbjct  312  P  312



>ref|XP_009370779.1| PREDICTED: chlorophyllase-1-like [Pyrus x bretschneideri]
Length=320

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 115/182 (63%), Gaps = 11/182 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGG  AFA+ALG+  T+  LK S +IG+DPV G      T P +L  +P  FDL+
Sbjct  138  LSGHSRGGFTAFAIALGRAKTSLSLKISVLIGIDPVAGKNRYCTTRPHILTYSPQSFDLS  197

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +P  VIG+GLG   K  +  PCAP G N+  F+ +C+ P    V KDYGH DMLDDD +G
Sbjct  198  IPVTVIGTGLGPEIKTCI--PCAPDGVNHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQG  255

Query  400  SLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
             + G ++ CMCKNG   R  MR  VGG VVAFL  +L  D   L+ I+   +++P +L+P
Sbjct  256  VV-GAVSGCMCKNGTGPREIMRKTVGGIVVAFLNAYLNGDDRYLLAIVGDPDSSPAKLEP  314

Query  223  VD  218
            V+
Sbjct  315  VE  316



>ref|XP_010477190.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=326

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D   KFSA+IG+DPV G      T P +L   PD F+L
Sbjct  139  LVGHSRGGKTAFAVALGHAATLDPSFKFSALIGIDPVAGSNKFMRTDPHILTYEPDSFEL  198

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P +V+G+GLG  +KN++  PCAP   N+  FY +C+A     VA D+GH DMLDDD  
Sbjct  199  DIPVVVVGTGLGPERKNVMP-PCAPTDLNHEEFYRECKATKSHFVAADFGHMDMLDDDLP  257

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G +  CMCKNG   ++ MR FVGG VVAFL+  L  +   +  I+     +PV L 
Sbjct  258  GFV-GFMAGCMCKNGKGKKSEMRKFVGGIVVAFLKYSLWGEKAEIRRIVKDPLVSPVRLD  316

Query  226  P  224
            P
Sbjct  317  P  317



>gb|ABR16879.1| unknown [Picea sitchensis]
Length=314

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 114/182 (63%), Gaps = 14/182 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            ++GHSRGGKVAF LALG  +    +K SA++G+DPV G      T P +L   P  FDL+
Sbjct  128  VAGHSRGGKVAFGLALGLASEKTKVKMSALVGIDPVDGRGRGHQTEPPILTYKPHSFDLH  187

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +P +VIGSGLG+ K NLL  PCAP G ++  F+S+C  P+   VA ++GH D L+DDT  
Sbjct  188  IPTLVIGSGLGE-KWNLLVPPCAPDGVSHREFFSECSVPSYHFVASEFGHMDFLNDDT--  244

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
               G LT+  CKNG AR PMR F GG +VAFL   L +D   L  ++   E APV L+P 
Sbjct  245  ---GPLTF-FCKNGVAREPMRRFSGGIMVAFLHACLRNDSEALNHLLLHPEDAPVTLEPP  300

Query  220  DS  215
             S
Sbjct  301  QS  302



>gb|ABE01079.1| chlorophyllase [Piper betle]
 gb|ABI96085.1| chloroplast chlorophyllase [Piper betle]
Length=306

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 109/182 (60%), Gaps = 12/182 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG-----------TCPDVLNSTPD  596
            L+GHSRGGK AF + LG   +   ++FS +IGVDPV G             P ++ +   
Sbjct  117  LAGHSRGGKAAFCMLLGLAGSPLTVQFSGLIGVDPVAGFQIPGINYKMEIPPKIITNNSK  176

Query  595  YFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLD  416
             FD+N+P ++IG+ LG+  K  L+ P AP G NY  FY K + P+   VAK YGH DMLD
Sbjct  177  PFDINVPTLIIGTELGEEAKGCLAPPYAPAGLNYEQFYEKSKEPSYQFVAKGYGHVDMLD  236

Query  415  DDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPV  236
            D ++  L G LTYC+CKNG  R PMR   GG +VAFL+ F +   + L  I++  E AP+
Sbjct  237  DISKNDLMGKLTYCVCKNGKEREPMRRTAGGLMVAFLKAFSDGQRDDLDAILNDPELAPI  296

Query  235  EL  230
            +L
Sbjct  297  QL  298



>gb|ACO50429.1| chlorophyllase 2 [Pachira macrocarpa]
Length=313

 Score =   156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 110/180 (61%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG-----TCPDVLNSTPDYFDLNMP  575
            L GHSRGGK AFALALG+  TA   FSA++G+DPV G     T P +L  TP  FDL++P
Sbjct  133  LVGHSRGGKTAFALALGRAKTAQ-NFSALVGIDPVAGNRFGETSPKILTYTPGSFDLSIP  191

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              V+G+GLG   K  + CPCAP   N+  F+++C+ P     AK+YGH D LDD+  G +
Sbjct  192  VAVVGTGLGPESKGCMPCPCAPTQYNHEEFFNECKPPRVHFDAKNYGHMDTLDDNPSGFI  251

Query  394  RGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             G L+  +C NG   R PMR  VGG VVAFL  F E++    M I+++   APV L  V 
Sbjct  252  -GKLSDTICVNGEGPRDPMRRCVGGIVVAFLNYFFEAEKEDFMTIMNEPYVAPVTLDQVQ  310



>emb|CDP03668.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 112/180 (62%), Gaps = 13/180 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            ++GH RGG VAF LALGK  T  + F A+IG+DPV G      + PD+L   P  FDL +
Sbjct  120  VAGHGRGGYVAFCLALGKAETT-VNFKALIGIDPVAGVNTLWRSKPDILTYIPRSFDLEI  178

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLG  KKN L  PCAP+G N+A F+++C+ P C  +AK+YGHT MLDD     
Sbjct  179  PVGVIGTGLGSQKKNFLLPPCAPEGVNHAEFFNECKPPCCYFLAKEYGHTGMLDDGA---  235

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
                L  C CK G   R  MR  V G VVAF+  +L+++ + L+ +I+  ++AP+ L PV
Sbjct  236  --AKLGNCACKKGSQPRYLMRKAVAGIVVAFMESYLKNNESDLLAVINNPKSAPITLDPV  293



>emb|CDY29413.1| BnaA06g13830D [Brassica napus]
Length=324

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 113/182 (62%), Gaps = 11/182 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  +KFSA++G+DPV G      T P++L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +MP  VIG+GLG  K N+L  PCAP   N+  FY +C+A     VA DYGH DMLDD+  
Sbjct  194  DMPVAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMDMLDDNLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKN    ++ MR+FVGG VVAFL+  L  + + +  I+     +P  L 
Sbjct  253  G-FVGFMAGCMCKNSKRKKSEMRSFVGGIVVAFLKYSLLGEKSEIRQIVKDPSVSPARLD  311

Query  226  PV  221
            P+
Sbjct  312  PL  313



>ref|XP_010498391.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=325

 Score =   156 bits (394),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 112/181 (62%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D   KFSA+IG+DPV G      T P +L   PD F+L
Sbjct  138  LVGHSRGGKTAFAVALGHAATLDPSFKFSALIGIDPVAGANKCMRTDPHILTYKPDSFEL  197

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG  +KN++  PCAP   N+  FY +C+A     VA D+GH DMLDDD  
Sbjct  198  DIPVAVVGTGLGPKRKNVMP-PCAPADLNHEEFYKECKATKSHFVAADFGHMDMLDDDLP  256

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G +  CMCKNG   +  MR FVGG VVAFL+  L  + + +  ++     +PV L 
Sbjct  257  GFV-GFMAGCMCKNGKGKKKEMRKFVGGIVVAFLKYSLWGEKSEIRRVVKDPLVSPVRLD  315

Query  226  P  224
            P
Sbjct  316  P  316



>gb|KHN44574.1| Chlorophyllase-1 [Glycine soja]
Length=313

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 106/182 (58%), Gaps = 9/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            LSGHSRGGK  FA+ALG   T +LKFSA++G+DPV GT       P +L   P  FDL M
Sbjct  129  LSGHSRGGKTVFAVALGHAKT-NLKFSALVGIDPVAGTSKYCRTRPHILTGKPRSFDLKM  187

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLG  K N  + PCAP G NY  F+++C+ P    V   YGH DML+DDT G 
Sbjct  188  PVEVIGTGLGPEKLNCCTPPCAPDGVNYKEFFNECKPPCAKFVVAKYGHMDMLNDDTPGL  247

Query  397  LRGMLTYCMCKNGPA--RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
            +  +++ CMCKNG    R  MR   GG VV+FLR  L         I+     AP E+  
Sbjct  248  IGTLVSKCMCKNGTTGPRDLMRRTTGGLVVSFLRAQLNDLWKDFDAILKDPNLAPTEVDG  307

Query  223  VD  218
            VD
Sbjct  308  VD  309



>ref|NP_001130783.1| chlorophyllase-2 [Zea mays]
 gb|ACF79135.1| unknown [Zea mays]
 tpg|DAA49920.1| TPA: chlorophyllase-2 [Zea mays]
Length=346

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 120/186 (65%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKT-ATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGKVAFALALG   A   +  +A++ VDPV G      T P +L        + 
Sbjct  157  ISGHSRGGKVAFALALGHAKAKLAVPLAAVVAVDPVDGMGVGKQTPPPILTGRHGSLHVG  216

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKC--RAPACCLVAKDYGHTDMLDDDT  407
             PAMVIG+GLG++ +  L  PCAP+G ++AAFY +    APAC LV +DYGHTDM+DDDT
Sbjct  217  APAMVIGTGLGELPRGSLLPPCAPRGVSHAAFYDELDGAAPACHLVVRDYGHTDMMDDDT  276

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             G+ RGMLT  +C++G ARAPMR FV GA VAFL+ ++  D   +  I  + + APV L 
Sbjct  277  PGA-RGMLTRTICRSGGARAPMRRFVAGATVAFLKKWVAGDAAAMDSITARPDQAPVALS  335

Query  226  PVDSKD  209
             V+  D
Sbjct  336  VVEFGD  341



>ref|XP_004290630.1| PREDICTED: chlorophyllase-1 [Fragaria vesca subsp. vesca]
Length=308

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 113/182 (62%), Gaps = 10/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKT-ATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            LSGHSRGGK AFALALG   A+  L FS +IG+DPV G      T P +L   P  FDLN
Sbjct  123  LSGHSRGGKAAFALALGHAKASLSLDFSVLIGIDPVAGANQYCRTNPHILTYVPCSFDLN  182

Query  580  MPAMVIGSGLGDVKKN-LLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  VIG+GLG  KKN  +S PCA  G N+  F+++ + P    VAKDYGH DMLDDD  
Sbjct  183  IPIAVIGTGLGPEKKNDCMSQPCASDGVNHKEFFNESKPPCAHFVAKDYGHMDMLDDDPP  242

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G L G L+ C+CKNG   +  MR  VGG VVAFL+ +L  +   L+ I+     +P +L 
Sbjct  243  G-LVGALSGCLCKNGSGPKDLMRKSVGGIVVAFLKAYLNGEDGDLLAIVADPGLSPAKLD  301

Query  226  PV  221
            PV
Sbjct  302  PV  303



>ref|XP_006416475.1| hypothetical protein EUTSA_v10008201mg [Eutrema salsugineum]
 gb|ESQ34828.1| hypothetical protein EUTSA_v10008201mg [Eutrema salsugineum]
Length=324

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 112/182 (62%), Gaps = 11/182 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D   KFSA+IG+DPV G      T P++L   P+ F++
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDTSFKFSALIGIDPVAGISKCMRTDPEILTYKPESFEI  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG  K N +  PCAP   N+  FY +C+A     VA DYGH DMLDDD  
Sbjct  194  DIPVAVVGTGLGP-KSNGMMPPCAPAEVNHEEFYKECKATKGHFVAADYGHMDMLDDDLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G +  CMCKNG   ++ MR FVGG VVAFLR  L    + +  I+     +PV L 
Sbjct  253  GFV-GFMAGCMCKNGKRKKSEMRRFVGGIVVAFLRYSLWGHKSEIREILKDPSASPVTLD  311

Query  226  PV  221
            P+
Sbjct  312  PL  313



>gb|ACG44273.1| chlorophyllase-2 [Zea mays]
Length=346

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 120/186 (65%), Gaps = 10/186 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKT-ATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGKVAFALALG   A   +  +A++ VDPV G      T P +L        + 
Sbjct  157  ISGHSRGGKVAFALALGHAKAKLAVPLAAVVAVDPVDGMGVGKQTPPPILTGRHGSLHVG  216

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKC--RAPACCLVAKDYGHTDMLDDDT  407
             P MVIG+GLG++ +  L  PCAP+G ++AAFY +    APAC LVA+DYGHTDM+DDDT
Sbjct  217  APTMVIGTGLGELPRGSLLPPCAPRGVSHAAFYDELDGAAPACHLVARDYGHTDMMDDDT  276

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             G+ RGMLT  +C++G ARAPMR FV GA VAFL+ ++  D   +  I  + + AP+ L 
Sbjct  277  PGA-RGMLTRTICRSGGARAPMRRFVAGATVAFLKKWVAGDAAAMDSITARPDQAPIALS  335

Query  226  PVDSKD  209
             V+  D
Sbjct  336  VVEFGD  341



>gb|KDP21409.1| hypothetical protein JCGZ_21880 [Jatropha curcas]
Length=353

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 110/184 (60%), Gaps = 8/184 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT-ADLKFSAIIGVDPVGGTC-----PDVLNSTPDYFDLNM  578
            ++GHSRGGK+AFALALG   T   +  SA+IG+DPV GT      P VL   P+ F+L++
Sbjct  161  IAGHSRGGKMAFALALGYAKTPLTVTISALIGLDPVEGTENIVVDPKVLTYIPNSFNLSV  220

Query  577  PAMVIGSGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            P  VIGSGLG+     L CP CAP G N+  +YS+C+ P    V  DYGH D++DD  + 
Sbjct  221  PVAVIGSGLGNESNCWLVCPACAPNGMNHVEYYSECKNPVSHFVTTDYGHMDVIDDGLKD  280

Query  400  SLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
             L G++   MCKN   +R PMR  VGG  VAFL+ +L  +    M I+     APV L P
Sbjct  281  KLLGIMANVMCKNSKDSRDPMRRTVGGIFVAFLKAYLFGESGDYMTILQDPSVAPVTLDP  340

Query  223  VDSK  212
            V  K
Sbjct  341  VQFK  344



>ref|XP_002893060.1| coronatine-induced protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69319.1| coronatine-induced protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=324

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGGTC------PDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  + FSA+IG+DPV GT       P +L   P+ FDL
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAGTNKFMRTDPHILTYKPESFDL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG    N++  PCAP   N+  FY +C+A     VA DYGH DMLDDD  
Sbjct  194  DIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDDLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +  I+     +P  + 
Sbjct  253  G-FVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEIRLIVKDPSVSPATID  311

Query  226  P  224
            P
Sbjct  312  P  312



>ref|XP_004956217.1| PREDICTED: chlorophyllase-1-like [Setaria italica]
Length=315

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 108/183 (59%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            L+GHSRGG  AF+L LG   T +LKFSA+IG+DPV GT       P +L   P  FD+ M
Sbjct  137  LAGHSRGGHTAFSLVLGHGKT-NLKFSALIGLDPVAGTGKSSQISPKILTYEPSSFDIAM  195

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIG+GLG+ KKN+L  PCAPK  N+  FY +CR P    V KDYGH DMLDDD    
Sbjct  196  PVLVIGTGLGEEKKNILFPPCAPKDVNHREFYHECRPPCYYFVTKDYGHLDMLDDDAPKF  255

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +      CMCK+G   +  MR  V G +VAFL+  L  +   L  I+   +  P  + PV
Sbjct  256  MT-----CMCKDGKNCKDLMRRTVAGIMVAFLKAVLNEEDGDLRVIMKDPKLTPTTVDPV  310

Query  220  DSK  212
            + +
Sbjct  311  EHR  313



>ref|XP_010459642.1| PREDICTED: chlorophyllase-1-like [Camelina sativa]
Length=326

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT--ADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT     KFSA+IG+DPV G      T P +L   PD F+L
Sbjct  139  LVGHSRGGKTAFAVALGHAATLAPSFKFSALIGIDPVAGANKCMRTDPHILTYEPDSFEL  198

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG  + N++  PCAP   N+  FY +C+A     VA D+GH DMLDDD  
Sbjct  199  DIPIAVVGTGLGPKRNNVMP-PCAPADLNHEEFYKECKATKSHFVAADFGHMDMLDDDLP  257

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR FVGG VVAFL+  L  + + +  I+     +PV L 
Sbjct  258  G-FVGFMAGCMCKNGKGKKSEMRKFVGGIVVAFLKYSLWGEKSEIRRIVKDPLVSPVRLD  316

