BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013F18

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99902.1|  unnamed protein product                                206   9e-60   Coffea canephora [robusta coffee]
ref|XP_010088787.1|  Diphosphomevalonate decarboxylase                  204   2e-59   
gb|ABV02028.1|  mevalonate diphosphate decarboxylase                    202   2e-58   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009795010.1|  PREDICTED: diphosphomevalonate decarboxylase...    202   2e-58   Nicotiana sylvestris
ref|XP_006361468.1|  PREDICTED: diphosphomevalonate decarboxylase...    202   2e-58   Solanum tuberosum [potatoes]
ref|XP_009630346.1|  PREDICTED: diphosphomevalonate decarboxylase...    202   2e-58   Nicotiana tomentosiformis
ref|NP_001234815.1|  mevalonate disphosphate decarboxylase              202   5e-58   Solanum lycopersicum
ref|XP_010032077.1|  PREDICTED: diphosphomevalonate decarboxylase...    201   7e-58   Eucalyptus grandis [rose gum]
ref|XP_009792788.1|  PREDICTED: diphosphomevalonate decarboxylase...    200   2e-57   Nicotiana sylvestris
ref|XP_009619582.1|  PREDICTED: diphosphomevalonate decarboxylase...    199   3e-57   Nicotiana tomentosiformis
gb|AII99848.1|  mevalonate disphosphate decarboxylase                   199   4e-57   Nicotiana tabacum [American tobacco]
gb|AFK38744.1|  unknown                                                 192   6e-57   Medicago truncatula
dbj|BAF98285.1|  diphosphomevelonate decarboxylase                      198   1e-56   Hevea brasiliensis [jebe]
gb|AGZ15316.1|  mevalonate decarboxylase                                197   1e-56   Platycodon grandiflorus [balloon-flower]
gb|AFO67223.1|  putative mevalonate diphosphate decarboxylase           188   3e-56   Aralia elata
gb|KDP35789.1|  hypothetical protein JCGZ_10425                         197   3e-56   Jatropha curcas
gb|ADR65113.1|  mevalonate 5-diphosphate decarboxylase                  197   4e-56   Catharanthus roseus [chatas]
ref|XP_002266399.1|  PREDICTED: diphosphomevalonate decarboxylase       196   5e-56   Vitis vinifera
gb|AAL18927.1|AF429386_1  mevalonate disphosphate decarboxylase         196   7e-56   Hevea brasiliensis [jebe]
gb|KEH44325.1|  mevalonate diphosphate decarboxylase                    196   1e-55   Medicago truncatula
ref|XP_003536712.1|  PREDICTED: diphosphomevalonate decarboxylase...    195   1e-55   Glycine max [soybeans]
gb|AEZ55675.1|  mevalonate diphosphate decarboxylase                    195   1e-55   Salvia miltiorrhiza [Chinese salvia]
ref|XP_003555870.1|  PREDICTED: diphosphomevalonate decarboxylase...    195   2e-55   Glycine max [soybeans]
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       199   3e-55   Glycine soja [wild soybean]
emb|CAN82519.1|  hypothetical protein VITISV_042700                     194   5e-55   Vitis vinifera
ref|XP_004236810.1|  PREDICTED: diphosphomevalonate decarboxylase...    193   8e-55   Solanum lycopersicum
gb|KHN11470.1|  Diphosphomevalonate decarboxylase                       193   1e-54   Glycine soja [wild soybean]
ref|XP_004497159.1|  PREDICTED: diphosphomevalonate decarboxylase...    192   3e-54   Cicer arietinum [garbanzo]
gb|AFM77982.1|  mevalonate diphosphate decarboxylase                    192   3e-54   Eleutherococcus senticosus
ref|XP_002315441.1|  mevalonate disphosphate decarboxylase family...    191   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_002311015.1|  mevalonate disphosphate decarboxylase family...    189   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_010676219.1|  PREDICTED: diphosphomevalonate decarboxylase...    189   3e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|AID51442.1|  mevalonate diphosphate decarboxylase                    189   3e-53   Astragalus membranaceus
ref|XP_011024216.1|  PREDICTED: diphosphomevalonate decarboxylase...    189   4e-53   Populus euphratica
ref|XP_002521172.1|  diphosphomevalonate decarboxylase, putative        188   7e-53   Ricinus communis
ref|XP_007010314.1|  GHMP kinase family protein isoform 1               186   4e-52   
ref|XP_011032862.1|  PREDICTED: diphosphomevalonate decarboxylase...    186   6e-52   Populus euphratica
ref|XP_006359351.1|  PREDICTED: diphosphomevalonate decarboxylase...    185   1e-51   
ref|XP_007211744.1|  hypothetical protein PRUPE_ppa006290mg             184   2e-51   Prunus persica
ref|XP_008232018.1|  PREDICTED: diphosphomevalonate decarboxylase...    184   2e-51   Prunus mume [ume]
ref|XP_010244659.1|  PREDICTED: diphosphomevalonate decarboxylase...    184   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_007010315.1|  GHMP kinase family protein isoform 2               184   3e-51   
ref|XP_008345749.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   1e-50   
ref|XP_009356125.1|  PREDICTED: diphosphomevalonate decarboxylase       181   5e-50   Pyrus x bretschneideri [bai li]
emb|CDX73494.1|  BnaC08g25090D                                          180   7e-50   
ref|XP_008364764.1|  PREDICTED: diphosphomevalonate decarboxylase...    180   8e-50   
ref|XP_011102052.1|  PREDICTED: diphosphomevalonate decarboxylase...    172   9e-50   Sesamum indicum [beniseed]
ref|XP_010504223.1|  PREDICTED: diphosphomevalonate decarboxylase...    179   1e-49   Camelina sativa [gold-of-pleasure]
gb|KDO47063.1|  hypothetical protein CISIN_1g014714mg                   176   1e-49   Citrus sinensis [apfelsine]
ref|XP_008356850.1|  PREDICTED: diphosphomevalonate decarboxylase...    179   1e-49   
ref|XP_006291202.1|  hypothetical protein CARUB_v10017330mg             179   2e-49   Capsella rubella
ref|XP_009139253.1|  PREDICTED: diphosphomevalonate decarboxylase...    178   4e-49   Brassica rapa
ref|XP_006403599.1|  hypothetical protein EUTSA_v10010411mg             178   4e-49   Eutrema salsugineum [saltwater cress]
ref|XP_009116111.1|  PREDICTED: diphosphomevalonate decarboxylase       178   4e-49   Brassica rapa
emb|CDX76157.1|  BnaA04g04210D                                          178   5e-49   
emb|CDY65399.1|  BnaCnng46900D                                          177   1e-48   Brassica napus [oilseed rape]
gb|KDO47062.1|  hypothetical protein CISIN_1g014714mg                   176   1e-48   Citrus sinensis [apfelsine]
gb|EYU19775.1|  hypothetical protein MIMGU_mgv1a007068mg                177   1e-48   Erythranthe guttata [common monkey flower]
gb|KDO47059.1|  hypothetical protein CISIN_1g014714mg                   176   2e-48   Citrus sinensis [apfelsine]
ref|XP_002877963.1|  hypothetical protein ARALYDRAFT_906831             176   2e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_007142839.1|  hypothetical protein PHAVU_007G021200g             176   2e-48   Phaseolus vulgaris [French bean]
gb|AAM65192.1|  diphosphomevalonate decarboxylase-like protein          176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427097.1|  PREDICTED: diphosphomevalonate decarboxylase...    176   2e-48   Camelina sativa [gold-of-pleasure]
ref|NP_566995.1|  diphosphomevalonate decarboxylase                     176   2e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CAB70999.1|  DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein         176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445713.1|  hypothetical protein CICLE_v10015368mg             176   2e-48   Citrus clementina [clementine]
ref|XP_011469322.1|  PREDICTED: diphosphomevalonate decarboxylase       176   3e-48   Fragaria vesca subsp. vesca
gb|KFK34679.1|  hypothetical protein AALP_AA5G177200                    176   3e-48   Arabis alpina [alpine rockcress]
ref|XP_010515945.1|  PREDICTED: diphosphomevalonate decarboxylase...    175   5e-48   Camelina sativa [gold-of-pleasure]
gb|ABG24207.2|  mevalonate disphosphate decarboxylase                   174   1e-47   Arnebia euchroma
ref|XP_011084229.1|  PREDICTED: diphosphomevalonate decarboxylase...    173   3e-47   
ref|XP_006391873.1|  hypothetical protein EUTSA_v10023484mg             171   1e-46   Eutrema salsugineum [saltwater cress]
gb|KHG20401.1|  Mvd                                                     171   2e-46   Gossypium arboreum [tree cotton]
gb|KHG20400.1|  Mvd                                                     171   3e-46   Gossypium arboreum [tree cotton]
gb|KJB78629.1|  hypothetical protein B456_013G012400                    170   4e-46   Gossypium raimondii
ref|XP_010536295.1|  PREDICTED: diphosphomevalonate decarboxylase...    169   2e-45   Tarenaya hassleriana [spider flower]
gb|ACW83616.2|  mevalonate diphosphate decarboxylase                    168   2e-45   Panax ginseng [Asiatic ginseng]
gb|AEM42974.1|  diphosphomevalonate decarboxylase                       167   3e-45   Siraitia grosvenorii [arhat fruit]
gb|AEA72605.1|  mevalonate 5-diphosphate decarboxylase                  167   5e-45   Houttuynia cordata [chameleon-plant]
ref|XP_010536297.1|  PREDICTED: diphosphomevalonate decarboxylase...    167   7e-45   Tarenaya hassleriana [spider flower]
ref|XP_010536296.1|  PREDICTED: diphosphomevalonate decarboxylase...    165   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_002452980.1|  hypothetical protein SORBIDRAFT_04g035950          164   6e-44   Sorghum bicolor [broomcorn]
ref|XP_010554524.1|  PREDICTED: diphosphomevalonate decarboxylase...    164   8e-44   Tarenaya hassleriana [spider flower]
ref|XP_004954217.1|  PREDICTED: diphosphomevalonate decarboxylase...    162   4e-43   Setaria italica
gb|ADI80345.1|  mevalonate diphosphate decarboxylase                    162   5e-43   Panax ginseng [Asiatic ginseng]
ref|XP_004963234.1|  PREDICTED: diphosphomevalonate decarboxylase...    162   5e-43   Setaria italica
ref|XP_004150845.1|  PREDICTED: diphosphomevalonate decarboxylase...    160   2e-42   Cucumis sativus [cucumbers]
ref|XP_009404708.1|  PREDICTED: diphosphomevalonate decarboxylase...    160   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW73864.1|  hypothetical protein ZEAMMB73_421648                    158   1e-41   
ref|XP_003565147.1|  PREDICTED: diphosphomevalonate decarboxylase...    158   2e-41   Brachypodium distachyon [annual false brome]
gb|AIK21783.1|  mevalonate diphosphate decarboxylase                    158   2e-41   Panax notoginseng [san-qi]
ref|XP_008446768.1|  PREDICTED: diphosphomevalonate decarboxylase       158   2e-41   Cucumis melo [Oriental melon]
ref|NP_001149256.1|  LOC100282878                                       158   2e-41   Zea mays [maize]
gb|EPS58605.1|  hypothetical protein M569_16208                         151   5e-41   Genlisea aurea
ref|XP_008665378.1|  PREDICTED: diphosphomevalonate decarboxylase...    155   1e-40   Zea mays [maize]
gb|EMT01953.1|  Diphosphomevalonate decarboxylase                       155   2e-40   
ref|XP_008665377.1|  PREDICTED: diphosphomevalonate decarboxylase...    154   7e-40   Zea mays [maize]
ref|XP_006836043.1|  hypothetical protein AMTR_s00114p00051110          152   3e-39   Amborella trichopoda
dbj|BAD27942.1|  putative mevalonate disphosphate decarboxylase         152   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|ACN41090.1|  unknown                                                 150   8e-39   Picea sitchensis
ref|XP_010067136.1|  PREDICTED: diphosphomevalonate decarboxylase...    150   1e-38   Eucalyptus grandis [rose gum]
gb|AAV32433.1|  mevalonate disphosphate decarboxylase                   150   1e-38   Ginkgo biloba [ginkgo]
gb|KFK36776.1|  hypothetical protein AALP_AA4G169000                    149   2e-38   Arabis alpina [alpine rockcress]
emb|CDM86983.1|  unnamed protein product                                148   7e-38   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA51253.1|  TPA: hypothetical protein ZEAMMB73_408503              152   1e-37   
gb|EMS47869.1|  Diphosphomevalonate decarboxylase                       146   1e-37   Triticum urartu
gb|AGT17596.1|  mevalonate diphosphate decarboxylase                    147   2e-37   Picrorhiza kurrooa
ref|NP_181404.1|  mevalonate diphosphate decarboxylase 1                146   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64988.1|  mevalonate diphosphate decarboxylase                    146   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294305.1|  hypothetical protein CARUB_v10023314mg             144   1e-36   Capsella rubella
ref|XP_002881611.1|  hypothetical protein ARALYDRAFT_482881             144   2e-36   
ref|XP_010509167.1|  PREDICTED: diphosphomevalonate decarboxylase...    142   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010505522.1|  PREDICTED: diphosphomevalonate decarboxylase...    140   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010907122.1|  PREDICTED: diphosphomevalonate decarboxylase...    139   1e-34   Elaeis guineensis
ref|XP_008788072.1|  PREDICTED: diphosphomevalonate decarboxylase...    135   4e-33   Phoenix dactylifera
ref|XP_006646770.1|  PREDICTED: diphosphomevalonate decarboxylase...    134   9e-33   Oryza brachyantha
gb|ADE77000.1|  unknown                                                 124   4e-32   Picea sitchensis
ref|XP_001773902.1|  predicted protein                                  125   1e-29   
ref|XP_001774493.1|  predicted protein                                  120   5e-28   
gb|ACO35356.1|  mevalonate pyrophosphate decarboxylase                  102   1e-22   Elaeis oleifera
ref|XP_002992344.1|  hypothetical protein SELMODRAFT_135101           84.0    3e-15   Selaginella moellendorffii
ref|XP_002979347.1|  hypothetical protein SELMODRAFT_268244           84.0    3e-15   Selaginella moellendorffii
gb|KJB78632.1|  hypothetical protein B456_013G012400                  80.1    4e-14   Gossypium raimondii
gb|AFS28685.1|  putative phosphomevalonate kinase                     66.2    4e-11   Olea europaea
ref|XP_002592260.1|  hypothetical protein BRAFLDRAFT_277163           59.7    7e-07   Branchiostoma floridae
gb|ACU22779.1|  unknown                                               55.8    8e-07   Glycine max [soybeans]
ref|XP_006411092.1|  hypothetical protein EUTSA_v10016888mg           57.0    4e-06   Eutrema salsugineum [saltwater cress]
emb|CBI24186.3|  unnamed protein product                              53.1    8e-06   Vitis vinifera
gb|ELW62889.1|  Diphosphomevalonate decarboxylase                     55.8    1e-05   Tupaia chinensis
ref|XP_005424871.1|  PREDICTED: diphosphomevalonate decarboxylase     54.7    2e-05   
ref|XP_004356734.1|  diphosphomevalonate decarboxylase                54.3    4e-05   Acanthamoeba castellanii str. Neff
ref|XP_002735076.1|  PREDICTED: diphosphomevalonate decarboxylase...  53.9    5e-05   Saccoglossus kowalevskii
emb|CAF99534.1|  unnamed protein product                              53.1    9e-05   Tetraodon nigroviridis
gb|EHH60647.1|  hypothetical protein EGM_12056                        52.8    1e-04   Macaca fascicularis [crab eating macaque]
ref|XP_009089159.1|  PREDICTED: diphosphomevalonate decarboxylase     52.8    1e-04   Serinus canaria [canary]
ref|XP_005592827.1|  PREDICTED: diphosphomevalonate decarboxylase...  52.8    1e-04   Macaca fascicularis [crab eating macaque]
ref|NP_001247472.1|  diphosphomevalonate decarboxylase                52.8    1e-04   Macaca mulatta [rhesus macaque]
gb|EIE86507.1|  diphosphomevalonate decarboxylase                     52.8    1e-04   Rhizopus delemar RA 99-880
ref|XP_003922886.1|  PREDICTED: diphosphomevalonate decarboxylase     52.8    1e-04   Saimiri boliviensis boliviensis
ref|XP_010996740.1|  PREDICTED: diphosphomevalonate decarboxylase...  50.4    1e-04   Camelus dromedarius [camel]
ref|XP_008300019.1|  PREDICTED: diphosphomevalonate decarboxylase     52.4    2e-04   Stegastes partitus
ref|XP_008403677.1|  PREDICTED: diphosphomevalonate decarboxylase     52.4    2e-04   Poecilia reticulata
gb|EAW66791.1|  mevalonate (diphospho) decarboxylase, isoform CRA_b   50.8    2e-04   Homo sapiens [man]
ref|XP_008838768.1|  PREDICTED: diphosphomevalonate decarboxylase     52.4    2e-04   Nannospalax galili
ref|XP_003228605.1|  PREDICTED: diphosphomevalonate decarboxylase     52.4    2e-04   Anolis carolinensis [Carolina anole]
ref|XP_006721255.1|  PREDICTED: diphosphomevalonate decarboxylase...  51.2    2e-04   
gb|EAW66790.1|  mevalonate (diphospho) decarboxylase, isoform CRA_a   51.6    3e-04   Homo sapiens [man]
ref|XP_006173825.1|  PREDICTED: diphosphomevalonate decarboxylase     51.6    3e-04   
ref|XP_010966484.1|  PREDICTED: diphosphomevalonate decarboxylase     51.6    3e-04   Camelus bactrianus [camel]
ref|XP_003917347.1|  PREDICTED: diphosphomevalonate decarboxylase     51.2    4e-04   Papio anubis [baboon]
ref|XP_010739786.1|  PREDICTED: diphosphomevalonate decarboxylase     51.2    4e-04   Larimichthys crocea [croceine croaker]
ref|NP_002452.1|  diphosphomevalonate decarboxylase                   51.2    4e-04   Homo sapiens [man]
ref|XP_005805001.1|  PREDICTED: diphosphomevalonate decarboxylase...  51.2    4e-04   Xiphophorus maculatus
gb|AAP36301.1|  Homo sapiens mevalonate (diphospho) decarboxylase     51.2    4e-04   synthetic construct
ref|XP_003970115.1|  PREDICTED: diphosphomevalonate decarboxylase...  51.2    5e-04   Takifugu rubripes [tiger puffer]
ref|XP_007992523.1|  PREDICTED: diphosphomevalonate decarboxylase...  51.2    5e-04   Chlorocebus sabaeus
ref|XP_005256369.1|  PREDICTED: diphosphomevalonate decarboxylase...  50.8    5e-04   
ref|XP_001376834.1|  PREDICTED: diphosphomevalonate decarboxylase     50.8    5e-04   Monodelphis domestica
dbj|GAM24015.1|  hypothetical protein SAMD00019534_071900             50.8    5e-04   Acytostelium subglobosum LB1
ref|XP_002111980.1|  hypothetical protein TRIADDRAFT_55561            50.8    6e-04   Trichoplax adhaerens
ref|XP_004058175.1|  PREDICTED: diphosphomevalonate decarboxylase     50.4    7e-04   
ref|XP_010792093.1|  PREDICTED: diphosphomevalonate decarboxylase     50.4    7e-04   Notothenia coriiceps [yellowbelly rockcod]
gb|KIK57461.1|  hypothetical protein GYMLUDRAFT_86887                 50.4    7e-04   Gymnopus luxurians FD-317 M1
ref|XP_010625831.1|  PREDICTED: diphosphomevalonate decarboxylase     50.4    8e-04   Fukomys damarensis [Damara mole rat]
ref|XP_004437181.1|  PREDICTED: diphosphomevalonate decarboxylase     50.4    8e-04   Ceratotherium simum simum [southern square-lipped rhinoceros]
emb|CDS06586.1|  hypothetical protein LRAMOSA09114                    50.1    9e-04   Lichtheimia ramosa
ref|XP_003805806.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    9e-04   Pan paniscus [bonobo]
ref|XP_003758532.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    9e-04   Sarcophilus harrisii
ref|XP_523460.3|  PREDICTED: diphosphomevalonate decarboxylase        50.1    9e-04   
ref|XP_004905145.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  50.1    9e-04   
ref|XP_003325100.1|  diphosphomevalonate decarboxylase                50.1    9e-04   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_004753891.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    9e-04   Mustela putorius furo [black ferret]
gb|AAH81784.1|  Mevalonate (diphospho) decarboxylase                  50.1    0.001   Rattus norvegicus [brown rat]
ref|XP_004842741.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    0.001   Heterocephalus glaber [naked mole rat]
ref|XP_008308874.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    0.001   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007549941.1|  PREDICTED: diphosphomevalonate decarboxylase     50.1    0.001   Poecilia formosa
ref|XP_010353864.1|  PREDICTED: diphosphomevalonate decarboxylase...  50.1    0.001   Rhinopithecus roxellana
ref|NP_112324.1|  diphosphomevalonate decarboxylase                   50.1    0.001   Rattus norvegicus [brown rat]