Query  226  P  224
            P
Sbjct  317  P  317



>gb|AFK44490.1| unknown [Lotus japonicus]
Length=122

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = -1

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MPAMVIGSGLGDVK+N L  PCAPK  N+  F+++C  PA   VAKDYGH DMLDDDT G
Sbjct  1    MPAMVIGSGLGDVKRNPLFPPCAPKTVNHEDFFNECNKPAWYFVAKDYGHVDMLDDDTNG  60

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
             + G  TYC+CKNG +R PMR FVGG VVAFL+ +++ D   L+ I D+   APVEL+
Sbjct  61   II-GKATYCLCKNGESRKPMRTFVGGLVVAFLKAYMQGDNRDLLAIKDKHLRAPVELK  117



>emb|CBI28741.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 109/174 (63%), Gaps = 9/174 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGK AFALALG   T+ L FSA++G+DPVGG      T P +L   P  F+L +
Sbjct  389  LSGHSRGGKTAFALALGYADTS-LNFSALLGLDPVGGLSKCSQTVPKILTYVPHSFNLAI  447

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLGD  +N L+CPCAP G N+  F+S+C+ P    V  +YGH DMLDD   G 
Sbjct  448  PVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLSGC  507

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
            +  +  Y +CK+G   R PMR  VGG  VAFL+ +LE        I+D+ + AP
Sbjct  508  IGAISGY-ICKSGKGPRDPMRRCVGGLFVAFLKAYLEGQTGDFKAIVDEPDLAP  560


 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F L+
Sbjct  691  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFILD  750

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT-  407
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  751  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  810

Query  406  ---RGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  811  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDEPGIAP  870

Query  238  VELQPVDSKD  209
            V+L+ ++  +
Sbjct  871  VKLEVMEDSE  880



>ref|XP_004512891.1| PREDICTED: chlorophyllase-1-like [Cicer arietinum]
Length=323

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 109/178 (61%), Gaps = 11/178 (6%)
 Frame = -1

Query  730  HSRGGKVAFALALGKTATADLKFSAIIGVDPVGG--------TCPDVLNSTPDYFDLNMP  575
            HS+GGK AFA+ALG   T +LKFSA+IG+DPV G        T P +L      F+LN+P
Sbjct  140  HSKGGKTAFAIALGHAKT-NLKFSALIGIDPVAGPSKCKICRTPPHILTGQAQSFNLNIP  198

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS-  398
             +VIG+GLG  K N  S PCAP+G N+  F+ +C+ P    V KDYGH DMLDDD++   
Sbjct  199  VVVIGTGLGPEKSNCFSIPCAPEGVNHKQFFYECKPPCAHFVTKDYGHMDMLDDDSQTQG  258

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            LR  +  C+CK+G  ++  MR  +GG VVAFL+  L +       I+D    AP +L+
Sbjct  259  LRESVLKCICKSGIGSKDFMRRTLGGLVVAFLKAHLNNQWKDFQAILDDPNLAPAKLE  316



>ref|NP_564094.1| chlorophyllase 1 [Arabidopsis thaliana]
 sp|O22527.1|CLH1_ARATH RecName: Full=Chlorophyllase-1; Short=AtCLH1; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; AltName: 
Full=Coronatine-induced protein 1; Short=CORI1 [Arabidopsis 
thaliana]
 gb|AAG12547.1|AC007797_7 coronatine-induced protein 1 [Arabidopsis thaliana]
 gb|AAC13947.1| coronatine-induced protein 1 [Arabidopsis thaliana]
 gb|AAM20666.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15628.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29881.1| chlorophyllase 1 [Arabidopsis thaliana]
Length=324

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 110/181 (61%), Gaps = 11/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGGTC------PDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  + FSA+IG+DPV GT       P +L   P+ F+L
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSITFSALIGIDPVAGTNKYIRTDPHILTYKPESFEL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG    N++  PCAP   N+  FY +C+A     VA DYGH DMLDDD  
Sbjct  194  DIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFVAADYGHMDMLDDDLP  252

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  CMCKNG   ++ MR+FVGG VVAFL+  L  +   +  I+     +P +L 
Sbjct  253  G-FVGFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEIRLIVKDPSVSPAKLD  311

Query  226  P  224
            P
Sbjct  312  P  312



>ref|XP_003534159.1| PREDICTED: chlorophyllase-1-like [Glycine max]
 gb|KHN23755.1| Chlorophyllase-1 [Glycine soja]
Length=315

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 107/180 (59%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            LSGHS+GGK  FA+ALG   T +LKFSA++G+DPV G C      P +L      F+LN+
Sbjct  132  LSGHSKGGKTVFAVALGYAKT-NLKFSALVGIDPVAGPCKSCETFPPILTGMSQSFNLNI  190

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIG+GLG  K N    PCAP G N+  F++KC+ P    VA +YGH DMLDD T G 
Sbjct  191  PIVVIGTGLGPEKANFFIPPCAPDGVNHKEFFNKCKPPCAHFVATEYGHMDMLDDVTPGL  250

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +L+ C+CK+G   R  MR  VGG VVAFLR  L         ++     AP +L  V
Sbjct  251  IGSILSNCICKDGKGPRDLMRRTVGGLVVAFLRAQLNGLWKDFNAVLANPNLAPTKLDDV  310



>ref|XP_003620408.1| Chlorophyllase-1 [Medicago truncatula]
 gb|AES76626.1| chlorophyllase enzyme [Medicago truncatula]
Length=314

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 109/181 (60%), Gaps = 13/181 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG--------TCPDVLNSTPDYFDL  584
            L+GHS+GGK AFA+ALG   T +LKFSA+IG+DPV G        T P +L      FDL
Sbjct  131  LAGHSKGGKTAFAVALGHAET-NLKFSALIGIDPVAGPSKCKITRTLPHILTGQAQSFDL  189

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            NMP +VIG+GLG    N    PCAP G N+  F+ +C+ P    V KDYGH DMLDD+T 
Sbjct  190  NMPVIVIGTGLGPEPSNCSPLPCAPDGVNHEEFFYECKPPCAHFVVKDYGHMDMLDDETH  249

Query  403  GSLRGMLTYCMCKN--GPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
              +RG L  C+CKN  GP    +R  +GG VV+FL+ +L +       I++    AP +L
Sbjct  250  -DIRGSLLKCLCKNGTGPKDLMIRT-LGGLVVSFLKAYLYNQPEDFEVILEDPNLAPAKL  307

Query  229  Q  227
            +
Sbjct  308  E  308



>ref|XP_001753563.1| predicted protein [Physcomitrella patens]
 gb|EDQ81786.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   151 bits (382),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 105/176 (60%), Gaps = 8/176 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            L GHSRG KV F LALG    + L++SA++G+DPV G      T P +L  +    +L +
Sbjct  144  LVGHSRGAKVVFGLALG-VRNSILQYSAVVGLDPVDGMGIGQQTNPPILQFSEGSLNLGV  202

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P ++IG+GLG ++KN L   CAP G ++ AFY    APA   VA   GH D L+DD  G 
Sbjct  203  PTLIIGTGLGPLRKNFLFPACAPAGVSHEAFYYDSAAPAFHFVASKQGHMDFLNDDCSGP  262

Query  397  LRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
              GM +YC+CKNGP R PMR F GG VVAFLR     +  PL+  +   E AP+ L
Sbjct  263  -TGMFSYCLCKNGPTRKPMRRFSGGMVVAFLRAAFFGETAPLVAALATPELAPIPL  317



>ref|XP_007152724.1| hypothetical protein PHAVU_004G154100g [Phaseolus vulgaris]
 gb|ESW24718.1| hypothetical protein PHAVU_004G154100g [Phaseolus vulgaris]
Length=315

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 106/182 (58%), Gaps = 10/182 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT--------CPDVLNSTPDYFDL  584
            LSGHS+GGK AF +A G   T  L FSA+IG+DPVGGT         P++L   P   +L
Sbjct  130  LSGHSKGGKTAFCVAQGYAKTI-LGFSALIGIDPVGGTSKCKVSKTVPEILTGVPRSLNL  188

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            N+P  VIG+GLG    N+L  PCAP G N+  F+++ + P    VA +YGH DMLDD+T 
Sbjct  189  NIPVAVIGTGLGPESANVLFPPCAPDGENHKDFFNESKPPCAHFVATEYGHMDMLDDETP  248

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G L  +++ CMCKNG   R  MR  VGG VVAFLR  L+        I+     AP  L 
Sbjct  249  GPLGTIMSKCMCKNGKGHRDLMRKTVGGLVVAFLRAQLDEKFKDFDAILGDPNLAPARLD  308

Query  226  PV  221
             V
Sbjct  309  DV  310



>ref|XP_006304020.1| hypothetical protein CARUB_v10009755mg [Capsella rubella]
 gb|EOA36918.1| hypothetical protein CARUB_v10009755mg [Capsella rubella]
Length=322

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 110/181 (61%), Gaps = 10/181 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D   KFSA++ +DPV G      T P +L   P+ F+L
Sbjct  134  LVGHSRGGKTAFAVALGHAATLDPSFKFSALVAIDPVAGLSKCIRTDPHILTYKPESFEL  193

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            ++P  V+G+GLG  + +++  PCAP   N+  FY +C+A     VA D+GH DMLDDD  
Sbjct  194  DIPVAVVGTGLGPERNHVVMPPCAPTDLNHDEFYKECKATKAHFVAADHGHMDMLDDDLP  253

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G   G +  C CKNG   ++ MR FVGG VVAFL+  L ++ + +  I+     +PV L 
Sbjct  254  GFF-GYVAGCTCKNGKGNKSEMRRFVGGIVVAFLKYSLWAEKSEIRRIVKDPFVSPVRLD  312

Query  226  P  224
            P
Sbjct  313  P  313



>gb|AEK97328.1| chromoplast chlorophyllase [Brassica rapa var. parachinensis]
Length=188

 Score =   145 bits (366),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 101/154 (66%), Gaps = 11/154 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  AT D  +KFSA++G+DPV G      T P++L   P+ FDL
Sbjct  37   LVGHSRGGKTAFAVALGHAATLDPSIKFSALVGIDPVAGISKCIRTDPEILTYKPESFDL  96

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +MP  VIG+GLG  K N+L  PCAP   N+  FY +C+A     VA DYGH +MLDD+  
Sbjct  97   DMPVAVIGTGLGP-KSNMLMPPCAPAEVNHEEFYIECKATKGHFVAADYGHMNMLDDNLP  155

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFL  305
            G   G +  CMCKN    ++ MR+FVGG VVAFL
Sbjct  156  G-FVGFMAGCMCKNSKRKKSEMRSFVGGIVVAFL  188



>ref|XP_002459848.1| hypothetical protein SORBIDRAFT_02g012300 [Sorghum bicolor]
 gb|EER96369.1| hypothetical protein SORBIDRAFT_02g012300 [Sorghum bicolor]
Length=318

 Score =   148 bits (374),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 112/187 (60%), Gaps = 16/187 (9%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG--KTATADL-KFSAIIGVDPVGGT------CPDVLNSTPDYFD  587
            L+GHSRGG  AF+LALG  KT T+ L KFSA+IG+DPV GT       P +L   P  FD
Sbjct  135  LAGHSRGGHTAFSLALGYAKTNTSSLLKFSALIGLDPVAGTGKNSQLPPAILTYEPSSFD  194

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            + +P +VIG+GLGD ++N L  PCAP   N+A FY +CRAP   LV KDYGH DMLDDD 
Sbjct  195  IAVPVLVIGTGLGDERENALFPPCAPVEVNHAEFYRECRAPCYHLVTKDYGHLDMLDDDA  254

Query  406  RGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMN-PLMGIIDQTETAPVE  233
                   L  C+CK G   +  MR  V G +VAFL+  +  D +  L  I+     AP  
Sbjct  255  PK-----LVTCLCKEGNTCKDVMRRTVAGIMVAFLKAVMGEDEDGDLKAILQHPGLAPTI  309

Query  232  LQPVDSK  212
            L PV+ +
Sbjct  310  LDPVEYR  316



>ref|XP_003528959.1| PREDICTED: chlorophyllase-1-like [Glycine max]
Length=307

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 101/176 (57%), Gaps = 3/176 (2%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIG  560
            LSGHSRGGK  FA+ALG   T +LKFSA++G      T P +L   P  FDL MP  VIG
Sbjct  129  LSGHSRGGKTVFAVALGHAKT-NLKFSALVGTSKYCRTRPHILTGKPRSFDLKMPVEVIG  187

Query  559  SGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLT  380
            +GLG  K N  + PCAP G NY  F+++C+ P    V   YGH DML+DDT G +  +++
Sbjct  188  TGLGPEKLNCCTPPCAPDGVNYKEFFNECKPPCAKFVVAKYGHMDMLNDDTPGLIGTLVS  247

Query  379  YCMCKNGPA--RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             CMCKNG    R  MR   GG VV+FLR  L         I+     AP E+  VD
Sbjct  248  KCMCKNGTTGPRDLMRRTTGGLVVSFLRAQLNDLWKDFDAILKDPNLAPTEVDGVD  303



>gb|AHJ14565.1| chlorophyllase [Triticum aestivum]
Length=319

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 105/183 (57%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            L+GHSRGG  AF+LALG   T  L FSA+IG+DPV GT       P +L   P  F + M
Sbjct  141  LAGHSRGGHTAFSLALGHAKT-QLTFSALIGLDPVAGTGKSSQLQPKILTYEPSSFGMAM  199

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIG+GLG+ KKN+   PCAPK  N+A FY +CR P   LV KDYGH DMLDDD    
Sbjct  200  PVLVIGTGLGEEKKNIFFPPCAPKDVNHAEFYRECRPPCYYLVTKDYGHLDMLDDDAPKF  259

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +      C+CK+G   +  MR  V G +VAFL   L      L  I+     AP  L PV
Sbjct  260  IT-----CVCKDGNGCKGKMRRCVAGIMVAFLNAALGEKDADLEAILRDPAVAPTTLDPV  314

Query  220  DSK  212
            + +
Sbjct  315  EHR  317



>ref|XP_010523688.1| PREDICTED: chlorophyllase-1 [Tarenaya hassleriana]
Length=319

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATAD--LKFSAIIGVDPVGG------TCPDVLNSTPDYFDL  584
            L GHSRGGK AFA+ALG  +T D   KFSA++G+DPV G      T P +L   P+ F+L
Sbjct  128  LVGHSRGGKTAFAVALGHASTLDPSTKFSALVGIDPVAGSNVCMRTQPHILTYEPESFEL  187

Query  583  NMPAMVIGSGLGDVKKNLL-SCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            +MP  V+G+GLG + K    S PCAP G N+  F+++CR      VA DYGH DMLDDD 
Sbjct  188  DMPVAVVGTGLGPLWKTKPPSPPCAPDGVNHKEFFNECRPTRAHFVAADYGHMDMLDDDL  247

Query  406  RGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
             G++ G L  C+CK G   ++ MR FVGG VVAFL+  +  D + +  I+     +P  +
Sbjct  248  EGAV-GYLAGCLCKKGKLDKSGMRRFVGGIVVAFLKYSVFGDKSEINSIVKDPSLSPARI  306

Query  229  QP  224
             P
Sbjct  307  DP  308



>ref|XP_008652459.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Zea mays]
 tpg|DAA60721.1| TPA: hypothetical protein ZEAMMB73_331237 [Zea mays]
Length=318

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 13/184 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTA-TADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AF+LALG    ++ L FSA+IG+DPV GT       P +L   P  FD+ 
Sbjct  138  LAGHSRGGHMAFSLALGYAKISSSLSFSALIGLDPVAGTGKNSQLPPAILTYAPSSFDIA  197

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP +VIG+GLGD ++N+L  PCAP   N+  FY +CRAP   LV K+YGH DMLDDD   
Sbjct  198  MPVLVIGTGLGDERENVLFPPCAPVDVNHTEFYRECRAPCYHLVTKNYGHLDMLDDDAPK  257

Query  400  SLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
                 L  C+CK G + +  MR  V G +VAFL+  +  +   L  I+     AP  L P
Sbjct  258  -----LVTCLCKEGNSCKDVMRRTVAGIMVAFLKAVMGEEDGDLKAILTDPGLAPTTLDP  312

Query  223  VDSK  212
            V+ +
Sbjct  313  VEYR  316



>ref|XP_008465739.1| PREDICTED: chlorophyllase-1-like [Cucumis melo]
Length=326

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 107/180 (59%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC-----PDVLNSTPDYFDLNMP  575
            L GHSRGGK AF+LALG   +  L FSAIIG+DPV GT      P +LN     F ++ P
Sbjct  141  LVGHSRGGKTAFSLALG-WGSPSLPFSAIIGIDPVAGTKYFQPEPHILNPISQPFKISSP  199

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              VIG+GLG  K   ++CPCAP G N+ AF+ KC+      VA DYGH D+L+D+  G +
Sbjct  200  VTVIGTGLGPEKATPVTCPCAPNGFNHVAFFKKCKPTCAHFVAVDYGHMDILNDNPPG-M  258

Query  394  RGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             G  T   CKNG   R  MR    G VVA L+ +L++D++ L  I      AP+EL PVD
Sbjct  259  TGFFTNIACKNGKGPRELMRKCCSGLVVASLKAYLDNDVSFLNAIYVDPSIAPIELNPVD  318



>ref|XP_008787534.1| PREDICTED: chlorophyllase-1 [Phoenix dactylifera]
Length=307

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 104/183 (57%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            L+GHSRGG  AFALALG   T  LKFS ++G+DPV G        P +L   P  F+L +
Sbjct  129  LAGHSRGGHAAFALALGHAETT-LKFSLLMGIDPVAGPSKCCQIPPKILTYEPSSFELEI  187

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +V+G+GLG  +KN+L   CAP G N+  FYS+C+ P    V  DYGH DMLDD     
Sbjct  188  PVLVLGTGLGSEQKNILFPACAPDGVNHKEFYSECKPPCYHFVVTDYGHLDMLDDTAPK-  246

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
                +T C+CKNG   R  MR   GG + AFL+ +L      L  I D  + AP +L PV
Sbjct  247  ----ITKCVCKNGTNCREIMRRTTGGIMTAFLKAYLLDLEEDLKAIADDPQIAPTKLDPV  302

Query  220  DSK  212
              +
Sbjct  303  SYR  305



>ref|XP_010934773.1| PREDICTED: chlorophyllase-1-like [Elaeis guineensis]
Length=307

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 107/183 (58%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            L+GHSRGG  AF+LALG   T  LKFS ++G+DPV G        P +L   P  F+L +
Sbjct  129  LAGHSRGGHAAFSLALGHAET-KLKFSLLMGIDPVAGPSKCCQIPPKILTYKPSSFELEI  187

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +V+G+GLG  +KN+L  PCAP G N+  FY++C+ P   +V  DYGH DML+D     
Sbjct  188  PVLVMGTGLGSEQKNILFPPCAPDGVNHKEFYNECKPPCYHIVVTDYGHLDMLNDTAPK-  246

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
                +T C+CKNG   R  MR   GG + AFL+ +L      L  I+D  + AP +L PV
Sbjct  247  ----ITKCVCKNGTNCREIMRKTTGGIMTAFLKAYLLDLEGDLKAIVDDPQFAPTKLYPV  302

Query  220  DSK  212
              +
Sbjct  303  SYR  305



>ref|XP_002520936.1| Chlorophyllase-1, putative [Ricinus communis]
 gb|EEF41353.1| Chlorophyllase-1, putative [Ricinus communis]
Length=226

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 10/183 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            + GHSRGGK AFALALG   T   +K SA+ GVDPV GT       P +L   P   +L+
Sbjct  41   IGGHSRGGKTAFALALGYAKTPLKVKISALAGVDPVEGTSKNSPTQPKILTYIPQSLNLS  100

Query  580  MPAMVIGSGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  VIG+GLG+     L CP CAP   N+  F+S+C+APA   VA +YGH DML+D+  
Sbjct  101  IPVAVIGTGLGNQPVCWLVCPACAPDEMNHQEFFSECKAPAGHFVATEYGHMDMLNDNMT  160

Query  403  GSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
              + G LT  +CK+    R PMR   GG +VAFL+ + + ++   + I+ +   AP +L 
Sbjct  161  -DIVGTLTNSLCKSSQNPRKPMRRTTGGIIVAFLKAYFKGEIEDYITIVQEPSAAPAKLD  219

Query  226  PVD  218
            PV 
Sbjct  220  PVQ  222



>ref|XP_009376014.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Pyrus x bretschneideri]
Length=124

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 82/115 (71%), Gaps = 1/115 (1%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P  FDL MP MVIGS LG+VK+N+L  PCAPKG N+  F+++C   AC  V
Sbjct  7    TPPPMLTYVPQSFDLEMPVMVIGSRLGEVKRNILFPPCAPKGVNHEDFFNECWKLACYFV  66

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESD  284
            AKDYGH DM DD T+G + G  TYC+CKNG +R PMR FVGG +VAF++ +LE D
Sbjct  67   AKDYGHLDMRDDHTKG-ITGKATYCLCKNGKSRQPMRRFVGGVMVAFIKAYLEGD  120



>gb|EMT19932.1| Chlorophyllase-1 [Aegilops tauschii]
Length=319

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 103/183 (56%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            + GHSRGG  AF+LALG   T  L FSA+IG+DPV GT       P +L   P  F + M
Sbjct  141  VPGHSRGGHTAFSLALGHAKT-QLTFSALIGLDPVAGTGKSSQLQPKILTYEPSSFGMAM  199

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +VIG+GLG+ KKN+   PCAPK  N+A FY +CR P    V KDYGH DMLDDD    
Sbjct  200  PVLVIGTGLGEEKKNIFFPPCAPKDVNHAEFYRECRPPCYYFVTKDYGHLDMLDDDAPKF  259

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +      C+CK+G   +  MR  V G +VAFL   L      L  I+     AP  L PV
Sbjct  260  IT-----CVCKDGNGCKGKMRRCVAGIMVAFLNAALGEKDADLEAILRDPAVAPTTLDPV  314

Query  220  DSK  212
            + +
Sbjct  315  EHR  317



>ref|XP_010256231.1| PREDICTED: chlorophyllase-1-like [Nelumbo nucifera]
Length=441

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 114/181 (63%), Gaps = 9/181 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            L GHSRGGK AFALALG   T+ L FS +IG+DPV G C      P +L   P  F+L +
Sbjct  259  LVGHSRGGKAAFALALGLAPTS-LAFSVLIGLDPVAGKCKGCECPPKILTYQPRSFNLGI  317

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P MVIG+GLG+ +K  L CPCAP   ++  FY + + P   +V  DYGH DMLDD+ +G 
Sbjct  318  PVMVIGTGLGEKRKIKLFCPCAPPQVSHQEFYDESKHPRYHMVTADYGHMDMLDDNCKGI  377

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            L G L+  +CK+G   +  MR  VGG +VAF+R +LE     L GI+D  E APV+L PV
Sbjct  378  L-GTLSSSLCKSGDGDKDLMRRCVGGIIVAFMREYLEVSTGDLKGILDAPEIAPVKLDPV  436

Query  220  D  218
            +
Sbjct  437  E  437



>ref|NP_001064620.1| Os10g0419600 [Oryza sativa Japonica Group]
 gb|AAP53795.2| Chlorophyllase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26534.1| Os10g0419600 [Oryza sativa Japonica Group]
Length=367

 Score =   144 bits (362),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 118/191 (62%), Gaps = 15/191 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG------KTATADLKFSAIIGVDPVGG------TCPDVLN-STP  599
            +SGHSRGGKVAFALALG      +        +A++ VDPV G      T P +L     
Sbjct  170  ISGHSRGGKVAFALALGHANVSLRGGAGGATIAALVAVDPVDGFAAGKQTPPPILTYGGA  229

Query  598  DYFDLNMPAMVIGSGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDM  422
            +   +  P MVIG+GLG + +     P CAP G ++  FY +C APAC LVA+DYGHTDM
Sbjct  230  NSLRVPAPVMVIGTGLGGLARAAPLLPACAPPGVSHGEFYGECAAPACHLVARDYGHTDM  289

Query  421  LDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETA  242
            +DD T G+ RG+ T  +C++G ARAPMR F GGA+VAF++ ++E +   L  +  + ETA
Sbjct  290  MDDVTPGA-RGLATRAVCRSGGARAPMRRFFGGAMVAFVKRWVEGEPELLDCVRARPETA  348

Query  241  PVELQPVDSKD  209
            PV L  V+ +D
Sbjct  349  PVVLSAVEFRD  359



>gb|EMS62705.1| Chlorophyllase-1 [Triticum urartu]
Length=303

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 103/183 (56%), Gaps = 13/183 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            L+GHSRGG  AF+LALG   T  L FSA+IG+DPV GT       P +L   P  F + M
Sbjct  125  LAGHSRGGHTAFSLALGHAKT-QLTFSALIGLDPVAGTGKSSQLQPKILTHEPSSFGMAM  183

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P +V+G+GLG+ KKN+   PCAP+  N+A FY +CR P    V KDYGH DMLDD     
Sbjct  184  PVLVVGTGLGEEKKNIFFPPCAPRDVNHAEFYRECRPPCYYFVTKDYGHLDMLDDGAPKF  243

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +      C+CK+G   +  MR  V G +VAFL   L      L  I+     AP  L PV
Sbjct  244  IT-----CVCKDGNGCKGKMRRCVAGIMVAFLNAALGGKDGDLEAILRDPAVAPTTLDPV  298

Query  220  DSK  212
            + +
Sbjct  299  EHR  301



>ref|XP_003576870.1| PREDICTED: chlorophyllase-1-like [Brachypodium distachyon]
Length=324

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 113/188 (60%), Gaps = 18/188 (10%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN-  581
            L+GHSRGG  AF+LALG  A ++L FSA+IG+DPV GT       P +L   P  F+++ 
Sbjct  141  LAGHSRGGHTAFSLALGH-AKSNLSFSALIGIDPVAGTGKSSQLAPKILTYEPSSFNMSA  199

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIG+GLG+ KKN+ + PCAPK  N+  FY +C+ P    V KDYGH DMLDDD  
Sbjct  200  AMPVLVIGTGLGEEKKNIFTPPCAPKDVNHREFYLECKPPCYYFVTKDYGHLDMLDDDAP  259

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFL---ESDMNPLMGIIDQTETAPV  236
                 M+  C+CK+G + +  MR  V G +VAFL   L   ++  + L  I+     AP 
Sbjct  260  -----MVITCLCKDGGSCKDKMRRCVAGIMVAFLNSALGGKDNAAHDLEVIVKDPALAPT  314

Query  235  ELQPVDSK  212
             L PV+ +
Sbjct  315  TLDPVECR  322



>ref|XP_003565235.1| PREDICTED: chlorophyllase-1-like [Brachypodium distachyon]
Length=324

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 111/188 (59%), Gaps = 18/188 (10%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN-  581
            L+GHSRGG  AF+LALG  A ++L FSA+IG+DPV GT       P +L   P  F+++ 
Sbjct  141  LAGHSRGGHTAFSLALGH-AKSNLSFSALIGIDPVAGTGKSSQLAPKILTYEPSSFNMSA  199

Query  580  -MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
             MP +VIG+GLG+ KKN+ + PCAPK  N+  FY +C+ P    V KDYGH DMLDDD  
Sbjct  200  AMPVLVIGTGLGEEKKNIFTPPCAPKDVNHREFYLECKPPCYYFVTKDYGHLDMLDDDAP  259

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNP---LMGIIDQTETAPV  236
                 M+  C+CK+G + +  MR  V G +VAFL   L    N    L  I+     AP 
Sbjct  260  -----MVITCLCKDGDSCKDKMRRCVAGIMVAFLNSALGGKDNAGHDLEVIVKDPALAPT  314

Query  235  ELQPVDSK  212
             L PV+ +
Sbjct  315  TLDPVECR  322



>ref|XP_008449344.1| PREDICTED: chlorophyllase-1-like [Cucumis melo]
Length=322

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 106/178 (60%), Gaps = 8/178 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT-----CPDVLNSTPDYFDLNMP  575
            L GHSRGGK AF+LALG  +   L FSA+IG+DPV GT      P +L    + F ++ P
Sbjct  137  LVGHSRGGKTAFSLALG-ISRPSLPFSAVIGIDPVAGTKCFQPQPHILTPLSEPFKISAP  195

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              VIG+GLG    + ++CPCAP G N+ AF+ KCR      VA DYGH D+L+D+  G +
Sbjct  196  ITVIGTGLGPKSASPITCPCAPDGFNHVAFFKKCRPTCAHFVAVDYGHMDILNDNPPG-I  254

Query  394  RGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
             G+LT   CKNG   R  MR    G VVA L+ +LE+D + L  I      APV+L P
Sbjct  255  TGLLTNIACKNGKGPRKLMRECCSGLVVASLKAYLENDESFLKAIYVDPSIAPVDLNP  312



>gb|KCW84161.1| hypothetical protein EUGRSUZ_B01023 [Eucalyptus grandis]
Length=267

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 91/127 (72%), Gaps = 8/127 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            ++GHSRGGK AFALALGK+AT   L FSA++G+DPV G      T P VL   P  FDL 
Sbjct  139  VAGHSRGGKAAFALALGKSATPLALPFSALLGIDPVDGMDKGKQTPPPVLTYAPRSFDLG  198

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            MP +V+GSGLG+V+KN L   CAP+G N+A F+++CR PAC  VA+ YGH DMLDD+T G
Sbjct  199  MPVVVVGSGLGEVRKNPLFPACAPRGVNHADFFAECRPPACYFVAEKYGHLDMLDDETEG  258

Query  400  SLRGMLT  380
             LRG  T
Sbjct  259  -LRGKAT  264



>ref|XP_008386540.1| PREDICTED: LOW QUALITY PROTEIN: chlorophyllase-1 [Malus domestica]
Length=360

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 114/190 (60%), Gaps = 14/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            L+G S+GGK AFA ALG   ++  LK S +IG+DPV G      T P +L  +P  F+L+
Sbjct  176  LAGRSKGGKTAFATALGHAKSSLSLKISVLIGIDPVAGADQHCRTYPHILTYSPQSFNLS  235

Query  580  MPAMVIGSGLGDVKKNL-LSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P +VIG+GL    +N  ++ PCAP G N+  F+ +C+ P    V KDYGH DMLDDD +
Sbjct  236  IPVVVIGTGLRPEXQNACMAQPCAPDG-NHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQ  294

Query  403  GSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
            G + G L  CMCKNG   R  MR  VG  VVAFL+ +L  D   L+ I+   + +P +L 
Sbjct  295  G-IVGALLGCMCKNGKGPRELMRKAVGEIVVAFLKAYLNGDDRDLVAIVGDPDISPAKL-  352

Query  226  PVDSKDLVRA  197
              D  + +RA
Sbjct  353  --DHVEFIRA  360



>ref|XP_004143780.1| PREDICTED: chlorophyllase-1-like [Cucumis sativus]
 ref|XP_004170816.1| PREDICTED: chlorophyllase-1-like [Cucumis sativus]
 gb|KGN51166.1| hypothetical protein Csa_5G470560 [Cucumis sativus]
Length=329

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 107/180 (59%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC-----PDVLNSTPDYFDLNMP  575
            L GHSRGGK AF+LALG   +  L FSAIIG+DPV G+      P +L+     F +++P
Sbjct  144  LLGHSRGGKTAFSLALG-WGSPSLPFSAIIGIDPVAGSKFFRPEPQILDPPSQPFKISLP  202

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              V+G+GLG  K   ++C CAP G N+ AF+ KC+      VA +YGH D+LDD+  G +
Sbjct  203  ITVVGTGLGPQKATPVTCACAPDGLNHIAFFKKCKPTCAHFVAVNYGHMDILDDNPPG-M  261

Query  394  RGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
             G  T   CKNG   R  MR    G VVA L+ +L++D++ L  I D    AP EL PV+
Sbjct  262  TGYFTNIACKNGKGPRDLMRKCCSGLVVASLKAYLDNDVSILNAIYDDPSIAPTELNPVE  321



>gb|EMS58425.1| Chlorophyllase-2, chloroplastic [Triticum urartu]
Length=320

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 104/184 (57%), Gaps = 13/184 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG---KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFD  587
            L+GHSRGG+ AFA+ALG        +LKFSA+IGVDPV G        P VL   PD  D
Sbjct  127  LAGHSRGGQTAFAVALGLGDAKTKLELKFSALIGVDPVAGVSRAQQLEPKVLTFEPDCLD  186

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            + MP +V+G+GLG   K++   PCAP G N+A FY +C  P   LV KDYGH DMLDD+ 
Sbjct  187  VGMPVLVMGTGLG--PKHIGGFPCAPVGVNHAEFYKECAPPRYHLVVKDYGHLDMLDDNV  244

Query  406  RGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
               +   +  CM      +   R  +GGA+VAFLR  L  D+  L+ I    E AP  L 
Sbjct  245  PYIINNCM--CMRNQHDTKDLARRTMGGAMVAFLRAKLRIDVRDLITIYRNPEIAPAVLD  302