>emb|CDO99902.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   206 bits (524),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 109/116 (94%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+QRLLF+FPP SD DL+SY++GDKS+L DAGI+DL
Sbjct  309  QVAYTFDAGPNAVLIARNRKVAALLLQRLLFHFPPQSDADLNSYIVGDKSVLMDAGIQDL  368

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDN+PT K KGDVSYFICTRPGRGPV+L++E+QALLNPETGLPK
Sbjct  369  KDVEALPPPPEIKDNVPTQKFKGDVSYFICTRPGRGPVLLTEESQALLNPETGLPK  424



>ref|XP_010088787.1| Diphosphomevalonate decarboxylase [Morus notabilis]
 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis]
Length=400

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+QRLLFYFPPNSD DL+SY+ GDKSIL DAG+  L
Sbjct  285  QVAYTFDAGPNAVLIARNRKVAALLLQRLLFYFPPNSDADLNSYIHGDKSILQDAGLAGL  344

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDNIP+ K +GDVSYFICTRPGRGPV LSDE+QALLNPETGLPK
Sbjct  345  KDVEALPPPPEIKDNIPSQKYRGDVSYFICTRPGRGPVYLSDESQALLNPETGLPK  400



>gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=406

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 108/116 (93%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA L++QRLLF+FPPNSDTDL+SYVIGDKSIL DAGI+D+
Sbjct  291  QVAYTFDAGPNAVLIARNRKAATLMLQRLLFHFPPNSDTDLNSYVIGDKSILKDAGIQDI  350

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L+D++ ALLNPETGLPK
Sbjct  351  KDVEALPPPPEIKDKVPAQKYKGEISYFICTRPGRGPVLLTDDSHALLNPETGLPK  406



>ref|XP_009795010.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 108/116 (93%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA L++QRLLF+FPPNSDTDL+SYVIGDKSIL DAGI+D+
Sbjct  306  QVAYTFDAGPNAVLIARNRKAATLMLQRLLFHFPPNSDTDLNSYVIGDKSILKDAGIQDI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L+D++ ALLNPETGLPK
Sbjct  366  KDVEALPPPPEIKDKVPAQKYKGEISYFICTRPGRGPVLLTDDSHALLNPETGLPK  421



>ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=421

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAAAL++QRLLF+FPPNSDTDL SYVIGDKSIL DAGI+DL
Sbjct  306  QVAYTFDAGPNAVLIARNRKAAALMLQRLLFHFPPNSDTDLDSYVIGDKSILKDAGIQDL  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            NDVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L DE+QALL  ETGLPK
Sbjct  366  NDVEALPPPPEIKDKVPAQKCKGEISYFICTRPGRGPVLLPDESQALLCLETGLPK  421



>ref|XP_009630346.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 108/116 (93%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA L++QRLLF+FPPNSDTDL+SYVIGDKSIL DAGI+D+
Sbjct  307  QVAYTFDAGPNAVLIARNRKAATLMLQRLLFHFPPNSDTDLNSYVIGDKSILKDAGIQDI  366

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L+D++ ALLNPETGLPK
Sbjct  367  KDVEALPPPPEIKDKVPAQKYKGEISYFICTRPGRGPVLLTDDSHALLNPETGLPK  422



>ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
 gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
Length=422

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA L++QRLLF+FPPNSDTDL SYVIGDKSIL DAGIKDL
Sbjct  307  QVAYTFDAGPNAVLIARNRKAATLMLQRLLFHFPPNSDTDLDSYVIGDKSILKDAGIKDL  366

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            ND+EALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L DE+QALL  ETGLPK
Sbjct  367  NDIEALPPPPEIKDKVPAQKCKGEISYFICTRPGRGPVLLPDESQALLCLETGLPK  422



>ref|XP_010032077.1| PREDICTED: diphosphomevalonate decarboxylase-like [Eucalyptus 
grandis]
 gb|KCW51467.1| hypothetical protein EUGRSUZ_J00991 [Eucalyptus grandis]
Length=418

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 110/116 (95%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA+LL+QRLL+YFPPN +TD++SYV+GDKSIL DAGI+ +
Sbjct  303  QVAYTFDAGPNAVLIARNRKAASLLIQRLLYYFPPNPETDMNSYVLGDKSILKDAGIQGI  362

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            +DVEALPPPPEIKD IP  KN+G+VSYFICTRPGRGPVVLSDE+QAL++P+TGLPK
Sbjct  363  DDVEALPPPPEIKDKIPAQKNRGEVSYFICTRPGRGPVVLSDESQALIDPKTGLPK  418



>ref|XP_009792788.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 108/116 (93%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR +AALL+QRLLF+FPPNS+TDL+SYVIGDKSIL DAGI+++
Sbjct  306  QVAYTFDAGPNAVLIARNRTSAALLLQRLLFHFPPNSETDLNSYVIGDKSILKDAGIQEI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV++SDE+QALLNP TGLPK
Sbjct  366  KDVEALPPPPEIKDKVPVQKCKGEISYFICTRPGRGPVLISDESQALLNPYTGLPK  421