Query  226  PVDS  215
             VD 
Sbjct  303  QVDE  306



>gb|KDP21408.1| hypothetical protein JCGZ_21879 [Jatropha curcas]
Length=340

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 103/181 (57%), Gaps = 10/181 (6%)
 Frame = -1

Query  733  GHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNMP  575
            GHSRGGK AFALALG       LK  A+  +DPV G      T P      P   DL++P
Sbjct  157  GHSRGGKTAFALALGYANIPLKLKILALAALDPVEGMSKNNPTLPKTFTYLPQSLDLSIP  216

Query  574  AMVIGSGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
              VIG+GLG+     L CP CAP   N+  F+++CRAP    VA +YGH DML+++ +  
Sbjct  217  VTVIGTGLGNQPICWLVCPACAPNEVNHEEFFNECRAPTTHFVAAEYGHMDMLNENIK-D  275

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            L G LT  +CK+  + + PMR  VGG VVAFL+ + E      + I+ +   APV+L PV
Sbjct  276  LVGRLTNSLCKSSQSPKEPMRKTVGGIVVAFLKAYFEGQSGDYLTIVQEPSVAPVKLDPV  335

Query  220  D  218
             
Sbjct  336  Q  336



>ref|XP_002271936.2| PREDICTED: chlorophyllase-1 [Vitis vinifera]
Length=315

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F+L+
Sbjct  125  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNLD  184

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  185  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  244

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  245  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGIVVAMLMAHLEGETGDLDAIVDEPGIAP  304

Query  238  VELQPVDSKD  209
            V+L+ V+  +
Sbjct  305  VKLEVVEDSE  314



>ref|XP_003632330.1| PREDICTED: chlorophyllase-1-like [Vitis vinifera]
Length=315

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F+L+
Sbjct  125  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNLD  184

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  185  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  244

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  245  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDEPGIAP  304

Query  238  VELQPVDSKD  209
            V+L+ ++  +
Sbjct  305  VKLEVMEDSE  314



>gb|EEE50970.1| hypothetical protein OsJ_31546 [Oryza sativa Japonica Group]
Length=356

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 106/178 (60%), Gaps = 17/178 (10%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIG  560
            +SGHSRGGKVAFALALG                      P +     +   L  P MVIG
Sbjct  187  ISGHSRGGKVAFALALGHANQTPR---------------PILTYGGANSLRLPAPVMVIG  231

Query  559  SGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGML  383
            +GLG + +     P CAP G ++  FY +C APAC LVA+DYGHTDM+DD T G+ RG+ 
Sbjct  232  TGLGGLARAAPLLPACAPPGVSHGEFYGECAAPACHLVARDYGHTDMMDDVTPGA-RGLA  290

Query  382  TYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVDSKD  209
            T  +C++G ARAPMR F GGA+VAF++ ++E +   L  +  + ETAPV L  V+ +D
Sbjct  291  TRAVCRSGGARAPMRRFFGGAMVAFVKRWVEGEPELLDCVRARPETAPVVLSAVEFRD  348



>ref|XP_002273956.1| PREDICTED: chlorophyllase-1-like [Vitis vinifera]
Length=315

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 109/190 (57%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F L+
Sbjct  125  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFILD  184

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  185  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  244

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  245  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDEPGIAP  304

Query  238  VELQPVDSKD  209
            V+L+ ++  +
Sbjct  305  VKLEVMEDSE  314



>emb|CBI28744.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 110/190 (58%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F+L+
Sbjct  401  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNLD  460

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  461  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  520

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  521  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGIVVAMLMAHLEGETGDLDAIVDEPGIAP  580

Query  238  VELQPVDSKD  209
            V+L+ V+  +
Sbjct  581  VKLEVVEDSE  590


 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            LSGHSRGGK AFALALG   T+ L FSA++G+DPVGG      T P +L   P  F+L +
Sbjct  137  LSGHSRGGKTAFALALGYADTS-LNFSALLGLDPVGGLSKCCQTVPKILTYVPHSFNLAI  195

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GLGD  +N L+CPCAP G N+  F+S+C+ P    V  +YGH DMLDD   G 
Sbjct  196  PVCVIGTGLGDEPRNCLTCPCAPDGVNHVEFFSECKPPCSHFVTTEYGHLDMLDDHLSGC  255

Query  397  L  395
            +
Sbjct  256  I  256



>gb|EYU46277.1| hypothetical protein MIMGU_mgv1a022687mg [Erythranthe guttata]
Length=310

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 107/180 (59%), Gaps = 13/180 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCP------DVLNSTPDYFDLNM  578
            + GHSRGGK+AFALALG   T+ LKF A+ G+DPV G  P      ++L+  P  F L++
Sbjct  132  IMGHSRGGKIAFALALGHAPTS-LKFKALFGLDPVSGPTPPTWVEPNILSYVPHSFKLSI  190

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GL +   N +  P AP G N++ F+++ R P C  +AKDYGH D L+D   G 
Sbjct  191  PIGVIGTGLSNRTNNYVFPPLAPNGFNHSEFFNESRPPCCYFLAKDYGHCDFLNDSKTG-  249

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            L G+    +C++G  ++  MR  VGG VVAFL  +L      L  I+   + AP+ L PV
Sbjct  250  LAGL----VCRSGKGSKEKMRRGVGGIVVAFLNAYLGGGFEDLENIVAAPDIAPITLDPV  305



>ref|XP_009760775.1| PREDICTED: chlorophyllase-1-like [Nicotiana sylvestris]
Length=304

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 104/182 (57%), Gaps = 16/182 (9%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNM  578
            +SGHSRGGK+AFALALG      +KF A++G+DPV G      + P +L   P  FD  +
Sbjct  130  VSGHSRGGKIAFALALG----YGIKFQALLGIDPVAGFSPSNRSAPKILKYIPRIFDQTV  185

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GL +   N +  P AP G N++ F+++ + P C  +AK+YGHTDMLDD     
Sbjct  186  PVAVIGAGLSNQSANCIFPPFAPNGVNHSEFFNESKPPCCYFLAKNYGHTDMLDDRI---  242

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
                +   + K+G   +  MR  VGG VVAFL   L   ++ L  I+ +   AP+ L PV
Sbjct  243  --AAIASWISKSGKGPKDLMRKAVGGIVVAFLEAKLGEKVDNLNAIVQEPSLAPIILDPV  300

Query  220  DS  215
             S
Sbjct  301  IS  302



>ref|XP_011090376.1| PREDICTED: chlorophyllase-1-like [Sesamum indicum]
Length=331

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 108/200 (54%), Gaps = 32/200 (16%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLK--------------------FSAIIGVDPVGGTCP  620
            L+GHSRGGK AFALALG+T     K                    F A+IGVDPV G+ P
Sbjct  132  LAGHSRGGKTAFALALGRTEQKSRKKKAQSIRDVVIDVDVSQPSKFKAVIGVDPVAGSSP  191

Query  619  ------DVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPAC  458
                   +L   P  F++++P  VIG+G G+    +L  PCAP G N++ F+++ + P C
Sbjct  192  SDRPPPQILEYIPRCFNMSIPVAVIGTGYGNQSVGILRPPCAPDGVNHSEFFNESKPPVC  251

Query  457  CLVAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDM  281
              +AKDYGH DMLDD        M++Y +CK+G   +  MR  +GG VVA L+ +L    
Sbjct  252  YFLAKDYGHCDMLDD----WYANMMSY-VCKSGKGPKDLMRKSIGGIVVAVLKSYLGGSD  306

Query  280  NPLMGIIDQTETAPVELQPV  221
            + L  I+    TAP  L PV
Sbjct  307  DALNAIVHDPTTAPTTLDPV  326



>gb|EYU43828.1| hypothetical protein MIMGU_mgv1a009904mg [Erythranthe guttata]
Length=328

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 113/204 (55%), Gaps = 16/204 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLNM  578
            LSGHSRGGK AFALAL  TA    KF A+IG+DPV G+       P +L   P  F +  
Sbjct  129  LSGHSRGGKTAFALALASTAPPQ-KFKAVIGIDPVAGSGPSMRSAPKILEYIPRSFGITT  187

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  V+G+G G+ +  L+  P AP G N++ F+++ + P C  +AKDYGH DMLDD     
Sbjct  188  PVAVVGTGYGNQRLGLIP-PFAPNGVNHSEFFNESKPPVCYFLAKDYGHCDMLDD-----  241

Query  397  LRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
                L   +CK+G   R  MR  VGG VVAFLR +L  D + L GI+     AP+   PV
Sbjct  242  WIAKLASFVCKSGGGDRDLMRRGVGGIVVAFLRCYLGGDGD-LNGIVGDPSVAPITFDPV  300

Query  220  DS-KDLVRA*VACYCK*MELKVVC  152
               K+  +  +  +C  + LK V 
Sbjct  301  IYVKEQKKKKITIWCYVIVLKDVV  324



>ref|XP_009777296.1| PREDICTED: chlorophyllase-1-like isoform X2 [Nicotiana sylvestris]
Length=256

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (57%), Gaps = 17/187 (9%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGGT------CPDVLNSTPDY  593
            +SGHSRGGK AF+LALG      +    +KF A++G+DPV G+       P +L   P  
Sbjct  73   VSGHSRGGKTAFSLALGYGDLSSSTPTPIKFQALLGIDPVAGSSPSSQSAPKILQYIPRN  132

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            FD  +P  VIG+GL + + + +  P AP G N++ F+++C+ P    +AKDYGHTD+LDD
Sbjct  133  FDQTVPVAVIGAGLSNQRAHYIFPPFAPNGVNHSEFFNECKPPCYYFLAKDYGHTDILDD  192

Query  412  DTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPV  236
                     +   + K+G  ++  MR  VGG VVAFL   L   ++ L  I+ +   AP+
Sbjct  193  KI-----AAIASLVAKSGKGSKDLMRKAVGGIVVAFLEAKLGGKVDNLNAIVQEPSLAPI  247

Query  235  ELQPVDS  215
             L PV S
Sbjct  248  TLDPVIS  254



>emb|CAN82816.1| hypothetical protein VITISV_044164 [Vitis vinifera]
Length=315

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 107/190 (56%), Gaps = 13/190 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALA G    + +LKF  +IG+DPV G       CP +L   P  F+L+
Sbjct  125  LAGHSRGGYLAFALAXGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNLD  184

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+         DYGH DMLD D  
Sbjct  185  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFXIPDYGHMDMLDXDYC  244

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAP  239
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+   AP
Sbjct  245  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDEPGIAP  304

Query  238  VELQPVDSKD  209
            V+L+ V+  +
Sbjct  305  VKLEVVEDSE  314



>ref|XP_009777295.1| PREDICTED: chlorophyllase-1-like isoform X1 [Nicotiana sylvestris]
Length=318

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (57%), Gaps = 17/187 (9%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----KTATADLKFSAIIGVDPVGGT------CPDVLNSTPDY  593
            +SGHSRGGK AF+LALG      +    +KF A++G+DPV G+       P +L   P  
Sbjct  135  VSGHSRGGKTAFSLALGYGDLSSSTPTPIKFQALLGIDPVAGSSPSSQSAPKILQYIPRN  194

Query  592  FDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
            FD  +P  VIG+GL + + + +  P AP G N++ F+++C+ P    +AKDYGHTD+LDD
Sbjct  195  FDQTVPVAVIGAGLSNQRAHYIFPPFAPNGVNHSEFFNECKPPCYYFLAKDYGHTDILDD  254

Query  412  DTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPV  236
                     +   + K+G  ++  MR  VGG VVAFL   L   ++ L  I+ +   AP+
Sbjct  255  KI-----AAIASLVAKSGKGSKDLMRKAVGGIVVAFLEAKLGGKVDNLNAIVQEPSLAPI  309

Query  235  ELQPVDS  215
             L PV S
Sbjct  310  TLDPVIS  316



>gb|EMT11146.1| Chlorophyllase-2, chloroplastic [Aegilops tauschii]
Length=226

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 87/126 (69%), Gaps = 1/126 (1%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+   +  P MVIG+GLG++ +N L  PCAP G ++A FY +C APAC LV
Sbjct  87   TPPPILAYKPNALRVPAPVMVIGTGLGELPRNALFPPCAPLGVSHAEFYDECAAPACHLV  146

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLM  269
            A+DYGHTDM+DD T G+ +G+ T  +CK+G ARAPMR FV GA+VAFL+ +++     L 
Sbjct  147  ARDYGHTDMMDDVTTGA-KGLATRALCKSGGARAPMRRFVAGAMVAFLKKWVQGKPEWLD  205

Query  268  GIIDQT  251
             I +QT
Sbjct  206  AIREQT  211



>ref|XP_009791851.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Nicotiana sylvestris]
Length=327

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 113/192 (59%), Gaps = 22/192 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK--TATAD-------LKFSAIIGVDPVGGTC------PDVLNS  605
            +SGHSRGGK AFALALG   ++T++       LK SA++G+DPV G+       P++L  
Sbjct  138  VSGHSRGGKTAFALALGHGGSSTSNATQLEPPLKISALLGIDPVAGSSLSCLCSPNILQF  197

Query  604  TPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTD  425
             P  FD ++P  VIGSGL + +   +  P AP G N+A F+++ + P    +AKDYGH D
Sbjct  198  IPYSFDQSIPVAVIGSGLSNQRAFGVCPPGAPNGVNHAEFFNESKPPCYYFLAKDYGHLD  257

Query  424  MLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTE  248
            MLDD T       L   M K+G A +  MR  VGG  VAFL+ +L+   + L+ I++  +
Sbjct  258  MLDDGT-----AALISWMTKSGKASKDTMRRTVGGLFVAFLKAYLDGQADDLINIVESPK  312

Query  247  T-APVELQPVDS  215
              AP+ L PV S
Sbjct  313  IRAPITLDPVIS  324



>ref|XP_002444588.1| hypothetical protein SORBIDRAFT_07g024090 [Sorghum bicolor]
 gb|EES14083.1| hypothetical protein SORBIDRAFT_07g024090 [Sorghum bicolor]
Length=338

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 108/192 (56%), Gaps = 22/192 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG------KTATADLKFSAIIGVDPVGGTC------PDVLNSTPD  596
            L+GHSRGG  AFA+ALG       + T  LKFSA+IGVDPV G        P VL   P 
Sbjct  134  LAGHSRGGDTAFAVALGLGSSSSSSDTTPLKFSALIGVDPVAGLSKELQLEPKVLTFEPR  193

Query  595  YFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLD  416
              D  MPA+V+G+GLG   K LL  PCAP G ++  FY +C  P   +V +DYGH DMLD
Sbjct  194  SLDPGMPALVVGTGLG--PKGLL--PCAPAGVSHGEFYDECAPPRYHVVVRDYGHLDMLD  249

Query  415  DDTRGSLRGMLTYCMCK--NGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTE-T  245
            DD    +  +++ CMCK      +   R  +GGA+VAFLR  LE D   L  ++  +   
Sbjct  250  DD---GVPYVISNCMCKRNTNTTKDLARRAIGGAMVAFLRAKLEDDDEDLRAVLQNSPGL  306

Query  244  APVELQPVDSKD  209
            +P  L PV+  D
Sbjct  307  SPAVLDPVEYDD  318



>emb|CBI28739.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 101/175 (58%), Gaps = 13/175 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGK-TATADLKFSAIIGVDPVGGT------CPDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + +LKF  +IG+DPV G       CP +L   P  F+L+
Sbjct  125  LAGHSRGGYLAFALALGNANVSMNLKFLTLIGIDPVAGANKCMKMCPKILTGVPHSFNLD  184

Query  580  MPAMVIGSGLG-DVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD--  410
            +P MVIG+GLG +     + C CAP G NYA F+++C+      V  DYGH DMLDDD  
Sbjct  185  IPVMVIGTGLGGESVIGCIPCSCAPDGLNYAEFFNECKDNCLGFVIPDYGHMDMLDDDYC  244

Query  409  --TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQ  254
                G+  G +   MCK+G   +  M   VGG VVA L   LE +   L  I+D+
Sbjct  245  TNCIGTSIGAIMGSMCKSGKGDKTSMMECVGGLVVAMLMAHLEGETGDLDAIVDE  299



>ref|XP_002963743.1| hypothetical protein SELMODRAFT_66990, partial [Selaginella moellendorffii]
 gb|EFJ35614.1| hypothetical protein SELMODRAFT_66990, partial [Selaginella moellendorffii]
Length=250

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 93/153 (61%), Gaps = 8/153 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            ++GHSRGGKVAF+LALG +  +   + SA+I +DPV GT       P VL    D    N
Sbjct  98   IAGHSRGGKVAFSLALGFSKRSLPSRVSALIALDPVDGTSSASQTNPPVLRYRKDSLQPN  157