>ref|XP_009619582.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 108/116 (93%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR +AALL+QRLLF+FPPNS+TDL+SYVIGDKSIL DAGI ++
Sbjct  306  QVAYTFDAGPNAVLIARNRTSAALLLQRLLFHFPPNSETDLNSYVIGDKSILKDAGIPEI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV++SDE+QALLNP+TGLPK
Sbjct  366  KDVEALPPPPEIKDKVPVQKCKGEISYFICTRPGRGPVLISDESQALLNPDTGLPK  421



>gb|AII99848.1| mevalonate disphosphate decarboxylase [Nicotiana tabacum]
Length=418

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYT DAGPNAV+IARNRKAA L++QRLLF+FPPNSDTDL+SYVIGDKSIL DAGI+D+
Sbjct  303  QVAYTSDAGPNAVLIARNRKAATLMLQRLLFHFPPNSDTDLNSYVIGDKSILKDAGIQDI  362

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD +P  K KG++SYFICTRPGRGPV+L+D++ ALLNPETGLPK
Sbjct  363  KDVEALPPPPEIKDKVPAQKYKGEISYFICTRPGRGPVLLTDDSHALLNPETGLPK  418



>gb|AFK38744.1| unknown [Medicago truncatula]
Length=191

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA LL+Q+LL+YFPPNSD DL+SY+IGDKSI  DAGI  +
Sbjct  77   QVAYTFDAGPNAVLIARNRKAATLLIQKLLYYFPPNSD-DLNSYIIGDKSIAKDAGINGI  135

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPEIKDNIP+ K KGDVSYFICTRPGRGPVVL+DE+QALLN E GLPK
Sbjct  136  EDIEALPPPPEIKDNIPSQKYKGDVSYFICTRPGRGPVVLTDESQALLNSENGLPK  191



>dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRKAAA L+Q+LLFYFPPNSDT+L+SYV+GDKSIL DAGI+DL
Sbjct  303  QVAYTFDAGPNAVLIAHNRKAAAQLLQKLLFYFPPNSDTELNSYVLGDKSILKDAGIEDL  362

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD    + KGDVSYFICTRPGRGPV+LSDE+QALL+PETGLPK
Sbjct  363  KDVEALPPPPEIKD--APRYKGDVSYFICTRPGRGPVLLSDESQALLSPETGLPK  415



>gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus]
Length=417

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV++ARNRK AALL+QRLLF+FPP SDT+L SYVIGDK+IL D G++D+
Sbjct  302  QVAYTFDAGPNAVLVARNRKTAALLLQRLLFHFPPQSDTNLDSYVIGDKTILQDVGVQDM  361

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPEIKD IPT K+KGDVSYFICTRPGRGPVVLSDE+QALL+P TGLPK
Sbjct  362  KDVEALTPPPEIKDYIPTQKSKGDVSYFICTRPGRGPVVLSDESQALLDPVTGLPK  417



>gb|AFO67223.1| putative mevalonate diphosphate decarboxylase, partial [Aralia 
elata]
Length=126

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 107/115 (93%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AALL+QRLLF+FPP+S+TDL+SYVIGDKSIL D G++D+
Sbjct  12   QVAYTFDAGPNAVLIARDRKIAALLLQRLLFHFPPHSNTDLNSYVIGDKSILQDVGVQDM  71

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLP  267
             DVEALPPPPEIKDNIP  K+KGDVSYFICTRPGRGPV+L D ++ALLNPETGLP
Sbjct  72   KDVEALPPPPEIKDNIPAQKSKGDVSYFICTRPGRGPVLLPD-SRALLNPETGLP  125



>gb|KDP35789.1| hypothetical protein JCGZ_10425 [Jatropha curcas]
Length=415

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA L+Q+LLF+FPPNSDTDL+SYVIGDKSIL DAGI+++
Sbjct  303  QVAYTFDAGPNAVLIAQNRKTAAQLLQKLLFFFPPNSDTDLNSYVIGDKSILKDAGIQEI  362

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD   ++ KGDVSYFICTRPGRGPV+LSDE+ ALLNPETGLPK
Sbjct  363  KDVEALPPPPEIKD--ASRYKGDVSYFICTRPGRGPVLLSDESHALLNPETGLPK  415



>gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus]
Length=421

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA LL+QRLLFYFPP S  +L+SYV+GDKSIL DAGI+D+
Sbjct  306  QVAYTFDAGPNAVLIARNRKAATLLLQRLLFYFPPESGANLNSYVVGDKSILKDAGIQDM  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVE+L PPPE+KDNIP  K KGDVSYFICTRPGRGPV+L++E+Q+LLNPETGLPK
Sbjct  366  KDVESLCPPPEVKDNIPAQKYKGDVSYFICTRPGRGPVLLTEESQSLLNPETGLPK  421



>ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera]
 emb|CBI35263.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AA L+QRLL+YFPP+SDTDL+SYVIGDKSILGD G++++
Sbjct  307  QVAYTFDAGPNAVLIARDRKVAANLLQRLLYYFPPHSDTDLNSYVIGDKSILGDVGVEEM  366

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPE KD IP  K +G VSYFICTRPG+GPV+LSDE+QALLNPE+GLPK
Sbjct  367  KDVEALPPPPETKDQIPAQKQRGAVSYFICTRPGKGPVLLSDESQALLNPESGLPK  422



>gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 106/115 (92%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRKAAA L+Q+LLFYFPPNSDT+L+SYV+GDKSIL DAGI+DL
Sbjct  303  QVAYTFDAGPNAVLIAHNRKAAAQLLQKLLFYFPPNSDTELNSYVLGDKSILKDAGIEDL  362

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD    + KGDVSYFICTRPG+GPV+LSDE+QALL+PETGLPK
Sbjct  363  KDVEALPPPPEIKD--APRYKGDVSYFICTRPGQGPVLLSDESQALLSPETGLPK  415



>gb|KEH44325.1| mevalonate diphosphate decarboxylase [Medicago truncatula]
Length=418

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA LL+Q+LL+YFPPNSD DL+SY+IGDKSI  DAGI  +
Sbjct  304  QVAYTFDAGPNAVLIARNRKAATLLIQKLLYYFPPNSD-DLNSYIIGDKSIAKDAGINGI  362

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPEIKDNIP+ K KGDVSYFICTRPGRGPVVL+DE+QALLN E GLPK
Sbjct  363  EDIEALPPPPEIKDNIPSQKYKGDVSYFICTRPGRGPVVLTDESQALLNSENGLPK  418



>ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=420

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA  L+QRLL+YFPPNSD DLSSY+IGDKSI  DAGI  +
Sbjct  306  QVAYTFDAGPNAVLIARNRKAATSLIQRLLYYFPPNSD-DLSSYIIGDKSIAKDAGINGI  364

Query  428  NDVEALPPPPEIKDNI-PTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDNI P K KGDVSYFICTRPGRGPV+LSD +QALLN ETGLPK
Sbjct  365  QDVEALPPPPEIKDNIPPQKYKGDVSYFICTRPGRGPVLLSDSSQALLNGETGLPK  420



>gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza]
Length=422

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+I++NRK AALL+QRLLF+FPP SD DL+SYVIGDK+IL DAGI+DL
Sbjct  307  QVAYTFDAGPNAVLISKNRKTAALLLQRLLFHFPPQSDADLNSYVIGDKTILKDAGIEDL  366

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EAL PPPEIK+N  T+  +GDVSYFICTRPGRGPVVL+DE+Q+L+NPETGLPK
Sbjct  367  KDIEALAPPPEIKENASTQRCRGDVSYFICTRPGRGPVVLADESQSLINPETGLPK  422



>ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=421

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA  L+QRLL+YFPPNSD DLSSY+IGDKSI  DAGI  +
Sbjct  307  QVAYTFDAGPNAVLIARNRKAATSLIQRLLYYFPPNSD-DLSSYIIGDKSIAKDAGINGI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDNIP+ K KGDVSYFICTRPGRGPV+LSD  QALLN ETGLPK
Sbjct  366  QDVEALPPPPEIKDNIPSQKYKGDVSYFICTRPGRGPVLLSDSIQALLNDETGLPK  421



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 120/162 (74%), Gaps = 10/162 (6%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA  L+QRLL+YFPPNSD DLSSY+IGDKSI  DAGI  +
Sbjct  306  QVAYTFDAGPNAVLIARNRKAATSLIQRLLYYFPPNSD-DLSSYIIGDKSIAKDAGINGI  364

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*RTK  252
             DVEALPPPPEIKDNIP  K KGDVSYFICTRPGRGPV+LSD +QALLN ETGLPK R  
Sbjct  365  QDVEALPPPPEIKDNIPPQKYKGDVSYFICTRPGRGPVLLSDNSQALLNGETGLPKMRPA  424

Query  251  RFLSQKLPF*NGKVLCNHYNSRHFLLSFFVSS----WVPFRV  138
              L+ KL       LC  Y+S  F    F +S    W P  V
Sbjct  425  G-LTWKL---KTLTLCKAYSSMAFHAMDFETSIEFFWAPLLV  462



>emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
Length=451

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AA L+QRLL+YFPP+SDTDL+SYVIGDKSILGD G++++
Sbjct  292  QVAYTFDAGPNAVLIARDRKVAANLLQRLLYYFPPHSDTDLNSYVIGDKSILGDVGVEEM  351

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPE KD IP  K +G VSYFICTRPG+GP +LSDE+QALLNPE+GLPK
Sbjct  352  KDVEALPPPPETKDQIPAQKQRGAVSYFICTRPGKGPXLLSDESQALLNPESGLPK  407



>ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum]
Length=421

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 107/116 (92%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR  AALL+QRLLF+FPPNS+TDL+SYVIGDKS++ D GI+D+
Sbjct  306  QVAYTFDAGPNAVLIARNRTYAALLLQRLLFHFPPNSETDLNSYVIGDKSLMEDIGIQDI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPEIKD +P  K KG++SYFICTRPGRGPV++SD++QALL+P+TGLPK
Sbjct  366  KDIEALPPPPEIKDKVPAQKYKGEISYFICTRPGRGPVLISDDSQALLHPDTGLPK  421



>gb|KHN11470.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=421

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 102/116 (88%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR AA  L+QRLL+YFPPNSD DLSSY+IGDKSI  DAGI  +
Sbjct  307  QVAYTFDAGPNAVLIARNRNAATSLIQRLLYYFPPNSD-DLSSYIIGDKSIAKDAGINGI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDNIP+ K KGDVSYFICTRPGRGPV+LSD  QALLN ETGLPK
Sbjct  366  QDVEALPPPPEIKDNIPSQKYKGDVSYFICTRPGRGPVLLSDSIQALLNDETGLPK  421



>ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum]
Length=421

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 104/116 (90%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA LL+QRLL+YFPPNSD DL+SY+IGDKSI  DAGI  +
Sbjct  307  QVAYTFDAGPNAVLIARNRKAATLLIQRLLYYFPPNSD-DLNSYIIGDKSIAKDAGINGI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E LPPPPEIKDNIP+ K KG+VSYFICTRPGRGPV+LSDE+QALLN E GLPK
Sbjct  366  PDIETLPPPPEIKDNIPSQKYKGEVSYFICTRPGRGPVLLSDESQALLNSENGLPK  421



>gb|AFM77982.1| mevalonate diphosphate decarboxylase [Eleutherococcus senticosus]
Length=420

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 106/116 (91%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AALL+QRLLF+FPP+SDTDL+SYVIGDKSIL D G++D+
Sbjct  306  QVAYTFDAGPNAVLIARDRKTAALLLQRLLFHFPPHSDTDLNSYVIGDKSILQDVGVQDI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DV+ALPPPPEIKDNIP  K+KGDVSYFICT+PGRGP +L D +QALLNPETG PK
Sbjct  366  KDVKALPPPPEIKDNIPAQKSKGDVSYFICTKPGRGPFLLPD-SQALLNPETGFPK  420



>ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRKAA  L+Q+LLFYFPP+SD DL+SYVIGDKSIL DAGI+D+
Sbjct  304  QVAYTFDAGPNAVLIAHNRKAATQLLQKLLFYFPPSSDADLNSYVIGDKSILKDAGIEDM  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPEIK+    ++KGDVSYFICT+PGRGPV+LSDE+QALL+PETGLPK
Sbjct  364  KDVEALSPPPEIKN--AQRSKGDVSYFICTKPGRGPVLLSDESQALLHPETGLPK  416



>ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 102/115 (89%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRKAA  L+Q+LLF FPP+SD DL+SYVIGDKSIL DAGI+D+
Sbjct  304  QVAYTFDAGPNAVLIAHNRKAATQLMQKLLFCFPPSSDADLNSYVIGDKSILKDAGIEDI  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD    + KGDVSYFICT+PGRGP +LSDE+QALL+PETGLPK
Sbjct  364  KDVEALPPPPEIKD--AQRCKGDVSYFICTKPGRGPALLSDESQALLHPETGLPK  416