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
             P ++I +G G  KKN L   CAP+G    AF+  C APA  L A ++GH D LDD T G
Sbjct  158  CPVLIIAAGYGGEKKNFLFPACAPRGVGPQAFFRDCCAPAFLLSAPEHGHFDFLDDATSG  217

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLR  302
             L+G LT  + KNG AR PMR F  GA+VAFL+
Sbjct  218  -LKGGLTSLVGKNGKARKPMRIFTAGAIVAFLQ  249



>ref|XP_006388207.1| hypothetical protein POPTR_0284s00200g [Populus trichocarpa]
 gb|ERP47121.1| hypothetical protein POPTR_0284s00200g [Populus trichocarpa]
Length=370

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 106/192 (55%), Gaps = 22/192 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + D+ FSA+IGVDPV GT       P +LN     F+ +
Sbjct  160  LAGHSRGGYIAFALALGLADVSLDVDFSALIGVDPVAGTSKTNQMEPKILNYESCSFNFS  219

Query  580  MPAMVIGSGLGDVKKNLLSCP-----CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLD  416
            +P  +IG+GLG    N  +CP     CAP G ++   +++C+ P    V  DYGH D+LD
Sbjct  220  IPVAIIGTGLG----NKPACPIIRQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLD  275

Query  415  DDTRGSLRGMLTYCMCK---NGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTET  245
            DD    L G     MCK    G +R PMR  VGG  VAFL  F + +      I+ ++  
Sbjct  276  DDI--GLIGEGARAMCKGSRRGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQKSNY  333

Query  244  -APVELQPVDSK  212
             AP  L PV +K
Sbjct  334  FAPTTLDPVQNK  345



>ref|XP_002974826.1| hypothetical protein SELMODRAFT_57004, partial [Selaginella moellendorffii]
 gb|EFJ24346.1| hypothetical protein SELMODRAFT_57004, partial [Selaginella moellendorffii]
Length=250

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 93/153 (61%), Gaps = 8/153 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            ++GHSRGGKVAF+LALG +  +   + SA+I +DPV GT       P VL    D    N
Sbjct  98   IAGHSRGGKVAFSLALGFSKRSLPSRVSALIALDPVDGTSSASQTNPPVLRYRKDSLQPN  157

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
             P ++I +G G  KKN L   CAP+G    AF+  C APA  L A ++GH D LDD T G
Sbjct  158  CPVLIIAAGYGGEKKNFLFPACAPRGVGPLAFFRDCCAPAFLLSAPEHGHFDFLDDATSG  217

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLR  302
             L+G LT  + KNG AR PMR F  GA+VAFL+
Sbjct  218  -LKGGLTSLVGKNGKARKPMRIFTAGAIVAFLQ  249



>ref|XP_003572503.1| PREDICTED: chlorophyllase type 0-like [Brachypodium distachyon]
Length=306

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 99/185 (54%), Gaps = 21/185 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG----KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYF  590
            L+GHSRGG  AF++ALG    KT  A LK SA+IG++PV G        P VL   P   
Sbjct  131  LAGHSRGGDTAFSVALGLGDAKTKLA-LKLSALIGIEPVAGASKDHQMEPKVLTFKPQSL  189

Query  589  DLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            D+ MP MV+G+G         +CPCAP   N+A FY +C+ P   LV KDYGH DM+DD 
Sbjct  190  DVGMPVMVLGTGK--------TCPCAPDHVNHAEFYDECKPPRYHLVVKDYGHLDMVDDH  241

Query  409  TRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
                   +   C   +      +R  +GGA+VAF+R  ++     L  I+   + AP  L
Sbjct  242  VLMFFHNLA--CQANSDDTNGLVRRTMGGAMVAFMRATMDHKDEDLNAILADKQLAPATL  299

Query  229  QPVDS  215
            +PV+ 
Sbjct  300  EPVEH  304



>ref|XP_010326402.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X2 [Solanum 
lycopersicum]
Length=301

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 12/182 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPD------VLNSTPDYFDLNM  578
            +SGHS+GG  AFA+AL   ++  LKFSA++G+DPV G  P       VL   P  F+ ++
Sbjct  122  ISGHSKGGNTAFAVAL--DSSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  179

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GL +     L    AP G N+A F+++ + P    +AKDYGH DML  D    
Sbjct  180  PVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNESKPPCYYFLAKDYGHADMLQAD---G  236

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +L   M K+G  ++  MR  VGG VVAFL+ +LE  ++ L  I+     AP+ L PV
Sbjct  237  IMAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIVKSPNLAPIILDPV  296

Query  220  DS  215
             S
Sbjct  297  IS  298



>ref|XP_004247197.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X1 [Solanum 
lycopersicum]
Length=307

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 104/182 (57%), Gaps = 12/182 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPD------VLNSTPDYFDLNM  578
            +SGHS+GG  AFA+AL   ++  LKFSA++G+DPV G  P       VL   P  F+ ++
Sbjct  128  ISGHSKGGNTAFAVAL--DSSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  185

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GL +     L    AP G N+A F+++ + P    +AKDYGH DML  D    
Sbjct  186  PVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNESKPPCYYFLAKDYGHADMLQAD---G  242

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +L   M K+G  ++  MR  VGG VVAFL+ +LE  ++ L  I+     AP+ L PV
Sbjct  243  IMAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIVKSPNLAPIILDPV  302

Query  220  DS  215
             S
Sbjct  303  IS  304



>ref|XP_002306793.2| hypothetical protein POPTR_0005s23590g [Populus trichocarpa]
 gb|EEE93789.2| hypothetical protein POPTR_0005s23590g [Populus trichocarpa]
Length=362

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 104/188 (55%), Gaps = 14/188 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + D+ FSA+IGVDPV GT       P +LN     F+ +
Sbjct  160  LAGHSRGGYIAFALALGLADVSLDVDFSALIGVDPVAGTSKTNQMEPKILNYESCSFNFS  219

Query  580  MPAMVIGSGLGDVKK-NLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  +IG+GLG+     +L   CAP G ++   +++C+ P    V  DYGH D+LDDD  
Sbjct  220  IPVAIIGTGLGNKPAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLDDDI-  278

Query  403  GSLRGMLTYCMCKN---GPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTET-APV  236
              L G     MCK    G +R PMR  VGG  VAFL  F + +      I+ +    AP 
Sbjct  279  -GLIGEGARAMCKGSRWGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQKPNYFAPA  337

Query  235  ELQPVDSK  212
             L PV +K
Sbjct  338  TLDPVQNK  345



>gb|ACI06105.1| chlorophyllase [Citrus limon]
Length=329

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 104/183 (57%), Gaps = 18/183 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNMPA  572
            GHSRGG+ AFAL+L         F A+IG+DPV GT       P +L+   D FD ++P 
Sbjct  145  GHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIPV  196

Query  571  MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDDTRGSL  395
             VIG+GLG V + + +C  AP+G+N+  F+++C+ +     VA DYGH D+LDD+     
Sbjct  197  TVIGTGLGGVARCITAC--APEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVK  254

Query  394  RGMLTYCMCKNG-PARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
               L+   CKNG  +R PMR  V G VVAFL+ F + D      I+     AP++L  V+
Sbjct  255  SWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFDGDAEDFRQILKDPSFAPIKLDSVE  314

Query  217  SKD  209
              D
Sbjct  315  YMD  317



>ref|XP_009588380.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Nicotiana tomentosiformis]
Length=316

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 108/194 (56%), Gaps = 22/194 (11%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG----KTATAD-----LKFSAIIGVDPVGGTC------PDVLNS  605
            +SGHS GGK AFALALG     T+ A      LK SA++G+DPV G+       P++L  
Sbjct  127  VSGHSSGGKTAFALALGYGGSSTSNATQLEPGLKISALLGIDPVAGSSTSCLCSPNILQF  186

Query  604  TPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTD  425
             P  FD ++P  VIG GL + +   +  P AP G N+A F+++ + P    +AKDYGH D
Sbjct  187  IPYSFDQSIPVAVIGGGLSNQRALGMCPPGAPNGVNHAEFFNESKPPCYYFLAKDYGHLD  246

Query  424  MLDDDTRGSLRGMLTYCMCKNGPARA-PMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTE  248
            MLDD T       L+  M K+G      MR  VGG  VAFL+ +LE   + L+ I++   
Sbjct  247  MLDDGTAS-----LSRWMMKSGKGSTDTMRRTVGGLFVAFLKAYLEGQADDLINIVESPN  301

Query  247  T-APVELQPVDSKD  209
              AP+ L PV S +
Sbjct  302  IRAPITLDPVISIE  315



>sp|Q94LX1.1|CLH1_CITUN RecName: Full=Chlorophyllase-1, chloroplastic; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; Flags: 
Precursor [Citrus unshiu]
 dbj|BAB47176.1| chlorophyllase [Citrus unshiu]
Length=329

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 104/183 (57%), Gaps = 18/183 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNMPA  572
            GHSRGG+ AFAL+L         F A+IG+DPV GT       P +L+   D FD ++P 
Sbjct  145  GHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIPV  196

Query  571  MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDDTRGSL  395
             VIG+GLG V + + +C  AP+G+N+  F+++C+ +     VA DYGH D+LDD+     
Sbjct  197  TVIGTGLGGVARCITAC--APEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVK  254

Query  394  RGMLTYCMCKNG-PARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
               L+   CKNG  +R PMR  V G VVAFL+ F + D      I+     AP++L  V+
Sbjct  255  SWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFDGDAEDFRQILKDPSFAPIKLDSVE  314

Query  217  SKD  209
              D
Sbjct  315  YID  317



>ref|NP_001169192.1| uncharacterized protein LOC100383045 [Zea mays]
 gb|ACN31905.1| unknown [Zea mays]
Length=299

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 104/199 (52%), Gaps = 31/199 (16%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----------------KTATADLKFSAIIGVDPVGGTC----  623
            L+GHSRGG  AFA+ALG                   A   LKFSA+IGVDPV G      
Sbjct  101  LAGHSRGGDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDPVAGLSKQAQ  160

Query  622  --PDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
              P VL   P   D  MPA+V+G+GLG   K++   PCAP G N+A FY +C  P   +V
Sbjct  161  VEPKVLTFRPRSLDPGMPALVVGTGLG--PKHVGGPPCAPAGVNHAEFYDECAPPRYHVV  218

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP--ARAPMRAFVGGAVVAFLRGFLESDMNP  275
             +DYGH DMLDDD    +  ++  CMC       +   R  +GGAVVAFLR  LE D   
Sbjct  219  LRDYGHMDMLDDD---GVPYVINNCMCMRNTKDTKDLARRAIGGAVVAFLRATLEDDDED  275

Query  274  LMGIIDQTE-TAPVELQPV  221
            L  +++     +P  L PV
Sbjct  276  LKVVLENRPGLSPAVLDPV  294



>gb|ACN32030.1| unknown [Zea mays]
 tpg|DAA48626.1| TPA: hypothetical protein ZEAMMB73_996983 [Zea mays]
Length=333

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 104/199 (52%), Gaps = 31/199 (16%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----------------KTATADLKFSAIIGVDPVGGTC----  623
            L+GHSRGG  AFA+ALG                   A   LKFSA+IGVDPV G      
Sbjct  135  LAGHSRGGDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDPVAGLSKQAQ  194

Query  622  --PDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
              P VL   P   D  MPA+V+G+GLG   K++   PCAP G N+A FY +C  P   +V
Sbjct  195  VEPKVLTFRPRSLDPGMPALVVGTGLG--PKHVGGPPCAPAGVNHAEFYDECAPPRYHVV  252

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP--ARAPMRAFVGGAVVAFLRGFLESDMNP  275
             +DYGH DMLDDD    +  ++  CMC       +   R  +GGAVVAFLR  LE D   
Sbjct  253  LRDYGHMDMLDDD---GVPYVINNCMCMRNTKDTKDLARRAIGGAVVAFLRATLEDDDED  309

Query  274  LMGIIDQTE-TAPVELQPV  221
            L  +++     +P  L PV
Sbjct  310  LKVVLENRPGLSPAVLDPV  328



>ref|NP_001275819.1| chlorophyllase-1, chloroplastic [Citrus sinensis]
 sp|Q9MV14.1|CLH1_CITSI RecName: Full=Chlorophyllase-1, chloroplastic; AltName: Full=Chlorophyll-chlorophyllido 
hydrolase 1; Short=Chlase 1; Flags: 
Precursor [Citrus sinensis]
 gb|AAF59834.1|AF160869_1 chloroplast chlorophyllase [Citrus sinensis]
 gb|KDO68641.1| hypothetical protein CISIN_1g020199mg [Citrus sinensis]
Length=329

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 103/183 (56%), Gaps = 18/183 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNMPA  572
            GHSRGG+ AFAL+L         F A+IG+DPV GT       P +L+   D FD ++P 
Sbjct  145  GHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIPV  196

Query  571  MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDDTRGSL  395
             VIG+GLG V + + +C  AP+G+N+  F+++C+ +     VA DYGH D+LDD+     
Sbjct  197  TVIGTGLGGVARCITAC--APEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVK  254

Query  394  RGMLTYCMCKNG-PARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
               L+   CKNG  +R PMR  V G VVAFL+ F   D      I+     AP++L  V+
Sbjct  255  SWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQILKDPSFAPIKLDSVE  314

Query  217  SKD  209
              D
Sbjct  315  YID  317



>ref|XP_006443995.1| hypothetical protein CICLE_v10021103mg [Citrus clementina]
 gb|ESR57235.1| hypothetical protein CICLE_v10021103mg [Citrus clementina]
Length=329

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 103/183 (56%), Gaps = 18/183 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNMPA  572
            GHSRGG+ AFAL+L         F A+IG+DPV GT       P +L+   D FD ++P 
Sbjct  145  GHSRGGQTAFALSL------RYGFGAVIGLDPVAGTSKTTGLDPSILSF--DSFDFSIPV  196

Query  571  MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDDTRGSL  395
             VIG+GLG V + + +C  AP+G+N+  F+++C+ +     VA DYGH D+LDD+     
Sbjct  197  TVIGTGLGGVARCITAC--APEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVK  254

Query  394  RGMLTYCMCKNG-PARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
               L+   CKNG  +R PMR  V G VVAFL+ F   D      I+     AP++L  V+
Sbjct  255  SWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQILKDPSFAPIKLDSVE  314

Query  217  SKD  209
              D
Sbjct  315  YID  317



>ref|XP_006441463.1| hypothetical protein CICLE_v10021095mg [Citrus clementina]
 gb|ESR54703.1| hypothetical protein CICLE_v10021095mg [Citrus clementina]
Length=329

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 102/192 (53%), Gaps = 15/192 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT--ADLKFSAIIGVDPVGGTC-------PDVLNSTPDYFD  587
            L GHSRGG +AF LALG        +K SA++G+DPV G         P +L+   D F+
Sbjct  140  LMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFE  197

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDD  410
             ++P  VIG+GLG V K +   PCAP+  N+  F+ +C  +      AKDYGH D+LDD+
Sbjct  198  FSIPVTVIGTGLGGVTKCMQ--PCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDN  255

Query  409  TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
             +G     ++  +C NG   R PMR  V G   AFL+ + + D      ++     AP+E
Sbjct  256  PQGPKNWAISKLLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIE  315

Query  232  LQPVDSKDLVRA  197
            L  V+     RA
Sbjct  316  LDEVEFIPAARA  327



>ref|XP_006494924.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Citrus sinensis]
Length=344

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 102/192 (53%), Gaps = 15/192 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT--ADLKFSAIIGVDPVGGTC-------PDVLNSTPDYFD  587
            L GHSRGG +AF LALG        +K SA++G+DPV G         P +L+   D F+
Sbjct  155  LMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFE  212

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDD  410
             ++P  VIG+GLG V K +   PCAP+  N+  F+ +C  +      AKDYGH D+LDD+
Sbjct  213  FSIPVTVIGTGLGGVTKCMQ--PCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDN  270

Query  409  TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
             +G     ++  +C NG   R PMR  V G   AFL+ + + D      ++     AP+E
Sbjct  271  PQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIE  330

Query  232  LQPVDSKDLVRA  197
            L  V+     RA
Sbjct  331  LDEVEFIPAARA  342



>ref|XP_006478133.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Citrus sinensis]
 gb|KDO40785.1| hypothetical protein CISIN_1g020188mg [Citrus sinensis]
Length=329

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 102/192 (53%), Gaps = 15/192 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTAT--ADLKFSAIIGVDPVGGTC-------PDVLNSTPDYFD  587
            L GHSRGG +AF LALG        +K SA++G+DPV G         P +L+   D F+
Sbjct  140  LMGHSRGGLIAFGLALGYATNPPVSIKISALVGIDPVAGLASVHSELEPPILSH--DSFE  197

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR-APACCLVAKDYGHTDMLDDD  410
             ++P  VIG+GLG V K +   PCAP+  N+  F+ +C  +      AKDYGH D+LDD+
Sbjct  198  FSIPVTVIGTGLGGVTKCMQ--PCAPENKNHEQFFKRCTYSDHAHFDAKDYGHMDILDDN  255

Query  409  TRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
             +G     ++  +C NG   R PMR  V G   AFL+ + + D      ++     AP+E
Sbjct  256  PQGPKNWAISKFLCTNGKKPRDPMRRCVAGIAAAFLKAYFDGDCEDFRTMLKDPSLAPIE  315

Query  232  LQPVDSKDLVRA  197
            L  V+     RA
Sbjct  316  LDEVEFIPAARA  327



>sp|Q9LE89.1|CLH0_CHEAL RecName: Full=Chlorophyllase type 0; AltName: Full=CaCLH0; AltName: 
Full=Chlorophyll-chlorophyllido hydrolase 0; Short=Chlase 
0; Flags: Precursor [Chenopodium album]
 gb|AAF27045.1|AF134301_1 CaCLH [Chenopodium album]
 dbj|BAA93635.1| chlorophyllase [Chenopodium album]
Length=347

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 94/177 (53%), Gaps = 12/177 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGK AFALALG      D+ FSA+IGVDPV G      T P VL   P+ F+L+
Sbjct  158  ISGHSRGGKSAFALALGFSNIKLDVTFSALIGVDPVAGRSVDDRTLPHVLTYKPNSFNLS  217

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +P  VIGSGLG+      +  CAP   ++  FY +C+  +   V   YGH DML++    
Sbjct  218  IPVTVIGSGLGN-----HTISCAPNHVSHQQFYDECKENSSHFVITKYGHMDMLNEFRLS  272

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
             +   ++    ++   +A MR  +GG +VAFL  +   D      II     AP  L
Sbjct  273  PIAVTMSLMCAQSFRPKATMRRTLGGIMVAFLNAYFRDDGRQYYAIIANRSLAPTNL  329



>ref|XP_011032645.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Populus euphratica]
Length=362

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + D+  SA+IGVDPV GT       P +LN     F+ +
Sbjct  160  LAGHSRGGYIAFALALGLADVSLDINISALIGVDPVVGTSKNNQMEPKILNYESCSFNFS  219

Query  580  MPAMVIGSGLGDVKK-NLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  +IG+GLG+     +L   CAP G ++   +++C+ P    V  DYGH D+LDDD  
Sbjct  220  IPVTIIGTGLGNEPAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTTDYGHMDVLDDDI-  278

Query  403  GSLRGMLTYCMCKN---GPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTET-APV  236
              L G     +CK    G +R PMR  VGG  VAFL  F + +      I+      +P 
Sbjct  279  -GLIGEGARAICKGSWWGVSRDPMRRTVGGVSVAFLEAFFKGNYTDYNKILQNPNYFSPA  337

Query  235  ELQPVDSK  212
             L PV +K
Sbjct  338  TLDPVQNK  345



>ref|XP_006838962.1| hypothetical protein AMTR_s00002p00271040 [Amborella trichopoda]
 gb|ERN01531.1| hypothetical protein AMTR_s00002p00271040 [Amborella trichopoda]
Length=248

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 75/113 (66%), Gaps = 3/113 (3%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIG  560
            ++GHSRGGK+AFALAL       L +SA++ +DPV GT P +L +  +     MP +V+G
Sbjct  122  IAGHSRGGKIAFALALD---LKTLTYSALLTIDPVEGTSPHILTNMHNSLSTGMPVLVVG  178

Query  559  SGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            SGLG VKK L+   CAP GSN   F+ +C++PAC  +  DYGH DM +D+T G
Sbjct  179  SGLGQVKKCLICLACAPVGSNRTDFFEECQSPACYFLPSDYGHIDMFNDETEG  231



>ref|XP_006349715.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=293

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 104/182 (57%), Gaps = 12/182 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNM  578
            +SGHS+GG  AFA+A    ++  LKFSA++G++PV GT       P VL   P  F+ ++
Sbjct  114  ISGHSKGGNTAFAVAFD--SSMPLKFSALLGIEPVAGTSTSCLCPPYVLEYIPRIFNQSI  171

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  V+G+GL +     L    AP G N+A F+++ + P    +AKDYGH DML+ +    
Sbjct  172  PVAVLGAGLSNQSTCCLLQSVAPNGVNHAEFFNESKPPCYYFMAKDYGHADMLEAE---G  228

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +L   + K+G  ++  M   VGG VVAFL+ +LE  ++ L  I+     AP+ L PV
Sbjct  229  IMAILIRILMKSGKGSKDSMIRAVGGIVVAFLKAYLEGQIDDLNDIVKSPNLAPITLDPV  288

Query  220  DS  215
             S
Sbjct  289  IS  290



>ref|XP_002978190.1| hypothetical protein SELMODRAFT_176680 [Selaginella moellendorffii]
 gb|EFJ20847.1| hypothetical protein SELMODRAFT_176680 [Selaginella moellendorffii]
Length=316

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 97/175 (55%), Gaps = 18/175 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDP-----VGGTCPDVLNSTPDYFDLNMPAM  569
            GHS+GGK+AFALAL   A   + F+ ++G+DP     +G T P VL + P  F    P++
Sbjct  148  GHSKGGKIAFALALNIKANVSVPFATLVGLDPMDGTRLGQTQPRVLYNAPIVF--QYPSL  205

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRG  389
            +IG+GLG          C+P   N+A+F+++ R+    L+   YGH D +DD   G++ G
Sbjct  206  IIGTGLGGA--------CSPAKYNHASFFNQTRSMVVDLIPAKYGHMDFVDD--LGAVDG  255

Query  388  MLTYCM-CKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
               + + CK    R PMR F  GAVVAFLR  L  D +    I+    +APV LQ
Sbjct  256  QRVFLLACKRKSPRKPMRDFTAGAVVAFLRAALYDDTDAFANIVKNPSSAPVLLQ  310



>ref|XP_002966376.1| hypothetical protein SELMODRAFT_85435, partial [Selaginella moellendorffii]
 gb|EFJ32403.1| hypothetical protein SELMODRAFT_85435, partial [Selaginella moellendorffii]
Length=262

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 94/175 (54%), Gaps = 18/175 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDP-----VGGTCPDVLNSTPDYFDLNMPAM  569
            GHS+GGK+AFALAL   A   + F+ ++G+DP     +G T P VL   P  F    P++
Sbjct  94   GHSKGGKIAFALALNIKANVSVPFATLVGLDPMDGTKIGQTQPRVLYDAPIVF--QYPSL  151

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRG  389
            +IG+GLG          C+P   N+A+F+++  +    L+   YGH D +DD   G+  G
Sbjct  152  IIGTGLGGA--------CSPAKYNHASFFNQTSSMVVDLIPAKYGHMDFVDD--LGAFDG  201

Query  388  MLTYCM-CKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
               + + CK    R PMR F  GAVVAFLR  L  D +    I+    +APV LQ
Sbjct  202  QRVFLLACKRKSPRKPMRDFTAGAVVAFLRAALYDDTDAFANIVKNPSSAPVLLQ  256



>ref|XP_002520934.1| Chlorophyllase-1, putative [Ricinus communis]
 gb|EEF41351.1| Chlorophyllase-1, putative [Ricinus communis]
Length=275

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 9/117 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGK AFA+  G +  A   KFSA++G+DPV G      T P VL   P  F+L+
Sbjct  151  ISGHSRGGKTAFAIQFGYSTDALTTKFSALVGLDPVAGHSKESRTDPKVLTYAPHSFNLS  210

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            +P  VIG+GLG   + L +C  AP G N+A FY++CR PA   VA DYGH DML+DD
Sbjct  211  IPVSVIGTGLGSQPQTLFAC--APDGVNHAEFYNECRPPANHFVATDYGHMDMLNDD  265



>gb|AFX87349.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87350.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKTHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87353.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87354.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=147

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87076.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87084.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87086.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87087.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87088.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87092.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87093.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87096.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87097.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87101.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87104.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87105.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87106.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87107.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87108.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87109.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87113.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87114.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87116.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87120.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87122.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87124.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87125.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87128.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87129.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87130.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87132.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87136.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87137.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87138.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87139.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87144.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87145.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87146.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87147.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87150.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87154.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87155.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87158.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87159.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87160.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87161.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87162.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87163.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87164.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87165.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87166.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87167.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87168.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87170.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87171.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87172.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87173.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87175.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87176.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87177.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87178.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87180.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87182.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87184.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87188.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87189.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87190.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87191.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87192.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87193.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87194.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87195.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87196.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87197.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87199.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87200.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87201.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87202.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87203.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87204.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87205.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87206.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87207.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87208.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87209.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87211.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87213.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87214.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87215.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87217.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87218.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87219.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87220.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87221.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87222.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87223.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87225.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87226.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87227.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87228.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87229.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87233.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87234.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87235.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87236.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87237.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87238.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87239.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87240.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87241.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87242.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87243.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87244.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87245.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87246.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87249.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87250.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87251.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87252.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87253.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87254.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87255.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87256.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87257.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87258.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87259.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87260.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87261.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87262.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87263.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87264.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87265.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87266.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87267.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87268.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87269.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87270.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87271.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87272.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87273.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87274.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87275.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87276.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87277.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87278.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87279.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87280.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87281.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87282.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87283.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87284.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87285.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87286.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87287.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87288.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87289.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87290.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87291.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87292.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87293.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87294.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87295.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87296.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87297.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87298.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87299.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87300.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87301.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87302.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87303.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87304.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87305.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87306.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87307.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87308.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87309.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87310.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87311.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87312.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87313.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87314.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87315.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87316.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87317.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87319.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87320.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87321.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87323.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87324.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87325.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87331.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87332.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87333.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87334.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87335.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87336.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87337.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87338.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87339.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87341.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87342.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87343.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87344.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87345.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87347.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87351.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87352.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87355.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87356.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87359.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87360.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87231.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87232.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87140.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87141.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87142.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87143.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87148.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87149.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87151.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87152.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87153.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87156.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87157.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87169.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKANFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87080.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87081.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87074.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87075.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87078.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87082.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87083.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87089.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87090.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87091.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87094.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87095.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87098.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87099.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87100.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87102.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87103.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87115.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87117.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87118.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87119.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87121.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87123.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87126.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87127.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87131.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87134.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87135.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87179.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87181.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87183.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87185.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87186.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87187.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87210.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87216.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87224.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87247.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87327.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87329.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>ref|XP_002966378.1| hypothetical protein SELMODRAFT_86398 [Selaginella moellendorffii]
 gb|EFJ32405.1| hypothetical protein SELMODRAFT_86398 [Selaginella moellendorffii]
Length=273

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 95/175 (54%), Gaps = 18/175 (10%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDP-----VGGTCPDVLNSTPDYFDLNMPAM  569
            GHS+GGK+AFALAL   A   + F+ ++G+DP     +G T P VL   P  F    P++
Sbjct  104  GHSKGGKIAFALALNIKANISVPFATLVGLDPMDGTKLGQTQPRVLYDAPIVF--QYPSL  161

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRG  389
            +IG+G        LS  C+P   N+  F+++ R+    L+  +YGH D +DD   G+  G
Sbjct  162  IIGTG--------LSGACSPARYNHGGFFNQTRSMVVDLIPSEYGHMDFVDD--LGTFDG  211

Query  388  MLTYCM-CKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQ  227
               + + CK    R PMR F  GAVVAFLR  L +  +  + I+    +APV LQ
Sbjct  212  QRVFLLACKRKSPRKPMRDFTAGAVVAFLRAVLYNVTDAFVNIVRNPSSAPVLLQ  266



>gb|AFX87361.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87362.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87363.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87364.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87365.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87366.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87367.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87368.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87369.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87370.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87371.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87372.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87373.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87375.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87376.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87377.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87378.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87379.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87380.1| chlorophyllase 1, partial [Arabidopsis thaliana]
 gb|AFX87381.1| chlorophyllase 1, partial [Arabidopsis thaliana]
Length=150

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ F+L++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFELDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  +   +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P +L P
Sbjct  123  RLIVKDPSVSPAKLDP  138



>gb|AFX87198.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87212.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87230.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87248.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87322.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87326.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87328.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87340.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87346.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87348.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P  FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPQSFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87374.1| chlorophyllase 1, partial [Arabidopsis thaliana]
Length=143

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 81/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ F+L++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFELDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  +   +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKAEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P +L P
Sbjct  123  RLIVKDPSVSPAKLDP  138



>gb|AFX87318.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87330.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P  FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPQSFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRNKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87077.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87174.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAF +  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFFKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87357.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87358.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   109 bits (273),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
              DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAFL+  L  + + +
Sbjct  64   TADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVVAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFX87079.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87085.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87112.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87133.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG VVAF +  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRNKSEMRSFVGGIVVAFFKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|AFR54123.1| chlorophyllase, partial [Populus deltoides x Populus tremuloides]
Length=188

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 90/153 (59%), Gaps = 13/153 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + D+ FSA+IGVDPV GT       P +LN     F+ +
Sbjct  38   LAGHSRGGYIAFALALGLADVSLDVDFSALIGVDPVAGTSKTNQMEPKILNYESCSFNFS  97

Query  580  MPAMVIGSGLGDVKK-NLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  +IG+GLG+     +L   CAP G ++   +++C+ P    V  DYGH D+LDDD  
Sbjct  98   IPVAIIGTGLGNKSAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTSDYGHMDVLDDDI-  156

Query  403  GSLRGMLTYCMCK---NGPARAPMRAFVGGAVV  314
            G + G L   MCK    G +R PMR  VGG  V
Sbjct  157  GPI-GELARAMCKGSRRGVSRDPMRRTVGGVSV  188



>gb|AFX87110.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
 gb|AFX87111.1| chlorophyllase 1, partial [Arabidopsis lyrata subsp. petraea]
Length=150

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 3/136 (2%)
 Frame = -1

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLV  449
            T P +L   P+ FDL++P  V+G+GLG    N++  PCAP   N+  FY +C+A     V
Sbjct  5    TDPHILTYKPESFDLDIPVAVVGTGLGPKWNNVMP-PCAPTDLNHEEFYKECKATKAHFV  63

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            A DYGH DMLDDD  G + G +  CMCKNG   ++ MR+FVGG V AFL+  L  + + +
Sbjct  64   AADYGHMDMLDDDLPGFV-GFMAGCMCKNGQRKKSEMRSFVGGIVXAFLKYSLWGEKSEI  122

Query  271  MGIIDQTETAPVELQP  224
              I+     +P  + P
Sbjct  123  RLIVKDPSVSPATIDP  138



>gb|KDP21407.1| hypothetical protein JCGZ_21878 [Jatropha curcas]
Length=407

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 102/185 (55%), Gaps = 11/185 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA--DLKFSAIIGVDPVGG---TCPDVLNSTPDYFDLNMP  575
            L+GHSRGGK+AFALALGK  T+  ++  SA++GVDPV G    C + +      FDL++P
Sbjct  158  LAGHSRGGKIAFALALGKAKTSLQEVNISALLGVDPVAGLGKECSEPIILRDGTFDLSVP  217

Query  574  AMVIGSGLGDVKKN---LLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
              +IG+GLGD  K+        CAP   N+  F+SK + P    V  +YG  DML+DD  
Sbjct  218  VTIIGTGLGDQPKHPHFPFWPACAPDNLNHKEFFSKSKPPKGHFVITEYGLLDMLNDDLT  277

Query  403  GSLRGMLTYCMCK-NGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGII-DQTETAPVE  233
                      +C  NG  + APMR  VGG  VAFL    +      + I+ D++  +PV+
Sbjct  278  SDFVVQFFNDLCTANGSGSNAPMRRGVGGITVAFLEYNFQGKTKDYLTIVRDRSAVSPVK  337

Query  232  LQPVD  218
            L  V+
Sbjct  338  LDDVE  342



>ref|XP_011080324.1| PREDICTED: chlorophyllase-1, chloroplastic-like [Sesamum indicum]
Length=333

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 97/174 (56%), Gaps = 26/174 (15%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIG  560
            L GHSRGGKVAFALALG  AT  L F A++G+DPV   C            L+ P    G
Sbjct  180  LMGHSRGGKVAFALALG-YATTSLNFKALLGLDPV---C-----------RLSQP----G  220

Query  559  SGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLT  380
            +GL +  K ++  P AP G N++ F+++ + P C  + KDYGH DML+D         L 
Sbjct  221  TGLSNQTKGIIP-PLAPDGFNHSEFFNESKPPCCYFLTKDYGHCDMLNDPNVA-----LA  274