>ref|XP_010676219.1| PREDICTED: diphosphomevalonate decarboxylase-like [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RKAA+LL+QR+LF+FPP ++TDL+SYVIGDKSIL DAGIK++
Sbjct  305  QVAYTFDAGPNAVLIARDRKAASLLLQRMLFHFPPGAETDLNSYVIGDKSILQDAGIKNI  364

Query  428  NDVEALPPPPEIKD-NIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVE+LP PPE+KD N   K+ GDVSYFICTRPG+GP VLSDE+Q+LLNPETGLPK
Sbjct  365  KDVESLPNPPELKDANSIQKHPGDVSYFICTRPGQGPTVLSDESQSLLNPETGLPK  420



>gb|AID51442.1| mevalonate diphosphate decarboxylase [Astragalus membranaceus]
Length=420

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAA +L+Q+LL+YFPPNSD DL SY+IGDKSI  DAGI  +
Sbjct  306  QVAYTFDAGPNAVLIARNRKAATILIQKLLYYFPPNSD-DLDSYIIGDKSIAKDAGINGI  364

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPP EIKD IP+ K KGDVSYFICTRPGRGP VLSDE+QALLN E GLPK
Sbjct  365  QDIEALPPPSEIKDKIPSQKYKGDVSYFICTRPGRGPAVLSDESQALLNSENGLPK  420



>ref|XP_011024216.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 103/115 (90%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRKAA  L+Q+LLFYFPP+SD DL+SYVIGDKSIL DAGI+D+
Sbjct  304  QVAYTFDAGPNAVLIAHNRKAATQLLQKLLFYFPPSSDADLNSYVIGDKSILKDAGIEDM  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPEIK+    ++KGDVSYFICT+PGRGPV+L DE+QALL+PETGLPK
Sbjct  364  KDVEALSPPPEIKN--AQRSKGDVSYFICTKPGRGPVLLYDESQALLHPETGLPK  416



>ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
Length=415

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 104/115 (90%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK A  L+Q+LL+YFPPNSDTDL+SYV+GDKSIL DAGI+++
Sbjct  303  QVAYTFDAGPNAVLIAQNRKTAVQLLQKLLYYFPPNSDTDLNSYVLGDKSILKDAGIEEM  362

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVE+LP PPEIKD    + KGDVSYFICTRPGRGPV+L+DE+QALLNP+TGLPK
Sbjct  363  KDVESLPAPPEIKD--APRFKGDVSYFICTRPGRGPVLLTDESQALLNPQTGLPK  415



>ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
Length=418

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRKAAA L+QRLLFYFPP SD DL SYVIGDKSIL DAG++ L
Sbjct  303  QVAYTFDAGPNAVLIARNRKAAAQLLQRLLFYFPPKSDIDLDSYVIGDKSILQDAGLEGL  362

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPEIK+N    K  G+VSYFICTRPGRGPV+L++E  ALLNPETGLPK
Sbjct  363  KDVEALSPPPEIKENAAAQKYPGEVSYFICTRPGRGPVLLTNENLALLNPETGLPK  418



>ref|XP_011032862.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 101/115 (88%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA +R AA  L+Q+LLF FPP+SD DL+SYVIGDKSIL DAGI+D+
Sbjct  304  QVAYTFDAGPNAVLIAHDRNAATQLMQKLLFCFPPSSDADLNSYVIGDKSILKDAGIEDI  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKD    + KGDVSYFICT+PGRGP +LSDE+QALL+PETGLPK
Sbjct  364  KDVEALPPPPEIKD--AQRCKGDVSYFICTKPGRGPALLSDESQALLHPETGLPK  416



>ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=429

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR + +LL+QRLLF+FPPNS+TDL+SYVIGDKS++ D GI+D+
Sbjct  314  QVAYTFDAGPNAVLIARNRTSTSLLLQRLLFHFPPNSETDLNSYVIGDKSLMEDIGIQDI  373

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPEIK  +P  K KG++SYFICTRPGRGPV++S ++QALL+P++GLPK
Sbjct  374  KDIEALPPPPEIKGKVPAQKYKGEISYFICTRPGRGPVLISGDSQALLHPDSGLPK  429



>ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
 gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
Length=419

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 3/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR+ AALLVQ+LLF FPP SD DL+S+V+GDKSIL DAG++ L
Sbjct  306  QVAYTFDAGPNAVLIARNRETAALLVQKLLFCFPPKSDADLNSFVLGDKSILKDAGVESL  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              +E+LP PPEIKD  P+ +++GDVSYFICTRPGRGPVVLSDE+Q LLNPETGLPK
Sbjct  366  EAIESLPAPPEIKD--PSQRHRGDVSYFICTRPGRGPVVLSDESQFLLNPETGLPK  419



>ref|XP_008232018.1| PREDICTED: diphosphomevalonate decarboxylase-like [Prunus mume]
Length=419

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 3/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR+ AALLVQ+LLF FPP SD DL+S+V+GDKSIL DAG++ L
Sbjct  306  QVAYTFDAGPNAVLIARNRETAALLVQKLLFCFPPKSDADLNSFVLGDKSILKDAGVESL  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              +E+LP PPEIKD  P+ +++GDVSYFICTRPGRGPVVLSDE+Q LLNPETGLPK
Sbjct  366  EAIESLPAPPEIKD--PSQRHRGDVSYFICTRPGRGPVVLSDESQFLLNPETGLPK  419



>ref|XP_010244659.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nelumbo nucifera]
Length=421

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR+ A+L++QRLLFYFPP   T+L+SYV+GDKSIL DAG++  
Sbjct  306  QVAYTFDAGPNAVLIARNREVASLMLQRLLFYFPPPPATELTSYVLGDKSILKDAGLEMR  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPE KDNIP+ K  GDVSYFICTRPGRGPV+L+DE+QALL+PETGLPK
Sbjct  366  KDVEALSPPPETKDNIPSQKYAGDVSYFICTRPGRGPVLLADESQALLHPETGLPK  421



>ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
Length=417

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = -2

Query  605  VAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLN  426
            VAYTFDAGPNAV+IARNRKAAA L+QRLLFYFPP SD DL SYVIGDKSIL DAG++ L 
Sbjct  303  VAYTFDAGPNAVLIARNRKAAAQLLQRLLFYFPPKSDIDLDSYVIGDKSILQDAGLEGLK  362

Query  425  DVEALPPPPEIKDNIPTKNK-GDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            DVEAL PPPEIK+N   +   G+VSYFICTRPGRGPV+L++E  ALLNPETGLPK
Sbjct  363  DVEALSPPPEIKENAAAQKYPGEVSYFICTRPGRGPVLLTNENLALLNPETGLPK  417



>ref|XP_008345749.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 100/115 (87%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALLVQ+LLF FPPNSD DL+S+V+GDKSIL DAG++  
Sbjct  306  QVAYTFDAGPNAVLIARNRKTAALLVQKLLFCFPPNSDADLNSFVLGDKSILKDAGVESP  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E LPPPPEIKD    K +GDVSYFICTRPGRGPVVLSDE+  LLNPETGLPK
Sbjct  366  EDIETLPPPPEIKDP-SQKFRGDVSYFICTRPGRGPVVLSDESH-LLNPETGLPK  418



>ref|XP_009356125.1| PREDICTED: diphosphomevalonate decarboxylase [Pyrus x bretschneideri]
Length=418

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+Q+LLF FPPNSD DLSS+V+GDKSIL DAG++  
Sbjct  306  QVAYTFDAGPNAVLIARNRKTAALLIQKLLFCFPPNSDADLSSFVLGDKSILKDAGVESP  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E LP PPEIKD    K +GDVSYFICTRPGRGPVVLSDE+  LLNPETGLPK
Sbjct  366  GDIETLPAPPEIKDP-SQKFRGDVSYFICTRPGRGPVVLSDESH-LLNPETGLPK  418



>emb|CDX73494.1| BnaC08g25090D [Brassica napus]
Length=419

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGE  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI T++ KG+VSYFICTRPGRGPVVL D+TQALL+PETGLPK
Sbjct  364  NSVENLQPPPEIKDNIGTQDQKGEVSYFICTRPGRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_008364764.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR+ AALL+Q+LLF FPPNSD DL+S+V+GDKSIL DAG++  
Sbjct  306  QVAYTFDAGPNAVLIARNRETAALLIQKLLFCFPPNSDADLNSFVLGDKSILKDAGVESP  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E LPPPPEIKD    K +GDVSYFICTRPGRGPVVLSDE+  LLNPETGLPK
Sbjct  366  EDIETLPPPPEIKDP-SQKFRGDVSYFICTRPGRGPVVLSDESH-LLNPETGLPK  418



>ref|XP_011102052.1| PREDICTED: diphosphomevalonate decarboxylase-like, partial [Sesamum 
indicum]
Length=149

 Score =   172 bits (435),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  614  IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIK  435
            ++QVAYTFDAGPNAV+I+ NRKAAALL+QRLLFYFPP +D DL+SYVIGDK+IL DAGI+
Sbjct  32   LSQVAYTFDAGPNAVLISHNRKAAALLLQRLLFYFPPQADADLNSYVIGDKTILQDAGIQ  91

Query  434  DLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            ++ D+EAL PPPEIKDN  T K +GDVSYFICTRPGRGPVVL+DE+++L+NPETGLPK
Sbjct  92   NVKDIEALTPPPEIKDNTQTQKYRGDVSYFICTRPGRGPVVLTDESRSLINPETGLPK  149



>ref|XP_010504223.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504224.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504225.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+ + 
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDEA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  364  NGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  419



>gb|KDO47063.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
 gb|KDO47064.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=277

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+QRLLF+FPPNS+TDL+SYV+GDKSIL DAGI  +
Sbjct  161  QVAYTFDAGPNAVLIARNRKIATELLQRLLFFFPPNSETDLNSYVLGDKSILRDAGIDGM  220

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALP PPEI +    K  GDV+YFICTRPG GPV+LSD+++ALLNP++GLPK
Sbjct  221  KDIEALPLPPEINNISAQKYSGDVNYFICTRPGGGPVLLSDDSKALLNPKSGLPK  275



>ref|XP_008356850.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 99/115 (86%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNR  AALL+Q+LLF FPPNSD DL+S+V+GDKSIL DAG++  
Sbjct  306  QVAYTFDAGPNAVLIARNRXTAALLIQKLLFCFPPNSDADLNSFVLGDKSILKDAGVESP  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E LPPPPEIKD    K +GDVSYFICTRPGRGPVVLSDE+  LLNPETGLPK
Sbjct  366  EDIETLPPPPEIKDP-SQKFRGDVSYFICTRPGRGPVVLSDESH-LLNPETGLPK  418



>ref|XP_006291202.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
 gb|EOA24100.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
Length=419

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 100/116 (86%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTDL SYV+GD SIL +AG+ + 
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDLKSYVVGDNSILKEAGLDEA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI T++ KG+VSYFICTRPG+GP+V+ D+TQALL+PETGLPK
Sbjct  364  SGVENLQPPPEIKDNIGTQDQKGEVSYFICTRPGKGPIVIHDQTQALLDPETGLPK  419



>ref|XP_009139253.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brassica rapa]
Length=419

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI +++ KG+VSYFICT+PGRGPVVL D+TQALL+PETGLPK
Sbjct  364  NSVENLQPPPEIKDNIGSQDQKGEVSYFICTKPGRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_006403599.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45052.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=419

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+I+RNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLISRNRKVAVQLLQGLLYYFPPKSDTDMRSYVVGDHSILKEAGLDGE  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE+L PPPEIKDNI +++ KG+VSYFICTRPGRGPVVL D+T ALL+PETGLPK
Sbjct  364  NSVESLQPPPEIKDNIGSQDQKGEVSYFICTRPGRGPVVLPDQTHALLHPETGLPK  419



>ref|XP_009116111.1| PREDICTED: diphosphomevalonate decarboxylase [Brassica rapa]
 emb|CDX78223.1| BnaA09g34180D [Brassica napus]
Length=419

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGE  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEI+DNI +++ KG+VSYFICTRPGRGPVVL D+TQALL+PETGLPK
Sbjct  364  NSVENLQPPPEIRDNIGSQDQKGEVSYFICTRPGRGPVVLPDQTQALLDPETGLPK  419



>emb|CDX76157.1| BnaA04g04210D [Brassica napus]
Length=419

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI +++ KG+VSYFICT+PGRGPVVL D+TQALL+PETGLPK
Sbjct  364  NSVENLQPPPEIKDNIGSQDQKGEVSYFICTKPGRGPVVLPDQTQALLDPETGLPK  419



>emb|CDY65399.1| BnaCnng46900D [Brassica napus]
Length=419

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP S+TD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSETDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI +++ KG+VSYFICT+PGRGPVVL D+TQALL+PETGLPK
Sbjct  364  NSVENLQPPPEIKDNIGSQDQKGEVSYFICTKPGRGPVVLPDQTQALLDPETGLPK  419



>gb|KDO47062.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=378

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+QRLLF+FPPNS+TDL+SYV+GDKSIL DAGI  +
Sbjct  262  QVAYTFDAGPNAVLIARNRKIATELLQRLLFFFPPNSETDLNSYVLGDKSILRDAGIDGM  321

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALP PPEI +    K  GDV+YFICTRPG GPV+LSD+++ALLNP++GLPK
Sbjct  322  KDIEALPLPPEINNISAQKYSGDVNYFICTRPGGGPVLLSDDSKALLNPKSGLPK  376



>gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=421

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+I+ NRK AALL+QRLLF FPP SDTDL SYVIGDK+IL DAGI ++
Sbjct  307  QVAYTFDAGPNAVLISHNRKTAALLLQRLLFLFPPQSDTDLDSYVIGDKTILKDAGIHEM  366

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPE+K+N PT+NKGDVSYFICTRPGRGPVVL+DE+++L+N ETGLPK
Sbjct  367  KDVEALAPPPELKENAPTRNKGDVSYFICTRPGRGPVVLNDESRSLINSETGLPK  421



>gb|KDO47059.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=420

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+QRLLF+FPPNS+TDL+SYV+GDKSIL DAGI  +
Sbjct  304  QVAYTFDAGPNAVLIARNRKIATELLQRLLFFFPPNSETDLNSYVLGDKSILRDAGIDGM  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALP PPEI +    K  GDV+YFICTRPG GPV+LSD+++ALLNP++GLPK
Sbjct  364  KDIEALPLPPEINNISAQKYSGDVNYFICTRPGGGPVLLSDDSKALLNPKSGLPK  418



>ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVAGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALLNPETGLPK
Sbjct  364  SGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLNPETGLPK  419



>ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
 gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
Length=420

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RKAA LLVQRLL+YFPPNSD DL SY+IGDKSI  DAGI  +
Sbjct  306  QVAYTFDAGPNAVLIARDRKAATLLVQRLLYYFPPNSD-DLDSYIIGDKSIAKDAGINGI  364

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPEIKDNIP+ K +GD+SYFICTRPGRGPV+LSD + ALLN ETGLPK
Sbjct  365  QDVEALPPPPEIKDNIPSQKYRGDISYFICTRPGRGPVLLSDSSLALLNDETGLPK  420



>gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis thaliana]
Length=419

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  364  SGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  419



>ref|XP_010427097.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010427098.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  364  SGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  419



>ref|NP_566995.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
 gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
Length=419

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  364  SGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  419



>emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis thaliana]
Length=413

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  298  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  357

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  358  SGVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  413



>ref|XP_006445713.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 ref|XP_006485205.1| PREDICTED: diphosphomevalonate decarboxylase-like [Citrus sinensis]
 gb|ESR58953.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=420

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+QRLLF+FPPNS+TDL+SYV+GDKSIL DAGI  +
Sbjct  304  QVAYTFDAGPNAVLIARNRKIATELLQRLLFFFPPNSETDLNSYVLGDKSILRDAGIDGM  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALP PPEI +    K  GDV+YFICTRPG GPV+LSD+++ALLNP++GLPK
Sbjct  364  KDIEALPLPPEINNISAQKYSGDVNYFICTRPGGGPVLLSDDSKALLNPKSGLPK  418



>ref|XP_011469322.1| PREDICTED: diphosphomevalonate decarboxylase [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 98/115 (85%), Gaps = 3/115 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVMIAR+RK A LL+Q+LL+ FPPNSD DL+S+V+GDKSIL DAGI   
Sbjct  307  QVAYTFDAGPNAVMIARDRKTATLLLQKLLYTFPPNSDADLNSFVLGDKSILKDAGINCP  366

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+ +LPPPPEIK     + KGDVSYFICTRPGRGPVVLSDET+ LL+PETG+PK
Sbjct  367  EDIASLPPPPEIKGQ---QYKGDVSYFICTRPGRGPVVLSDETKFLLDPETGMPK  418



>gb|KFK34679.1| hypothetical protein AALP_AA5G177200 [Arabis alpina]
Length=419

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP  DTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKPDTDMRSYVVGDTSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE+L PPPEIKDNI +++ KG+VSYFICTRPGRGPVVL D+TQALL+P TGLPK
Sbjct  364  NSVESLQPPPEIKDNIGSQDQKGEVSYFICTRPGRGPVVLHDQTQALLDPVTGLPK  419



>ref|XP_010515945.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515946.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515947.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 99/116 (85%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+Q LL+YFPP  DTD+ SYV+GD SIL +AG+ + 
Sbjct  304  QVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPPKPDTDMKSYVVGDNSILKEAGLDEA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            + VE L PPPEIKDNI +++ KG+VSYFICTRPG+GP+VL D+TQALL+PETGLPK
Sbjct  364  SSVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGKGPIVLHDQTQALLDPETGLPK  419



>gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
Length=421

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNA MIARNRK A LL+Q+LL+ FPP +D DL SYVIGDKS+L +AG+  +
Sbjct  306  QVAYTFDAGPNAAMIARNRKVATLLLQKLLYCFPPQADADLDSYVIGDKSLLKEAGVGTM  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            NDV+AL PPPE+  ++P  + KGDVSYFICTRPG+GPV+L+DE QALL+ +TGLPK
Sbjct  366  NDVDALAPPPELTTSVPAQRTKGDVSYFICTRPGKGPVLLTDENQALLDSKTGLPK  421



>ref|XP_011084229.1| PREDICTED: diphosphomevalonate decarboxylase-like [Sesamum indicum]
Length=422

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+I+ NRKAAALL+QRLLFYFPP +D DL+SYVIGDK+IL DAGI+++
Sbjct  307  QVAYTFDAGPNAVLISNNRKAAALLLQRLLFYFPPQADADLNSYVIGDKTILQDAGIQNV  366

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EAL PPPEIKDN  T K +GDVSYFICTRPGRGPVVL+DE+++L+NPETGLPK
Sbjct  367  KDIEALTPPPEIKDNTQTQKYRGDVSYFICTRPGRGPVVLTDESRSLINPETGLPK  422



>ref|XP_006391873.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
 gb|ESQ29159.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
Length=419

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRK A  L+Q LL+YFPP SDTD+ SYV+GD SIL +AG+   
Sbjct  304  QVAYTFDAGPNAVLIAGNRKVAVQLLQGLLYYFPPKSDTDMKSYVVGDNSILKEAGLDGA  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE L PPPEIKDNI +++ KG+VSYFICTRPGRGPVVL D+TQALL+ +TGLPK
Sbjct  364  NSVENLQPPPEIKDNIGSQDQKGEVSYFICTRPGRGPVVLPDQTQALLDKKTGLPK  419



>gb|KHG20401.1| Mvd [Gossypium arboreum]
Length=423

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RKAAA L+QRLLFYFPP SDTDL SY++GDK+IL DAG++ L
Sbjct  311  QVAYTFDAGPNAVLIARDRKAAAQLIQRLLFYFPPKSDTDLDSYLLGDKTILKDAGLEGL  370

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DV+AL PPPE  +    K  GDVSYFICTRPG+GP++LS++  ALL+PETGLPK
Sbjct  371  EDVKALSPPPE--NGSAQKYPGDVSYFICTRPGKGPILLSNDKLALLDPETGLPK  423



>gb|KHG20400.1| Mvd [Gossypium arboreum]
Length=459

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RKAAA L+QRLLFYFPP SDTDL SY++GDK+IL DAG++ L
Sbjct  347  QVAYTFDAGPNAVLIARDRKAAAQLIQRLLFYFPPKSDTDLDSYLLGDKTILKDAGLEGL  406

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DV+AL PPPE  +    K  GDVSYFICTRPG+GP++LS++  ALL+PETGLPK
Sbjct  407  EDVKALSPPPE--NGSAQKYPGDVSYFICTRPGKGPILLSNDKLALLDPETGLPK  459



>gb|KJB78629.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
 gb|KJB78630.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=415

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RKAAA L+QRLLFYFPP SDTDL SY++GDK+IL DAG++ L
Sbjct  303  QVAYTFDAGPNAVLIARDRKAAAQLIQRLLFYFPPKSDTDLDSYLLGDKTILKDAGLEGL  362

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL  PPE  +    K  GDVSYFICTRPG+GP++LS++  ALL+PETGLPK
Sbjct  363  KDVEALSSPPE--NGSAQKYPGDVSYFICTRPGKGPILLSNDKLALLDPETGLPK  415



>ref|XP_010536295.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Tarenaya hassleriana]
Length=439

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVMIARNR  A  L+Q+LL  FPPN DTD++SYV+GDKSIL +AG+   
Sbjct  305  QVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCFPPNPDTDMNSYVLGDKSILQEAGLGGA  364

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*RTKR  249
            N VEAL PPPE+K+N+   +KG+V+YFICTRPGRGPV+L D+T ALL+  TGLPK R  R
Sbjct  365  NGVEALHPPPEVKENV---HKGEVNYFICTRPGRGPVLLQDQTHALLDSATGLPKSRGAR  421



>gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=417

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 105/116 (91%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AALL++RLLF+FPP+S+TD +SYVIGDKSIL D G++D 
Sbjct  303  QVAYTFDAGPNAVLIARDRKIAALLLRRLLFHFPPHSNTDSNSYVIGDKSILQDVGVQDT  362

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E+LPPPPEIKDNIP  K+ GDVSYFICTRPGRGPV+L D ++ALLNPETGLPK
Sbjct  363  KDIESLPPPPEIKDNIPAQKSNGDVSYFICTRPGRGPVLLPD-SRALLNPETGLPK  417



>gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii]
Length=418

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 4/118 (3%)
 Frame = -2

Query  614  IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIK  435
            + QVAYTFDAGPN+V+IARNRK A  L+QRLLFYFPPN +TDL+SYV+GDKSIL DAGIK
Sbjct  302  VPQVAYTFDAGPNSVLIARNRKTAVSLLQRLLFYFPPNPETDLNSYVLGDKSILQDAGIK  361

Query  434  DLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             + D+E+L  PPEI  N P  K +GDVSYFICTRPG+GPVVL D +QALL+P+TGLPK
Sbjct  362  GVEDIESLLQPPEI--NSPFQKFQGDVSYFICTRPGKGPVVLPD-SQALLDPKTGLPK  416



>gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
Length=421

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A  L+QRLLFYFPP    +L+SYV+GD SIL DAG++++
Sbjct  307  QVAYTFDAGPNAVLIARNRKTAEALLQRLLFYFPP-PGAELTSYVLGDVSILHDAGLQEM  365

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPE+K  IP K + GDVSYFICT+PGRGP++L+D+ QALLNP TG+P+
Sbjct  366  KDVEALMPPPELKCQIPFKRHAGDVSYFICTKPGRGPMILNDKNQALLNPNTGIPQ  421



>ref|XP_010536297.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010536298.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X4 
[Tarenaya hassleriana]
Length=416

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 3/115 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVMIARNR  A  L+Q+LL  FPPN DTD++SYV+GDKSIL +AG+   
Sbjct  305  QVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCFPPNPDTDMNSYVLGDKSILQEAGLGGA  364

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VEAL PPPE+K+N+   +KG+V+YFICTRPGRGPV+L D+T ALL+  TGLPK
Sbjct  365  NGVEALHPPPEVKENV---HKGEVNYFICTRPGRGPVLLQDQTHALLDSATGLPK  416



>ref|XP_010536296.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Tarenaya hassleriana]
Length=423

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVMIARNR  A  L+Q+LL  FPPN DTD++SYV+GDKSIL +AG+   
Sbjct  305  QVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCFPPNPDTDMNSYVLGDKSILQEAGLGGA  364

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*RTK  252
            N VEAL PPPE+K+N+   +KG+V+YFICTRPGRGPV+L D+T ALL+  TGLP   T 
Sbjct  365  NGVEALHPPPEVKENV---HKGEVNYFICTRPGRGPVLLQDQTHALLDSATGLPNAETH  420



>ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
Length=420

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 98/116 (84%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YFPP  D DLSSY++GDKSILGDAG+  +
Sbjct  306  QVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYFPPQ-DKDLSSYLVGDKSILGDAGVHSM  364

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPPE+K  +P  K KGDVSYFIC+R G GP V++DE+QAL++  TGLPK
Sbjct  365  EDVEALPPPPEMK--VPDLKFKGDVSYFICSRLGAGPKVIADESQALIDSVTGLPK  418



>ref|XP_010554524.1| PREDICTED: diphosphomevalonate decarboxylase-like [Tarenaya hassleriana]
Length=412

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 92/115 (80%), Gaps = 7/115 (6%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVMIA NRK A  L+Q+LLF FPP  DTD++SYV+GDKSIL +AG +  
Sbjct  305  QVAYTFDAGPNAVMIAPNRKVAVQLLQKLLFCFPPKPDTDMNSYVLGDKSILQEAGFEGA  364

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            N VE LP PPE+K+       G+VSYFICTRPGRGP+VL D+T ALL+PETGLPK
Sbjct  365  NGVEGLPHPPEMKE-------GEVSYFICTRPGRGPIVLHDQTHALLDPETGLPK  412



>ref|XP_004954217.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=420

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+Q+L++YFPP  D DLSSY++GDKSILGDAG+  +
Sbjct  306  QVAYTFDAGPNAVLIARNRKTAALLLQKLMYYFPPQ-DKDLSSYLVGDKSILGDAGLHSI  364