Query  379  YCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
              +CK+G  ++  MR  VGG VVAFL+ +LE +   L  I+     AP+ L PV
Sbjct  275  SLVCKSGKGSKEEMRRGVGGIVVAFLKAYLEGECEDLENIVATPTIAPISLNPV  328



>gb|KJB25943.1| hypothetical protein B456_004G217500, partial [Gossypium raimondii]
Length=268

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 87/169 (51%), Gaps = 35/169 (21%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIG  560
            LSGHSRGGK AFALALG       KFSA+IG+DP                          
Sbjct  134  LSGHSRGGKTAFALALGYGDPIQ-KFSALIGIDP--------------------------  166

Query  559  SGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLT  380
                   K L+SCPCAPK  N+  F+++ + P     AK+YGH DML+DD  G + G L 
Sbjct  167  ------SKGLISCPCAPKKYNHEEFFNESKPPRAHFTAKNYGHMDMLNDDLSGVI-GKLA  219

Query  379  YCMCKNGPA-RAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPV  236
              MC NG   R P+R  +GG V+AFL  + + +      I+++ + APV
Sbjct  220  DSMCVNGKGPRDPLRRCIGGIVIAFLNYYFQDNEVDFNTIVNEPDVAPV  268



>ref|XP_010669257.1| PREDICTED: chlorophyllase type 0-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 97/178 (54%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGK AFALALG + T  +   SA+IGVDPV G      T P VL    + FDL+
Sbjct  173  ISGHSRGGKSAFALALGMSKTKLNFNISALIGVDPVAGPDNHSQTEPHVLTYIDNSFDLS  232

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD-TR  404
            +P  VIG+GLG  K+N L  PCAP   ++  F+++ +  +  ++ K YGH  ML+D  T 
Sbjct  233  IPCTVIGTGLGS-KRNRLIPPCAPSNVSHQQFFNELKQGSHFVIEK-YGHMQMLNDFLTD  290

Query  403  GSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
                 M   C    GP +  MR  +GG +VAFL  +   +      ++     AP +L
Sbjct  291  PVAVSMSVMCTSGFGP-KTTMRRTLGGIMVAFLDAYFRDEKQQFFTLMANPSLAPTKL  347



>gb|KDO37483.1| hypothetical protein CISIN_1g043492mg, partial [Citrus sinensis]
Length=278

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 100/185 (54%), Gaps = 15/185 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADL--KFSAIIGVDPVGGTC-------PDVLNSTPDYFD  587
            L GHSRGG  AFALA G      L  KFSA++GVDPV G         P +L+   + F+
Sbjct  91   LMGHSRGGLTAFALAQGYATNPPLGLKFSALVGVDPVAGIPYFHSELDPPILDY--ESFN  148

Query  586  LNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAP-ACCLVAKDYGHTDMLDDD  410
             ++P  VIG+GLG + K ++  PCAP+  N+  F+++C +       A  YGH D+LDD 
Sbjct  149  FSIPVTVIGTGLGGLAKCVV--PCAPEKENHQQFFNRCTSSDRAHFDATYYGHMDVLDDC  206

Query  409  TRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVE  233
                    ++ CMC NG   R PMR  V G  VAFL+ + +S+ +    I+     AP+ 
Sbjct  207  PPDLKSLAISKCMCTNGTLPRQPMRQCVSGIAVAFLKAYFDSEGDDFKTILADPSVAPIT  266

Query  232  LQPVD  218
            L  V+
Sbjct  267  LGQVE  271



>ref|XP_006443996.1| hypothetical protein CICLE_v10024279mg [Citrus clementina]
 gb|ESR57236.1| hypothetical protein CICLE_v10024279mg [Citrus clementina]
Length=224

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 101/202 (50%), Gaps = 37/202 (18%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLNMPA  572
            GHSR G++ FAL+L         F A+IG+DPV GT       P +L+   + FD ++P 
Sbjct  21   GHSRRGQIVFALSL------HYGFHAVIGLDPVAGTSKSTGLDPSILSF--ESFDFSIPV  72

Query  571  MVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPA-CCLVAKDYGHTDMLDDDTRGSL  395
             +IG+GLG V + +   PCAP+G+N+  F+++C++ +    VA DYGH D+LDD+     
Sbjct  73   TMIGTGLGGVARCI--TPCAPEGANHEEFFNRCKSSSRAHFVATDYGHMDILDDNPSDVK  130

Query  394  RGMLTYCMCKNGPA--------------------RAPMRAFVGGAVVAFLRGFLESDMNP  275
               L+   CKNG                      R  MR  V G VVAF + F + D   
Sbjct  131  SWALSKYFCKNGNQSRDPMGEMQVMQPIGDVYLFRLSMRRCVSGIVVAFPKDFFDGDAED  190

Query  274  LMGIIDQTETAPVELQPVDSKD  209
               I+     AP++L  V+  D
Sbjct  191  FRQILKDPSFAPIKLDSVEYID  212



>ref|XP_004964134.1| PREDICTED: chlorophyllase-1-like [Setaria italica]
Length=190

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 91/174 (52%), Gaps = 14/174 (8%)
 Frame = -1

Query  706  FALALGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLNMPAMVIGSGLGD  545
             AL  G+T T+ LK S +IG+DPV G        P +L       D+ MP +VIG+GL +
Sbjct  20   IALGYGRTKTS-LKISGLIGIDPVAGQDKSSQVSPKILTYERSSLDIAMPVLVIGTGLSE  78

Query  544  VKKNLL--SCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLTYCM  371
             K++ L     CAPK  N+  FY +C+ P    V +DYGH DMLDD+   +L     Y  
Sbjct  79   QKRHELLPGSACAPKDVNHREFYRECKPPCYHFVTRDYGHLDMLDDEYAAAL---FRY-F  134

Query  370  CKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVDSK  212
            CK G   +  MR  V G +VAFL+  L  +   L  I+     AP +L PV+ +
Sbjct  135  CKEGKNCKEIMRRSVAGIMVAFLKAVLSGEDGDLRVIVKDPGLAPAKLNPVEYR  188



>ref|XP_010096443.1| Chlorophyllase-1 [Morus notabilis]
 gb|EXB64218.1| Chlorophyllase-1 [Morus notabilis]
Length=349

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 102/204 (50%), Gaps = 43/204 (21%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA------------------DLKFSAIIGVDPVG-----G  629
            L+GHSRGG+ +FALA  +TA +                  DL  S +IGVDPV       
Sbjct  147  LAGHSRGGRTSFALADKRTAESAKTNSEVHSSALLPRSGKDLNLSVLIGVDPVAATMCCA  206

Query  628  TCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPA-CCL  452
            T PDV   T   F  ++PA VIG+GLG          CAP+  NYA F+ +C+ P     
Sbjct  207  TMPDVHPET-QCFKFDVPAAVIGTGLGGS--------CAPESGNYAQFFKRCKPPKRAEF  257

Query  451  VAKDYGHTDMLDDDTRGS------LRGMLTYCMCKN--GPARAPMRAFVGGAVVAFLRGF  296
            +A  YGH D+LDD+  G+      +  ++T CMCKN  G +R  M   VGG VVAF + +
Sbjct  258  LAPQYGHMDVLDDNPPGNGSCFSCVSALMTKCMCKNAKGLSRECMSRTVGGIVVAFFKAY  317

Query  295  LESDMNP--LMGIIDQTETAPVEL  230
                 +P  L  I +    AP EL
Sbjct  318  NNKYPDPSDLNAIQNNPGLAPAEL  341



>ref|XP_006363512.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum tuberosum]
Length=323

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 103/198 (52%), Gaps = 24/198 (12%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----------------KTATADLKFSAIIGVDPV--GGTC--  623
            +SGHSRGGK AFALAL                  K     LK SA++G+DPV  G +C  
Sbjct  124  VSGHSRGGKTAFALALAYGSGSKGESITSGKATRKQKQPPLKISALLGIDPVAKGSSCLC  183

Query  622  -PDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVA  446
              ++L   P  F+ ++P  VIG+GL + +   +  P AP G N+A F+++ + P    +A
Sbjct  184  SSNILQFIPYSFNHSIPVAVIGTGLSNKRAYGVCPPDAPNGVNHAEFFNESKPPCYYFLA  243

Query  445  KDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMG  266
            K+YGH DMLDD  + +    +     K G     +R  +GG  VAF + +LE   + L+ 
Sbjct  244  KNYGHADMLDDGNKMTTLMGMMKKSGKKGSKED-LRRTIGGLFVAFFKAYLEGQADDLIN  302

Query  265  IIDQTETA-PVELQPVDS  215
            II+      P++L PV S
Sbjct  303  IIESPSIRCPIKLDPVIS  320



>ref|XP_004251483.1| PREDICTED: chlorophyllase-2, chloroplastic-like [Solanum lycopersicum]
Length=319

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 101/200 (51%), Gaps = 29/200 (15%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-------------------KTATADLKFSAIIGVDPV--GGTC  623
            +SGHSRGGK AFALAL                    K     LK SA++G+DPV  G +C
Sbjct  121  VSGHSRGGKTAFALALAYGSGDSKGESIVTSGRATRKQKQPPLKISALLGIDPVAKGSSC  180

Query  622  ---PDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCL  452
                ++L   P  F+ ++P  VIG+GL + +   +  P AP G N+A F+++ + P    
Sbjct  181  FCSSNILQYIPYSFNHSVPVAVIGTGLSNRRAYGVCPPDAPNGVNHAEFFNESKPPCYYF  240

Query  451  VAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPL  272
            +AK+YGHTDMLD+  +                 +  +R  +GG  VAF + +LE   + L
Sbjct  241  LAKNYGHTDMLDEGEKIMGIMKKKGKKE----TKHDLRRTIGGLFVAFFKAYLEGQADDL  296

Query  271  MGIIDQTETA-PVELQPVDS  215
            + II+      P++L PV S
Sbjct  297  INIIESPGIRCPIKLDPVIS  316



>gb|KDP21405.1| hypothetical protein JCGZ_21876 [Jatropha curcas]
Length=229

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 10/156 (6%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA--DLKFSAIIGVDPVGG---TCPDVLNSTPDYFDLNMP  575
            L GHSRGGK AFALALGK  T+  ++  SA++GVDPV G    C + +      FDL++P
Sbjct  74   LFGHSRGGKTAFALALGKAKTSLQEVNISALLGVDPVAGLGKECSEPIILRDGTFDLSIP  133

Query  574  AMVIGSGLGDVKK--NLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
              +IG+GLGD  K  ++   P CAP   N+  F+SK + P    V  +YG   ML+DD  
Sbjct  134  VTIIGTGLGDHPKYPHVPFWPACAPDSLNHKEFFSKSKPPKGHFVFTEYGLLGMLNDDLT  193

Query  403  GSLRGMLTYCMCK-NGP-ARAPMRAFVGGAVVAFLR  302
                      +C  NG  ++APMR+ VGG  VA L 
Sbjct  194  SEFVVQFFNDLCTANGSGSKAPMRSGVGGITVALLE  229



>gb|ABK26334.1| unknown [Picea sitchensis]
Length=346

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 97/185 (52%), Gaps = 14/185 (8%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG-----TCPDVLNSTPDYFDLNMP  575
            ++GHSRGGKVAF  A+G  +     FSA+  +DPV G     T P +L ++ +  +L +P
Sbjct  158  IAGHSRGGKVAFGAAMGLFSPP--SFSALAALDPVDGATGHPTSPPLLTNSQNSLNLKVP  215

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
             +V+G+GLG  +  +    CAP+G ++  F+ +    A   VA D GH D+L+DD     
Sbjct  216  TLVVGTGLGPAEHWMFPT-CAPEGLDHVEFFRETAGSAYHFVAVDQGHQDILNDDVD---  271

Query  394  RGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESD-MNPLMGIIDQTETAPVELQPVD  218
               L   +CK     APMR F  G +VAFL   +  +    L  +I     APV L+  +
Sbjct  272  --FLACFLCKCKAPLAPMRRFGAGILVAFLDATVGGNGAGALNDVIRNPHLAPVRLEKPE  329

Query  217  SKDLV  203
             K LV
Sbjct  330  FKPLV  334



>gb|EEC66959.1| hypothetical protein OsI_33606 [Oryza sativa Indica Group]
Length=337

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 80/144 (56%), Gaps = 14/144 (10%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG------KTATADLKFSAIIGVDPVGG------TCPDVLN-STP  599
            +SGHSRGGKVAFALALG      +        +A++ VDPV G      T P +L     
Sbjct  181  ISGHSRGGKVAFALALGHANVSLRGGAGGATIAALVAVDPVDGFATGKQTPPPILTYGGA  240

Query  598  DYFDLNMPAMVIGSGLGDVKKNLLSCP-CAPKGSNYAAFYSKCRAPACCLVAKDYGHTDM  422
            +   +  P MVIG+GLG + +     P CAP G ++  FY +C APAC LVA+DYGHTDM
Sbjct  241  NSLRVPAPVMVIGTGLGGLARAAPLLPACAPPGVSHGEFYGECAAPACHLVARDYGHTDM  300

Query  421  LDDDTRGSLRGMLTYCMCKNGPAR  350
            + D T GS   +   C   + P R
Sbjct  301  VVDVTPGSWASLRVPCAGASAPGR  324



>ref|XP_009594424.1| PREDICTED: chlorophyllase-1-like, partial [Nicotiana tomentosiformis]
Length=145

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 79/146 (54%), Gaps = 7/146 (5%)
 Frame = -1

Query  649  GVDPVGGTCPDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCR  470
            G  P   + P +L   P  FD  +P  VIG+GL + +  +   P AP G N++ F+++C+
Sbjct  4    GFSPSNRSAPKILQYIPRNFDQTIPVAVIGAGLSNQRVCIFP-PFAPNGVNHSEFFNECK  62

Query  469  APACCLVAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAPMRAFVGGAVVAFLRGFL  293
             P C  +AK+YGHTDMLDD+        +   + K+G   +  MR  VGG VVAFL   L
Sbjct  63   PPCCYFLAKNYGHTDMLDDEI-----AAIASLISKSGKGPKDLMRKAVGGIVVAFLEAKL  117

Query  292  ESDMNPLMGIIDQTETAPVELQPVDS  215
               ++ L  I+ +   AP+ L PV S
Sbjct  118  GGKVDNLNPIVQEPSLAPITLDPVIS  143



>ref|XP_002459847.1| hypothetical protein SORBIDRAFT_02g012201 [Sorghum bicolor]
 gb|EER96368.1| hypothetical protein SORBIDRAFT_02g012201 [Sorghum bicolor]
Length=235

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 66/114 (58%), Gaps = 6/114 (5%)
 Frame = -1

Query  622  PDVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAK  443
            P +L      F++ MP +VIG+GLG+ K+N+L  PCAPK  N+  FY +C  P    V K
Sbjct  91   PQILTYESSSFNIAMPVLVIGTGLGEEKRNILFPPCAPKDVNHKEFYLECMPPCYYFVTK  150

Query  442  DYGHTDMLDDDTRGSLRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESD  284
            DYGH DMLDDD    +      CMCK+G   +  MR  V G +VAFL+  L  +
Sbjct  151  DYGHLDMLDDDAPKFMT-----CMCKDGKNCKDMMRRSVAGIMVAFLKAVLSGE  199



>ref|XP_008355464.1| PREDICTED: chlorophyllase-1-like [Malus domestica]
Length=107

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = -1

Query  520  PCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPA-RAP  344
            PCA  G+N+  F+ +C+ P    V KDYGH DMLDDD +G + G ++ CMCKNG   R  
Sbjct  3    PCAXXGANHKEFFYECKPPCAHFVVKDYGHMDMLDDDPQG-MVGAVSGCMCKNGTGPREL  61

Query  343  MRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            MR  VGG VVAFL  +L  D   L+ I+   +++P +L+PV+
Sbjct  62   MRKTVGGIVVAFLNAYLNGDDXXLVAIVGDPDSSPAKLEPVE  103



>ref|XP_011032785.1| PREDICTED: chlorophyllase type 0-like [Populus euphratica]
Length=166

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 71/118 (60%), Gaps = 8/118 (7%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-KTATADLKFSAIIGVDPVGGTC------PDVLNSTPDYFDLN  581
            L+GHSRGG +AFALALG    + D+  SA+IGVDPV GT       P +LN     F+ +
Sbjct  40   LAGHSRGGYIAFALALGLADVSLDINISALIGVDPVVGTSKNNQMEPKILNYESCSFNFS  99

Query  580  MPAMVIGSGLGDVKK-NLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDD  410
            +P  +IG+GLG+     +L   CAP G ++   +++C+ P    V   YGH D+LDDD
Sbjct  100  IPVTIIGTGLGNEPAFPILPQTCAPDGVSHTEIFNECKPPCSHFVTTYYGHLDVLDDD  157