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DV+ALP PPE+K  +P  K KGDVSYFIC+R G GP V++DE QAL++  TGLPK
Sbjct  365  EDVDALPAPPEMK--VPDQKFKGDVSYFICSRLGAGPKVVADENQALIDSVTGLPK  418



>gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=420

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AALL++RLLF+FPP     L+SYVIGDKSIL D G++D+
Sbjct  306  QVAYTFDAGPNAVLIARDRKIAALLLRRLLFHFPPTFQHCLNSYVIGDKSILQDVGVQDM  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E+LPPPPEIKDNIP  K+ GDVSYFICTRPGRGPV+L D + ALLNPETGLPK
Sbjct  366  KDIESLPPPPEIKDNIPAQKSNGDVSYFICTRPGRGPVLLPD-SGALLNPETGLPK  420



>ref|XP_004963234.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=425

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+Q+LL+YFPP  D DLSSY++GDKSIL DAG+  L
Sbjct  309  QVAYTFDAGPNAVLIARNRKTAALLLQKLLYYFPPQ-DKDLSSYLVGDKSILSDAGLHSL  367

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PPE+K +   K KGDVSYFIC+R G G  V++DE+QALL+  TGLPK
Sbjct  368  EDVEALPAPPEMKIH-DQKFKGDVSYFICSRLGVGINVVADESQALLDSVTGLPK  421



>ref|XP_004150845.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 ref|XP_004165172.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 gb|KGN52198.1| hypothetical protein Csa_5G615210 [Cucumis sativus]
Length=424

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 96/115 (83%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPN+V+IARNRKAA  L+QRLLF FPPN +T+L+SYV+GDK+IL DAGI  +
Sbjct  310  QVAYTFDAGPNSVLIARNRKAAVSLLQRLLFQFPPNPETELNSYVLGDKTILQDAGINSV  369

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E+LP PPE   +   K +GDVSYFICTRPG+GPVVL  E+ +LL+P+TGLPK
Sbjct  370  EDIESLPQPPEFNSS-SQKFQGDVSYFICTRPGKGPVVLP-ESDSLLDPKTGLPK  422



>ref|XP_009404708.1| PREDICTED: diphosphomevalonate decarboxylase-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            Q AYTFDAGPNAV+IA NRK+A LL+QRLLF FPP +D +L+SYVIGDKSIL +AG++ +
Sbjct  306  QAAYTFDAGPNAVLIAPNRKSAGLLLQRLLFCFPPPADNELTSYVIGDKSILHEAGLQSM  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALPPPP  KD  P+ K  G VSYFICTR G GP VL+DE+ ALL+P TGLPK
Sbjct  366  KDVEALPPPPVSKDKYPSQKFPGKVSYFICTRLGSGPRVLTDESLALLSPTTGLPK  421



>gb|AFW73864.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=390

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YFPP  D DLSSY++GDKSILG AG+  +
Sbjct  276  QVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYFPPQ-DNDLSSYLVGDKSILGVAGLHSM  334

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PPE K  IP  K KGDVSYFIC+R G GP V+SDE QAL++  TGLPK
Sbjct  335  KDVEALPAPPETK--IPDQKFKGDVSYFICSRLGAGPKVVSDEGQALIDSVTGLPK  388



>ref|XP_003565147.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brachypodium 
distachyon]
Length=417

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 92/115 (80%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK A LL+QRLL+ FPP  D DL SY++GDKSIL DAG++ +
Sbjct  303  QVAYTFDAGPNAVLIARNRKTATLLLQRLLYCFPPQ-DNDLDSYMVGDKSILSDAGLQSI  361

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PPE+K     K KGDVSYFIC+RPG GP VL DE+QAL++  TGL K
Sbjct  362  ADVEALPTPPEMK-TPNQKFKGDVSYFICSRPGAGPKVLVDESQALIDSATGLAK  415



>gb|AIK21783.1| mevalonate diphosphate decarboxylase [Panax notoginseng]
Length=420

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 100/116 (86%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IAR+RK AALL++RLLF+FP      L+SYVIGDKSIL D G++D+
Sbjct  306  QVAYTFDAGPNAVLIARDRKIAALLLRRLLFHFPXTFQHCLNSYVIGDKSILQDVGVQDM  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E+LPPPPEIKDNIP  K+ G VSYFICTRPGRGPV+L D ++ALLNPETGLPK
Sbjct  366  KDIESLPPPPEIKDNIPAQKSNGGVSYFICTRPGRGPVLLPD-SRALLNPETGLPK  420



>ref|XP_008446768.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis melo]
Length=424

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 95/115 (83%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPN+V+IARNRK A  L+QRLLF FPPN +T+L+SYV+GDKSIL DAGI  +
Sbjct  310  QVAYTFDAGPNSVLIARNRKTAVSLLQRLLFQFPPNPETELNSYVLGDKSILQDAGINSV  369

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+E+LP PPE   +   K +GDVSYFICTRPG+GPVVL  E+++LL+ +TGLPK
Sbjct  370  EDIESLPQPPEFNSS-SQKFQGDVSYFICTRPGKGPVVLP-ESESLLDLKTGLPK  422



>ref|NP_001149256.1| LOC100282878 [Zea mays]
 ref|XP_008643692.1| PREDICTED: LOC100282878 isoform X1 [Zea mays]
 gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gb|ACR36666.1| unknown [Zea mays]
 gb|AFW73865.1| diphosphomevalonate decarboxylase [Zea mays]
Length=420

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YFPP  D DLSSY++GDKSILG AG+  +
Sbjct  306  QVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYFPPQ-DNDLSSYLVGDKSILGVAGLHSM  364

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PPE K  IP  K KGDVSYFIC+R G GP V+SDE QAL++  TGLPK
Sbjct  365  KDVEALPAPPETK--IPDQKFKGDVSYFICSRLGAGPKVVSDEGQALIDSVTGLPK  418



>gb|EPS58605.1| hypothetical protein M569_16208, partial [Genlisea aurea]
Length=215

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 5/119 (4%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+I+ NRK A  L+QRLL+YFP  SD DL+ YVIGD++IL DAGI  L
Sbjct  98   QVAYTFDAGPNAVIISPNRKTATQLLQRLLYYFPA-SDPDLNRYVIGDETILKDAGISTL  156

Query  428  NDVEALPPPPEIKDN----IPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEAL PPPE K N    I     GD+SYF+ TRPGRGPVV++D T++L++P+TGLPK
Sbjct  157  QDVEALAPPPETKGNSNHPIGRSRGGDISYFVATRPGRGPVVVTDGTRSLVDPQTGLPK  215



>ref|XP_008665378.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
 gb|ACF86239.1| unknown [Zea mays]
 gb|ACN26377.1| unknown [Zea mays]
 tpg|DAA51251.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=420

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YFPP  D DLSSY++GDKSILGDAG+  +
Sbjct  306  QVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYFPPQ-DNDLSSYLVGDKSILGDAGLHSM  364

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PP+ K  IP  K KGDVSYFIC+R G GP V+ DE QAL++  TGLPK
Sbjct  365  KDVEALPAPPDTK--IPDQKFKGDVSYFICSRLGAGPKVVVDEGQALIDSVTGLPK  418



>gb|EMT01953.1| Diphosphomevalonate decarboxylase [Aegilops tauschii]
Length=456

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IARNRK AALL+QRLL+ FPP  + +L SY++GDKSIL  AG++ L
Sbjct  342  QVAYTFDAGPNAVLIARNRKTAALLLQRLLYCFPPQ-ENNLDSYMVGDKSILSSAGVQSL  400

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPE+K   PT K KGDVSYFIC+RPG GP VL++E   L++  TGL K
Sbjct  401  ADIEALPPPPEMK--TPTQKFKGDVSYFICSRPGAGPKVLTEERHTLIDSATGLAK  454



>ref|XP_008665377.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=497

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YFPP  D DLSSY++GDKSILGDAG+  +
Sbjct  383  QVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYFPPQ-DNDLSSYLVGDKSILGDAGLHSM  441

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP PP+ K  IP  K KGDVSYFIC+R G GP V+ DE QAL++  TGLPK
Sbjct  442  KDVEALPAPPDTK--IPDQKFKGDVSYFICSRLGAGPKVVVDEGQALIDSVTGLPK  495



>ref|XP_006836043.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
 gb|ERM98896.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
Length=419

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QV+YTFDAGPNAVM A NRK A+LL+QRLLFYFPP    DLSS+VIGD+SIL +AGI  +
Sbjct  305  QVSYTFDAGPNAVMFAPNRKVASLLLQRLLFYFPPLPGDDLSSFVIGDQSILQEAGIGSM  364

Query  428  NDVEALPPPPEIKDN-IPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DV++L PPPE KD+   +K+ G VSYFICTRPGRGP  L     AL++P+TGLPK
Sbjct  365  KDVQSLSPPPETKDSKFLSKHGGSVSYFICTRPGRGP-ELRAHGDALIHPQTGLPK  419



>dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa 
Japonica Group]
 dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
Length=421

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRK A +L+Q+LL+YFPP  D DLSSY++GDKSIL DAG+K +
Sbjct  307  QVAYTFDAGPNAVLIAPNRKNATILLQKLLYYFPPQ-DNDLSSYMVGDKSILSDAGLKSI  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP P E K  +P+ K KGDVSYFIC+R G GP V++DE+ AL++  TGLPK
Sbjct  366  EDVEALPAPAETK--MPSQKFKGDVSYFICSRLGAGPKVVTDESLALIDSVTGLPK  419



>gb|ACN41090.1| unknown [Picea sitchensis]
Length=422

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVM A NRK A LL+QRLLFYFPP+S    SSYVIGD SIL + G+  +
Sbjct  307  QVAYTFDAGPNAVMYAPNRKVAGLLLQRLLFYFPPDSSKTFSSYVIGDTSILEEIGVNSM  366

Query  428  NDVEALPPPPEIKDNIPTKNK-GDVSYFICTRPGRGPVVLSDETQALLNPETGLP  267
             DVE+L  PPE+K    +    G + YFICTRPG+GP++  +E QALLNP+TG P
Sbjct  367  KDVESLTAPPELKSESSSSTFPGGIDYFICTRPGKGPILFRNEDQALLNPKTGFP  421



>ref|XP_010067136.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010067137.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW65201.1| hypothetical protein EUGRSUZ_G02693 [Eucalyptus grandis]
Length=419

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -2

Query  614  IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIK  435
            + Q AYT+DAG N  + AR+RKAAALL+QRLL+YFPPN DTDLSSY++GDKSIL DAG++
Sbjct  302  VPQGAYTYDAGCNGFLFARDRKAAALLLQRLLYYFPPNPDTDLSSYILGDKSILKDAGLE  361

Query  434  DLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            ++NDVE LP PPEI+D +P +  +G++SYFICTRPG GPV++SD+ QALL+P TG PK
Sbjct  362  NINDVEKLPAPPEIQDEVPAQRFRGNISYFICTRPGPGPVMVSDQGQALLDPVTGFPK  419



>gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
Length=430

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 1/115 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QV+YTFDAGPNAV+ A +RK A LL+QRLL+YFPP+S  +LSSYVIGD SILG+ G+K +
Sbjct  310  QVSYTFDAGPNAVICAPSRKVAGLLLQRLLYYFPPDSSKELSSYVIGDTSILGEIGLKSM  369

Query  428  NDVEALPPPPEIK-DNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLP  267
             DVE+L  PPE +  N  + + G+V YFICTRPG+GP++L +E QA  N +TG P
Sbjct  370  KDVESLIAPPEFRSQNSSSIHPGEVDYFICTRPGKGPIILRNEDQAFFNNKTGFP  424



>gb|KFK36776.1| hypothetical protein AALP_AA4G169000 [Arabis alpina]
Length=414

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%), Gaps = 7/116 (6%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAV+IA++RK A  L+Q LL+ FPP SDTD+ SYVIGD SI+ +AG+   
Sbjct  305  EIAYTFDAGPNAVLIAKSRKVAVELMQGLLYCFPPKSDTDMKSYVIGDTSIVKEAGL---  361

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
               E    P EIKD I +++ KG+VSYFIC+RPG+GPVVL D+TQALL+P+TGLPK
Sbjct  362  ---EGREVPQEIKDKIGSQDQKGEVSYFICSRPGKGPVVLQDQTQALLHPQTGLPK  414



>emb|CDM86983.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
             VAYTFDAGPNAV+IARNRK   LL+QRLL+ FPP  + DL SY++GDKSIL  AG++ +
Sbjct  305  HVAYTFDAGPNAVLIARNRKTDTLLLQRLLYCFPPQ-ENDLDSYMVGDKSILSGAGVQSI  363

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+EALPPPPE+K     K KGDVSYFIC+RPG GP VL++E+  L++  TGL K
Sbjct  364  ADIEALPPPPEMK-TPNQKFKGDVSYFICSRPGAGPKVLTEESHTLIDSATGLAK  417



>tpg|DAA51253.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1460

 Score =   152 bits (384),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 79/116 (68%), Positives = 93/116 (80%), Gaps = 4/116 (3%)
 Frame = -2

Query  608   QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
             QVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YFPP  D DLSSY++GDKSILGDAG+  +
Sbjct  1346  QVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYFPPQ-DNDLSSYLVGDKSILGDAGLHSM  1404

Query  428   NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              DVEALP PP+ K  IP  K KGDVSYFIC+R G GP V+ DE QAL++  TGLPK
Sbjct  1405  KDVEALPAPPDTK--IPDQKFKGDVSYFICSRLGAGPKVVVDEGQALIDSVTGLPK  1458



>gb|EMS47869.1| Diphosphomevalonate decarboxylase [Triticum urartu]
Length=364

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 91/130 (70%), Gaps = 17/130 (13%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSD--------------TDLSSYVI  471
            QVAYTFDAGPNAV+IARNRK A LL+QRLL+ FPP  +               D  SY++
Sbjct  235  QVAYTFDAGPNAVLIARNRKTATLLLQRLLYTFPPQENDLDRYTTNMCTSDKHDHGSYML  294

Query  470  GDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQA  294
            GDKSIL DAG++ + DVEALP PPE+K   P  K KGDVSYFIC+RPG GP VL+DE  A
Sbjct  295  GDKSILSDAGLQSIADVEALPAPPEMK--APNQKFKGDVSYFICSRPGAGPKVLTDEGHA  352

Query  293  LLNPETGLPK  264
            L++  TGL K
Sbjct  353  LIDSATGLAK  362



>gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa]
Length=421

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = -2

Query  608  QVAYTFDAGPNA-VMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKD  432
            QVAYTFDAGP   +   +  K      +   F+FPPNSDTDL+SYVIGD++IL DAGIKD
Sbjct  305  QVAYTFDAGPKCRINFTQTEKLLPNFFKGCSFHFPPNSDTDLNSYVIGDQTILQDAGIKD  364

Query  431  LNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            L D+EAL  PPE K+N+   K +GDVSYFICT+PGRGP V++DE+++L+NPE GLPK
Sbjct  365  LKDIEALSTPPETKENLSAQKYRGDVSYFICTKPGRGPAVVNDESRSLINPEFGLPK  421



>ref|NP_181404.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
 emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
Length=412

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAVMIARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  304  EIAYTFDAGPNAVMIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDTSIVKEAGLEG-  362

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I +++ KG+VSYFIC+RPGRGPVVL D+TQALL+P+TGLPK
Sbjct  363  ------ELPQGIKDKIGSQDQKGEVSYFICSRPGRGPVVLQDQTQALLHPQTGLPK  412



>gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
Length=404

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 90/116 (78%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAVMIARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  296  EIAYTFDAGPNAVMIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDTSIVKEAGLEG-  354

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I +++ KG+VSYFIC+RPGRGPVVL D+TQALL+P+TGLPK
Sbjct  355  ------ELPQGIKDKIGSQDQKGEVSYFICSRPGRGPVVLQDQTQALLHPQTGLPK  404



>ref|XP_006294305.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
 gb|EOA27203.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
Length=412

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 90/116 (78%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAV+IARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  304  EIAYTFDAGPNAVLIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDTSIVKEAGLEG-  362

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I +++ KG+VSYFIC+RPGRGPVVL D+TQALL+P+TGLPK
Sbjct  363  ------ELPQGIKDKIGSQDQKGEVSYFICSRPGRGPVVLQDQTQALLDPQTGLPK  412



>ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 89/116 (77%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAV+IARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  304  EIAYTFDAGPNAVLIARNRKVAVELMQGLLYCFPPKPDTDMKSYVLGDTSIVKEAGLEG-  362

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I  ++ KG+VSYFIC+RPGRGPVVL D+TQALL+P+TGLPK
Sbjct  363  ------ELPQGIKDKIGNQDQKGEVSYFICSRPGRGPVVLQDQTQALLHPQTGLPK  412



>ref|XP_010509167.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 89/116 (77%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAV+IARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  304  EIAYTFDAGPNAVLIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDASIVKEAGLEG-  362

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I  ++ KG+VSYFIC+RPGRGPVVL D+T+ALL+P+TGLPK
Sbjct  363  ------ELPQGIKDKIGRQDQKGEVSYFICSRPGRGPVVLQDQTKALLHPQTGLPK  412



>ref|XP_010505522.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 88/116 (76%), Gaps = 8/116 (7%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            ++AYTFDAGPNAV+IARNRK A  L+Q LL+ FPP  DTD+ SYV+GD SI+ +AG++  
Sbjct  304  EIAYTFDAGPNAVLIARNRKVAVELLQGLLYCFPPKPDTDMKSYVLGDASIVKEAGVEG-  362

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                    P  IKD I  ++ KG+VSYFIC++ GRGPVVL D+TQALL+P+TGLPK
Sbjct  363  ------ELPQGIKDKIGRQDQKGEVSYFICSKAGRGPVVLQDQTQALLHPQTGLPK  412



>ref|XP_010907122.1| PREDICTED: diphosphomevalonate decarboxylase-like [Elaeis guineensis]
Length=421

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 95/116 (82%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRK A LL+QRLLF FPP  +++L+SY++GDKSIL +AG++  
Sbjct  306  QVAYTFDAGPNAVLIAPNRKVAGLLLQRLLFQFPPPPESELASYILGDKSILHEAGLQSR  365

Query  428  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVE LPPP EIKD +P+ K  GDVSYFICTR G GP +L+DE QAL++PETG PK
Sbjct  366  KDVEDLPPPVEIKDKVPSQKFPGDVSYFICTRLGSGPRLLTDENQALISPETGCPK  421



>ref|XP_008788072.1| PREDICTED: diphosphomevalonate decarboxylase-like [Phoenix dactylifera]
Length=421

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 92/116 (79%), Gaps = 1/116 (1%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRK A LL+QRLLF FPP  D +L+SY++GDKSIL +AG++ +
Sbjct  306  QVAYTFDAGPNAVLIAPNRKVAGLLLQRLLFQFPPLPDNELASYILGDKSILREAGLQSM  365

Query  428  NDVEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVE LPPP EIKD  P  K  GDVSYFICTR G GP +L++E QAL++ ETG PK
Sbjct  366  KDVEDLPPPAEIKDKAPFQKFPGDVSYFICTRLGSGPRLLTEENQALISSETGHPK  421



>ref|XP_006646770.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oryza brachyantha]
Length=419

 Score =   134 bits (337),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 4/116 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAV+IA NRK AALL+++LL+ FPP  D DLSSY++GDKSIL DAG+K +
Sbjct  305  QVAYTFDAGPNAVLIAPNRKNAALLLKKLLYCFPPQ-DNDLSSYMVGDKSILSDAGVKSI  363

Query  428  NDVEALPPPPEIKDNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             DVEALP P E+K   P++  KGDVSYFIC+R G GP V++DE+ AL++  TGLPK
Sbjct  364  EDVEALPAPAEMK--TPSQQFKGDVSYFICSRLGAGPKVVTDESLALIDSFTGLPK  417



>gb|ADE77000.1| unknown [Picea sitchensis]
Length=103

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -2

Query  569  MIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK  390
            M A NRK A LL+QRLLFYFPP+S   LSSYVIGD SILG+ G+  + DVE+L  PPE+K
Sbjct  1    MYAPNRKVAGLLLQRLLFYFPPDSSKTLSSYVIGDTSILGEIGVNSMKDVESLTAPPELK  60

Query  389  DNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLP  267
                +    G + YFICTRPG+GP++  +E QALLNP+TG P
Sbjct  61   SESNSATFPGGIDYFICTRPGKGPILFRNEDQALLNPKTGFP  102



>ref|XP_001773902.1| predicted protein [Physcomitrella patens]
 gb|EDQ61250.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVM A+N++ AA L+QRLL+ FPP++DTD+S YV GD+SIL  AG+  L
Sbjct  307  QVAYTFDAGPNAVMFAKNKEVAAQLLQRLLYQFPPSADTDISRYVHGDQSILESAGVNSL  366

Query  428  NDVEALPPPPEIKDNIPTKNK--GDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             D+++L  P E+   IP   +  G+V Y ICT  G+G  VL ++   L++P +GL K
Sbjct  367  KDIDSLSAPAEVA-GIPNLQRIPGEVDYLICTNVGKGAYVLGEQGANLIDPVSGLLK  422



>ref|XP_001774493.1| predicted protein [Physcomitrella patens]
 gb|EDQ60717.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 81/115 (70%), Gaps = 3/115 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            QVAYTFDAGPNAVM A+N++ A  L++RLL+ FPP+++ DLS YV+GD+S+L  AG+  L
Sbjct  308  QVAYTFDAGPNAVMFAKNKEVAVQLLKRLLYQFPPSAEADLSRYVLGDQSVLKSAGVTSL  367

Query  428  NDVEALPPPPEIKD--NIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGL  270
             D+++L  P E     N+P +  G++ Y ICT  G+G  VL  +  +LL+P TGL
Sbjct  368  EDIDSLSAPAEFAGVINLP-RIPGEIDYLICTSAGKGASVLDGQIASLLDPATGL  421



>gb|ACO35356.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
Length=201

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -2

Query  488  LSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVL  312
            LSSY++GDKSIL +AG++ + DVE LPPP EIKD +P+ K  GDVSYFICTR G GP +L
Sbjct  126  LSSYILGDKSILHEAGLQSMKDVEDLPPPVEIKDKVPSQKFPGDVSYFICTRLGSGPRLL  185

Query  311  SDETQALLNPETGLPK  264
            +DE QAL++PETG PK
Sbjct  186  TDENQALISPETGCPK  201



>ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
Length=403

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            Q AYTFDAGPNAV+    +   ALL  RLL+ FPP    +LSSYV+G   +L   GI  L
Sbjct  307  QAAYTFDAGPNAVIFVPQKSGGALL-HRLLYEFPPPEGMNLSSYVVGSTELLEALGIDKL  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRG  324
             D+ +L  P  I+     +  G+++Y ICTRPG G
Sbjct  366  EDIRSLERP--IESPKRDEGHGELAYLICTRPGNG  398



>ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
Length=403

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            Q AYTFDAGPNAV+    +   ALL  RLL+ FPP    +LSSYV+G   +L   GI  L
Sbjct  307  QAAYTFDAGPNAVIFVPQKSGGALL-HRLLYEFPPPEGMNLSSYVVGSTELLEALGIDKL  365

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRG  324
             D+ +L  P  I+     +  G+++Y ICTRPG G
Sbjct  366  EDIRSLERP--IESPKRDEGHGELAYLICTRPGNG  398



>gb|KJB78632.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=345

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDL  486
            QVAYTFDAGPNAV+IAR+RKAAA L+QRLLFYFPP SDTDL
Sbjct  303  QVAYTFDAGPNAVLIARDRKAAAQLIQRLLFYFPPKSDTDL  343



>gb|AFS28685.1| putative phosphomevalonate kinase, partial [Olea europaea]
Length=40

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = -2

Query  374  KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            K KGDVSYFICT+PGRGPV+L++E+QALL+P+TGLPK
Sbjct  4    KYKGDVSYFICTKPGRGPVLLTNESQALLDPKTGLPK  40



>ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
Length=409

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 63/117 (54%), Gaps = 16/117 (14%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNS-DTDLSSYVIGDKSILGDAGIKD  432
            + AYTFDAGPNAV+         +L   L  +FPP+S +     +V G    L DA  KD
Sbjct  304  KAAYTFDAGPNAVLYLLQDDVPEVLA-LLRHFFPPSSTNNSEREFVQG----LPDANRKD  358

Query  431  LNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            L        P E+ +++  + + G V Y I TR G+GP VL+D  QALL+ E G PK
Sbjct  359  L--------PAELLNSVGLEPSPGSVQYIIHTRAGQGPQVLTDPQQALLD-EKGWPK  406



>gb|ACU22779.1| unknown [Glycine max]
Length=84

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = +3

Query  279  FRVEEGLSFITKNHRASSRSRADEVTNIALV-LSWNVVLDFWRWWKCFHVVQVLNPSIPE  455
            F V++ L+ I K +R+ SRS   E+T+I LV L WN++ DFWR W+ F+V+  ++P I  
Sbjct  12   FTVQKCLTAIRKQNRSPSRSGTYEITDIPLVFLGWNIIFDFWRRWQSFYVLYSIDPRIFC  71

Query  456  Y*FIPYDIAA  485
               +P ++ A
Sbjct  72   NWLVPNNVTA  81



>ref|XP_006411092.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
 gb|ESQ52545.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
Length=341

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSD  495
            ++AYTFDAGPNAV+IAR+RK A  L+Q LL+ FPP  D
Sbjct  304  EIAYTFDAGPNAVLIARSRKVAVELLQGLLYCFPPKPD  341



>emb|CBI24186.3| unnamed protein product [Vitis vinifera]
Length=87

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 37/52 (71%), Gaps = 1/52 (2%)
 Frame = +3

Query  285  VEEGLSFITKNHRASSRSRADEVTN-IALVLSWNVVLDFWRWWKCFHVVQVL  437
            VEEGL+FI K H +  RS ADEVTN   L+LSWN++  F R W+ FH++ +L
Sbjct  30   VEEGLTFIRKQHWSLLRSCADEVTNSTFLLLSWNLIHSFGRRWQSFHILHLL  81