>gb|KGN61685.1| hypothetical protein Csa_2G224250 [Cucumis sativus]
Length=191

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 87/177 (49%), Gaps = 41/177 (23%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGT-----CPDVLNSTPDYFDLNMP  575
            L GHSRGGK AF+LALG      L FSA+IG+DPV GT      P +L    + F ++ P
Sbjct  41   LVGHSRGGKTAFSLALG-ICRPSLPFSAVIGIDPVAGTKCFQPQPHILPPLSEPFKISAP  99

Query  574  AMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL  395
              VIG+GLG    + ++CPCAP G N+ AF+SK                    ++ +GS 
Sbjct  100  ITVIGTGLGPKSASPITCPCAPDGFNHVAFFSK--------------------NNGKGS-  138

Query  394  RGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQP  224
                          R  MR    G VVA L+ +L++D + L  I      APV+L P
Sbjct  139  --------------RKLMRECCSGLVVASLKAYLDNDESFLNAIYVDPSIAPVDLNP  181



>dbj|BAG55223.1| chlorophyllase [Sesbania rostrata]
Length=106

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 58/102 (57%), Gaps = 2/102 (2%)
 Frame = -1

Query  520  PCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAP-  344
            PCA  G N+  FY++C+ P    V  DYGH DMLDDDT G +  M+  CMCKNG      
Sbjct  2    PCASDGVNHKEFYNECKPPRAHFVTTDYGHMDMLDDDTPGIMGNMMK-CMCKNGTGPMDF  60

Query  343  MRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPVD  218
            MR  VGG VVAFLR +L      L  I+     AP +L PV+
Sbjct  61   MRRTVGGLVVAFLRAYLNDQWKDLNAILADPSIAPAKLDPVE  102



>ref|XP_010669258.1| PREDICTED: chlorophyllase type 0-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 84/177 (47%), Gaps = 37/177 (21%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATA-DLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN  581
            +SGHSRGGK AFALALG + T  +   SA+IGVDPV G      T P VL    + FDL+
Sbjct  173  ISGHSRGGKSAFALALGMSKTKLNFNISALIGVDPVAGPDNHSQTEPHVLTYIDNSFDLS  232

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRG  401
            +P  VIG+GLG  K+N L  PCAP   ++  F+++ +                       
Sbjct  233  IPCTVIGTGLGS-KRNRLIPPCAPSNVSHQQFFNELKQ----------------------  269

Query  400  SLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVEL  230
                    C    GP +  MR  +GG +VAFL  +   +      ++     AP +L
Sbjct  270  ------VMCTSGFGP-KTTMRRTLGGIMVAFLDAYFRDEKQQFFTLMANPSLAPTKL  319



>ref|XP_002978187.1| hypothetical protein SELMODRAFT_107983, partial [Selaginella 
moellendorffii]
 gb|EFJ20844.1| hypothetical protein SELMODRAFT_107983, partial [Selaginella 
moellendorffii]
Length=309

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 79/146 (54%), Gaps = 18/146 (12%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDP-----VGGTCPDVLNSTPDYFDLNMPAM  569
            GHS+GGK+AFALAL   A   + F+ ++G+DP     +G T P VL   P  F    P++
Sbjct  114  GHSKGGKIAFALALNIKANISVPFATLVGLDPMDGTKIGQTQPRVLYDAPIVFQ--YPSL  171

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSL-R  392
            +IG+G        LS  C+P   N+  F+++ R+    L+  +YGH D +DD   G++ R
Sbjct  172  IIGTG--------LSGACSPAKYNHGGFFNQTRSMVVDLIPSEYGHMDFVDD--LGAVDR  221

Query  391  GMLTYCMCKNGPARAPMRAFVGGAVV  314
              +    CK    R PMR F  GAVV
Sbjct  222  QRVFLLACKRKRPRKPMRDFTAGAVV  247



>ref|XP_010326403.1| PREDICTED: chlorophyllase-1 isoform X3 [Solanum lycopersicum]
Length=277

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 89/182 (49%), Gaps = 42/182 (23%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPD------VLNSTPDYFDLNM  578
            +SGHS+GG  AFA+AL   ++  LKFSA++G+DPV G  P       VL   P  F+ ++
Sbjct  128  ISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  185

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGS  398
            P  VIG+GL +                            CCL+      +DML  D    
Sbjct  186  PVAVIGAGLSN-------------------------QSTCCLLP-----SDMLQAD---G  212

Query  397  LRGMLTYCMCKNGP-ARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTETAPVELQPV  221
            +  +L   M K+G  ++  MR  VGG VVAFL+ +LE  ++ L  I+     AP+ L PV
Sbjct  213  IMAILIRIMMKSGKGSKKSMRRAVGGIVVAFLKAYLEGQIDDLNEIVKSPNLAPIILDPV  272

Query  220  DS  215
             S
Sbjct  273  IS  274



>gb|AFK36235.1| unknown [Medicago truncatula]
Length=219

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 55/87 (63%), Gaps = 9/87 (10%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGG--------TCPDVLNSTPDYFDL  584
            L+GHS+GGK AFA+ALG   T +LKFSA+IG+DPV G        T P +L      FDL
Sbjct  131  LAGHSKGGKTAFAVALGHAET-NLKFSALIGIDPVAGPSKCKITRTLPHILTGQAQSFDL  189

Query  583  NMPAMVIGSGLGDVKKNLLSCPCAPKG  503
            NMP +VIG+GLG    N    PCAP G
Sbjct  190  NMPVIVIGTGLGPEPSNCSPLPCAPDG  216



>gb|KHN00266.1| Chlorophyllase-2, chloroplastic [Glycine soja]
Length=84

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  580  MPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDT  407
            M  MVIGS LG+VK+N L  PCAPKG +Y  F+ +C+ PA   +AKDYGH DM DDDT
Sbjct  1    MAVMVIGSDLGEVKRNPLFPPCAPKGVSYENFFKECKKPAWYFLAKDYGHCDMQDDDT  58



>emb|CDP11312.1| unnamed protein product [Coffea canephora]
Length=87

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -1

Query  448  AKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLM  269
            AK+YG  DM+DDD    +RG + YC+ KNG +R PM  FVGG   AF R +L  +   L 
Sbjct  9    AKEYGLLDMVDDDI-SWIRGKVAYCLHKNGESRDPMWRFVGGITFAFTRNYLAGNSRDLQ  67

Query  268  GIIDQTETAPVELQPVD  218
             I D   TAP+ELQ VD
Sbjct  68   AIRDGHLTAPIELQNVD  84



>dbj|BAO47884.1| chlorophyllase, partial [Dianthus caryophyllus]
Length=91

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = -1

Query  694  LGKTATADLKFSAIIGVDPVGG------TCPDVLNSTPDYFDLN-MPAMVIGSGLGDVKK  536
            L K   + L  SA+IG+DPV G      T P VL+  P  FDL+ +P +VIGSGLG+VK+
Sbjct  1    LKKLIPSPLTISALIGIDPVDGMDKGKQTPPAVLSYIPRSFDLDGIPTLVIGSGLGEVKR  60

Query  535  NLLSCPCAPKGSNYAAFYSKCRAPACCLVAK  443
            N     CAPKG N+  FY +CR  +   + K
Sbjct  61   NAFFPACAPKGVNHENFYDECRDQSWYFLVK  91



>ref|XP_010326404.1| PREDICTED: chlorophyllase-2, chloroplastic isoform X4 [Solanum 
lycopersicum]
Length=221

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 56/94 (60%), Gaps = 8/94 (9%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPD------VLNSTPDYFDLNM  578
            +SGHS+GG  AFA+AL   ++  LKFSA++G+DPV G  P       VL   P  F+ ++
Sbjct  128  ISGHSKGGNTAFAVALD--SSMPLKFSALLGIDPVAGCSPSCLRPPYVLEYIPRIFNQSI  185

Query  577  PAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSK  476
            P  VIG+GL +     L    AP G N+A F+++
Sbjct  186  PVAVIGAGLSNQSTCCLLPSGAPNGVNHAEFFNE  219



>gb|KCW84158.1| hypothetical protein EUGRSUZ_B01020 [Eucalyptus grandis]
Length=79

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = -1

Query  427  DMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFL  293
            D LDDDT G L+G  TYCM KNG +R PMR  VGGAVVAFLR FL
Sbjct  2    DKLDDDTEG-LKGAATYCMRKNGSSREPMRTLVGGAVVAFLRAFL  45



>dbj|BAD21503.1| hypothetical protein [Oryza sativa Japonica Group]
Length=140

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 51/103 (50%), Gaps = 5/103 (5%)
 Frame = -1

Query  520  PCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPM  341
            PCAP G N+  FY +C  P    V +D GH DMLDD    ++   +  CM   G  +   
Sbjct  35   PCAPAGVNHCEFYDECAPPRYHFVLRDNGHLDMLDDGVPYAINNCM--CMRNLGDTKEVA  92

Query  340  RAFVGGAVVAFLRGFLESDMNPLMGIID---QTETAPVELQPV  221
            R  +GG +VAFLR  LE   + L  ++        AP  ++PV
Sbjct  93   RRTIGGLMVAFLRDALEDQHDDLKLVLKVGVNPGLAPAVIKPV  135



>gb|EAZ22614.1| hypothetical protein OsJ_06283 [Oryza sativa Japonica Group]
Length=135

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 16/136 (12%)
 Frame = -1

Query  619  DVLNSTPDYFDLNMPAMVIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKD  440
            +VL +TP+   L +    +G             PCAP G N+  FY +C  P    V +D
Sbjct  8    EVLGTTPNERSLRVRPRHVGGP-----------PCAPAGVNHCEFYDECAPPRYHFVLRD  56

Query  439  YGHTDMLDDDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGII  260
             GH DMLDD    ++   +  CM   G  +   R  +GG +VAFLR  LE   + L  ++
Sbjct  57   NGHLDMLDDGVPYAINNCM--CMRNLGDTKEVARRTIGGLMVAFLRDALEDQHDDLKLVL  114

Query  259  D---QTETAPVELQPV  221
                    AP  ++PV
Sbjct  115  KVGVNPGLAPAVIKPV  130



>ref|XP_004345599.1| hypothetical protein CAOG_06009 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95566.1| hypothetical protein CAOG_006009 [Capsaspora owczarzaki ATCC 
30864]
Length=359

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 74/180 (41%), Gaps = 29/180 (16%)
 Frame = -1

Query  739  LSGHSRGGKVA--FALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMV  566
            LSGHS GGK+   F         A +  + + G DP  G  P  +   P   +  +P +V
Sbjct  159  LSGHSAGGKIVTRFLEVQCSLVRALVLVNPVDGEDP-WGILPGFVIHPPYPVNFTLPLLV  217

Query  565  IGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLD----------  416
            +G GLG V        CAP G N+  FY+  R     + A D+GH D+LD          
Sbjct  218  LGEGLGPVVAQPGFPACAPAGRNFPRFYNGARPCKWMINATDFGHADLLDAVYVEFVQAT  277

Query  415  ----DDTRGSLRGMLTYCMCKNGPARAPMRAFVGGAVVAFLRGFLESDMNPLMGIIDQTE  248
                 +   SL    TY            R F+ G +V+  RG ++S  +    I  Q++
Sbjct  278  KLCASNMNASLAQFSTY------------RQFIAGTIVSMTRGAIDSQCDAYNYIQSQSQ  325



>tpg|DAA48625.1| TPA: hypothetical protein ZEAMMB73_996983, partial [Zea mays]
Length=187

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 45/87 (52%), Gaps = 23/87 (26%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALG-----------------KTATADLKFSAIIGVDPVGGTC----  623
            L+GHSRGG  AFA+ALG                   A   LKFSA+IGVDPV G      
Sbjct  101  LAGHSRGGDTAFAVALGLGPAASDDDDNNADAGTSPAALPLKFSALIGVDPVAGLSKQAQ  160

Query  622  --PDVLNSTPDYFDLNMPAMVIGSGLG  548
              P VL   P   D  MPA+V+G+GLG
Sbjct  161  VEPKVLTFRPRSLDPGMPALVVGTGLG  187



>gb|EGV18485.1| amidohydrolase 2 [Thiocapsa marina 5811]
Length=713

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPV--GGTCPDVLNSTPDYF-DLNMPAM  569
            L+GHS GGK++F L +      D +  AI  +DPV  G   P V   TP+    ++MP +
Sbjct  533  LAGHSLGGKISFMLGIDLIEDDDERVQAIFAIDPVDDGKGSPSV---TPEQMAKVDMPFI  589

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
             +G  L    K+     CAP+ SN+  F+   R+PA  +      H   LD+
Sbjct  590  ALGETLDSTPKHDSLMACAPEASNFEKFFDGARSPAAKIDVLGASHMSFLDN  641



>ref|WP_040731129.1| hypothetical protein [Thiocapsa marina]
Length=697

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 6/112 (5%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPV--GGTCPDVLNSTPDYF-DLNMPAM  569
            L+GHS GGK++F L +      D +  AI  +DPV  G   P V   TP+    ++MP +
Sbjct  517  LAGHSLGGKISFMLGIDLIEDDDERVQAIFAIDPVDDGKGSPSV---TPEQMAKVDMPFI  573

Query  568  VIGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDD  413
             +G  L    K+     CAP+ SN+  F+   R+PA  +      H   LD+
Sbjct  574  ALGETLDSTPKHDSLMACAPEASNFEKFFDGARSPAAKIDVLGASHMSFLDN  625



>ref|XP_005650113.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
 gb|EIE25569.1| alpha/beta-hydrolase [Coccomyxa subellipsoidea C-169]
Length=353

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 64/136 (47%), Gaps = 28/136 (21%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC-----PDVLNSTP--DYFDLN  581
            L GHSRGGKV+ ALA    A  D +  A+  +DPV  T      PD  ++     +    
Sbjct  157  LCGHSRGGKVS-ALA----AVVDPRVKAVCLLDPVDVTVCAPQGPDFPSAVAAVRHMSRG  211

Query  580  MPAMVIGSG-LGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTR  404
            +P  V+GSG  GD         C PK SNY  +++ C+ PA  +V    GH   LD+ + 
Sbjct  212  VPLAVVGSGRAGD---------CVPKDSNYRRYFNACQGPAWEVVLASAGHFQFLDEQS-  261

Query  403  GSLRGMLTYCMCKNGP  356
                 ML   +C  GP
Sbjct  262  -----MLQRAVCAVGP  272



>ref|WP_015746913.1| chlorophyllase [Nakamurella multipartita]
 gb|ACV78009.1| Chlorophyllase [Nakamurella multipartita DSM 44233]
Length=239

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 68/150 (45%), Gaps = 22/150 (15%)
 Frame = -1

Query  739  LSGHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTC--PDVLNSTPDYFDLNMPAMV  566
            L GHSRGG+ A+  A G+    D   S ++ +DPV G    P    +T       +PA++
Sbjct  90   LGGHSRGGQAAW-RAAGQLRDDDRPASVVL-LDPVDGQGRRPSGPTATAQEAAFTVPALI  147

Query  565  IGSGLGDVKKNLLSCPCAPKGSNYAAFYSKCRAPACCLVAKDYGHTDMLDDDTRGSLRGM  386
            +G+G+G          CAP+G N+  F     A    LV    GH D+LD   R      
Sbjct  148  VGAGVGGR--------CAPEGINHRQFARATPAARHMLV-PGLGHADLLDGRGRD-----  193

Query  385  LTYCMCKNGP----ARAPMRAFVGGAVVAF  308
            L   +C  GP    AR+ + A +G  + A 
Sbjct  194  LGRRLCGGGPDPDAARSAIAALIGAWITAV  223



>ref|XP_005824997.1| hypothetical protein GUITHDRAFT_165302 [Guillardia theta CCMP2712]
 gb|EKX38017.1| hypothetical protein GUITHDRAFT_165302 [Guillardia theta CCMP2712]
Length=465

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 50/109 (46%), Gaps = 14/109 (13%)
 Frame = -1

Query  733  GHSRGGKVAFALALGKTATADLKFSAIIGVDPVGGTCPDVLNSTPDYFDLNMPAMVIGSG  554
            GHSRG K    LA+G  +    +  A++  DPV  T  +     P   +L +P  ++G+ 
Sbjct  272  GHSRGAK----LAIGAASAFKGRVGALVLFDPVDSTNYEPDTMLPLLTNLRVPVAIVGAQ  327

Query  553  LGDVKKNLLSCPCAPKGSNYAAFYS---KCRAPACCLVAKDYGHTDMLD  416
              +         CAP G+NY AFYS   K  AP         GHT +LD
Sbjct  328  ADE-------GMCAPYGANYVAFYSALEKSGAPRLLATLPHAGHTQLLD  369



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515