>gb|ELW62889.1| Diphosphomevalonate decarboxylase [Tupaia chinensis]
Length=453

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 65/143 (45%), Gaps = 24/143 (17%)
 Frame = -2

Query  686  SECIHDLTLCLSYIFGDMKVTKK*IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFP  507
            S  I  L  C +   G  KV    + Q AYTFDAGPNAV+   +    A  V  +   FP
Sbjct  330  SRRIMHLVHCFNAHHGQTKV----LWQAAYTFDAGPNAVVFTLD-DTVAEFVAAVRHSFP  384

Query  506  PNSDTD--LSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  333
            P S+ D  L    +G  ++L +    +L    A+ P P           G + Y I T+ 
Sbjct  385  PASNADEFLKGLQVG-PALLSE----ELKAALAMEPSP-----------GAIRYVIATQV  428

Query  332  GRGPVVLSDETQALLNPETGLPK  264
            G GP VL D    LL P+ GLPK
Sbjct  429  GPGPQVLDDPHTHLLGPD-GLPK  450



>ref|XP_005424871.1| PREDICTED: diphosphomevalonate decarboxylase [Geospiza fortis]
Length=260

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 18/118 (15%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAY+FDAGPNAV+ A    A A  V+ +   FPP ++              GD  ++ L
Sbjct  159  KVAYSFDAGPNAVIFALA-DAVAEFVEVVRRSFPPATN--------------GDQFVRGL  203

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*R  258
              V +   PPE++  + T+   G V Y + T+PG GP ++ D +Q LL P+ GLP+ R
Sbjct  204  -PVGSAVLPPELEGAVLTEPVPGAVQYILHTKPGPGPQLVDDPSQHLLGPD-GLPRSR  259



>ref|XP_004356734.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24834.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
Length=412

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 65/125 (52%), Gaps = 17/125 (14%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGD----------KS  459
            ++AYTFDAGPNAV+ A  ++   LL+  +  YFPP+S  DL+ +V G           +S
Sbjct  294  KIAYTFDAGPNAVLYAL-KEDTPLLLHLITRYFPPSS--DLAHFVEGSGPKECGVESIES  350

Query  458  ILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPE  279
            +      KD + VEAL    + K    T     +   I T   +GP V++D+   L++  
Sbjct  351  LGAQLKAKDAS-VEALLQELDAK---FTPQPASIQRVIHTTVDKGPHVVTDDALCLIDTA  406

Query  278  TGLPK  264
            TGLPK
Sbjct  407  TGLPK  411



>ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus 
kowalevskii]
Length=405

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 59/114 (52%), Gaps = 15/114 (13%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYT+DAGPNAV+   +      +V  + +YFPP  D    +++ G K        ++L
Sbjct  302  KVAYTYDAGPNAVLYLLDEHVPD-VVSLINYYFPP-CDNIRETFIRGLKVDFKTDISQEL  359

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLP  267
             DV  L P P           G + Y I T+ G+GP +L +E  +LLN E GLP
Sbjct  360  KDVVPLEPSP-----------GAIKYVISTKVGQGPQILPNEA-SLLN-ENGLP  400



>emb|CAF99534.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=393

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 30/130 (23%)
 Frame = -2

Query  644  FGDMKVTKK*IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGD  465
            +G+M+V+        YTFDAGPNAV+    +  +  L Q +  +FPP ++          
Sbjct  291  YGEMRVS--------YTFDAGPNAVIFTLEQHVSEFL-QVVQHFFPPEAN----------  331

Query  464  KSILGDAGIKDLNDVEALPPPPEIKDNI---PTKNKGDVSYFICTRPGRGPVVLSDETQA  294
                G   I+ L  +E +  P  +K +I   P +N   +SY I T+ G GP V++D  + 
Sbjct  332  ----GGHFIRGL-PIEGVSLPDALKQSIGLQPMQN--GISYVISTKAGPGPCVVNDPAEH  384

Query  293  LLNPETGLPK  264
            LL  + GLPK
Sbjct  385  LLGSD-GLPK  393



>gb|EHH60647.1| hypothetical protein EGM_12056, partial [Macaca fascicularis]
Length=377

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 57/117 (49%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +    A  V  +   FPP S+              GDA +K L
Sbjct  275  KVAYTFDAGPNAVIFTLD-DTVAEFVAAVRHSFPPGSN--------------GDAFLKGL  319

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L D +  LL P+ GLPK
Sbjct  320  Q-VRPAPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDDPSAHLLGPD-GLPK  374



>ref|XP_009089159.1| PREDICTED: diphosphomevalonate decarboxylase [Serinus canaria]
Length=399

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 16/117 (14%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAY+FDAGPNAV+      A A  V+ +   FPP ++              GD  ++ L
Sbjct  298  KVAYSFDAGPNAVIFTLA-DAVAEFVEVVRRSFPPATN--------------GDQFVRGL  342

Query  428  NDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*R  258
                A  PP  +   +     G V Y + T+PG GP ++ D +Q LL P+ GLP+ R
Sbjct  343  PVGSAALPPELVAAVLTEPVPGAVQYILHTKPGPGPQLVDDPSQHLLGPD-GLPRSR  398



>ref|XP_005592827.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Macaca 
fascicularis]
Length=401

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 57/117 (49%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GDA +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHSFPPGSN--------------GDAFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L D +  LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDDPSAHLLGPD-GLPK  398



>ref|NP_001247472.1| diphosphomevalonate decarboxylase [Macaca mulatta]
Length=401

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 57/117 (49%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GDA +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHSFPPGSN--------------GDAFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L D +  LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDDPSAHLLGPD-GLPK  398



>gb|EIE86507.1| diphosphomevalonate decarboxylase [Rhizopus delemar RA 99-880]
Length=409

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 62/119 (52%), Gaps = 17/119 (14%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPN---SDTDLSSYVIGDKSILGDAGI  438
            + AYT+DAGPNAV+ A  +K    ++Q +  YFP N   S+     Y +   + LG+  I
Sbjct  301  KAAYTYDAGPNAVIYA-PKKNMPEIIQLIGHYFPSNKEPSEFFADPYRVAQGTKLGEKFI  359

Query  437  KDLNDVEALPPPPEIKDN-IPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                      P P   +N IP +  G VS  + T+   GP VL+ E ++LLN E GLPK
Sbjct  360  ----------PHPNFNENVIPVQPAGSVSRLLHTKVDDGPRVLA-EDESLLNAE-GLPK  406



>ref|XP_003922886.1| PREDICTED: diphosphomevalonate decarboxylase [Saimiri boliviensis 
boliviensis]
Length=400

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 56/116 (48%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+       A   V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLEDTVAD-FVAAVRHAFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V+  P P E++  +  +   G + Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VKPAPLPAELEAALAMEPTPGGIKYIIATQVGPGPQILDDPCSHLLGPD-GLPK  397



>ref|XP_010996740.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelus dromedarius]
Length=144

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIG---DKSILGDAGI  438
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+ D   ++ G   + ++L D   
Sbjct  43   KVAYTFDAGPNAVIFTLDETVAE-FVAAVRHSFPPESNGD--KFLQGLPVEPALLSD---  96

Query  437  KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             +L  V  + P P           G + Y I T+ G GP VL D    LL P+ GLPK
Sbjct  97   -ELKAVLGVDPAP-----------GGIKYIIATQVGPGPQVLDDPGARLLGPD-GLPK  141



>ref|XP_008300019.1| PREDICTED: diphosphomevalonate decarboxylase [Stegastes partitus]
Length=402

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 18/117 (15%)
 Frame = -2

Query  611  AQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGI-K  435
             +VAYTFDAGPNAV+    +      V+ +  +FPP  DT    ++ G    +G A + +
Sbjct  300  TRVAYTFDAGPNAVIFTLEQHVPE-FVRVVQHFFPP--DTHTEDFIQGLP--VGRAALSE  354

Query  434  DLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            +L     L P P          KG ++Y I T+ G GP V+ D TQ LL+ + GLPK
Sbjct  355  ELRRGVGLEPMP----------KG-INYIISTKAGPGPCVVEDPTQHLLSSD-GLPK  399



>ref|XP_008403677.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia reticulata]
Length=403

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 63/117 (54%), Gaps = 20/117 (17%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAY+FDAGPNAV+    ++     VQ +  +FPP+ +              G+  IK L
Sbjct  302  RVAYSFDAGPNAVIFIL-QQFVPEFVQLVQHFFPPDRN--------------GEDFIKGL  346

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V+    P E+K NI  +   KG ++Y I T+ G GP V+ D +Q LL+ E GLPK
Sbjct  347  -PVKCAALPMELKQNIGLEPVPKG-INYIISTKAGPGPRVVDDPSQHLLSAE-GLPK  400



>gb|EAW66791.1| mevalonate (diphospho) decarboxylase, isoform CRA_b [Homo sapiens]
Length=186

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  85   KVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHGFPPGSN--------------GDTFLKGL  129

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  130  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  183



>ref|XP_008838768.1| PREDICTED: diphosphomevalonate decarboxylase [Nannospalax galili]
Length=406

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 64/142 (45%), Gaps = 26/142 (18%)
 Frame = -2

Query  686  SECIHDLTLCLSYIFGDMKVTKK*IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFP  507
            S  I  L  C +   G  KV        AYTFDAGPNAV+   +   A   V  +   FP
Sbjct  287  SRRIIQLVHCFNTHHGQTKV--------AYTFDAGPNAVIFTLDDTVAE-FVAAVRHSFP  337

Query  506  PNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPG  330
            P+++              GD  +K L  V   P   E+K  + T+ + G V Y I T+ G
Sbjct  338  PSAN--------------GDKFLKGLQ-VTPAPLSDELKAALTTEPSPGSVQYIIATQVG  382

Query  329  RGPVVLSDETQALLNPETGLPK  264
             GP VL D    LL P+ GLP+
Sbjct  383  PGPQVLDDPHVHLLGPD-GLPQ  403



>ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase [Anolis carolinensis]
Length=406

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 26/120 (22%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+       A   V+ +   FPP ++              G   +K L
Sbjct  304  KVAYTFDAGPNAVVFMMEETVAEF-VEVVKRSFPPENN--------------GGQFLKGL  348

Query  428  NDVEALPPPPE-----IKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              VEA+ PP E     +KD  P    G + Y + T+PG GP +++D +  LL P+ G P+
Sbjct  349  -PVEAVMPPEELLSAVVKDPAP----GAIQYLLLTKPGPGPTIVNDGSCHLLGPD-GQPR  402



>ref|XP_006721255.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Homo 
sapiens]
Length=229

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  128  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHGFPPGSN--------------GDTFLKGL  172

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  173  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  226



>gb|EAW66790.1| mevalonate (diphospho) decarboxylase, isoform CRA_a [Homo sapiens]
Length=269

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  168  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHGFPPGSN--------------GDTFLKGL  212

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  213  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  266



>ref|XP_006173825.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus ferus]
Length=426

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIG---DKSILGDAGI  438
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+ D   ++ G   + ++L D   
Sbjct  325  KVAYTFDAGPNAVIFTLDETVAE-FVAAVRHSFPPESNGD--KFLQGLPVEPALLSD---  378

Query  437  KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             +L  V  + P P           G + Y I T+ G GP VL D    LL P+ GLPK
Sbjct  379  -ELKAVLGMDPAP-----------GGIKYIIATQVGPGPQVLDDPGARLLGPD-GLPK  423



>ref|XP_010966484.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus bactrianus]
Length=400

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIG---DKSILGDAGI  438
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+ D   ++ G   + ++L D   
Sbjct  299  KVAYTFDAGPNAVIFTLDETVAE-FVAAVRHSFPPESNGD--KFLQGLPVEPALLSD---  352

Query  437  KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             +L  V  + P P           G + Y I T+ G GP VL D    LL P+ GLPK
Sbjct  353  -ELKAVLGMDPAP-----------GGIKYIIATQVGPGPQVLDDPGARLLGPD-GLPK  397



>ref|XP_003917347.1| PREDICTED: diphosphomevalonate decarboxylase [Papio anubis]
Length=401

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP+S+              GDA +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVKHSFPPDSN--------------GDAFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L + +  LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDNPSAHLLGPD-GLPK  398



>ref|XP_010739786.1| PREDICTED: diphosphomevalonate decarboxylase [Larimichthys crocea]
Length=397

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIG---DKSILGDAGI  438
            +VAYTFDAGPNAV+    +      VQ +  +FPP  +T+   +  G   + + L +   
Sbjct  296  RVAYTFDAGPNAVIFTLQQHVPE-FVQVVQHFFPP--ETNGGQFFKGLPVNHAALSE---  349

Query  437  KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             +L     L P P          KG +SY I T+ G GP V+ D T  LL   TGLPK
Sbjct  350  -ELKQAIGLEPMP----------KG-ISYIISTKAGPGPCVVEDPTLHLLG-STGLPK  394



>ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 sp|P53602.1|MVD1_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Homo sapiens]
 pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
Length=400

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHGFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_005805001.1| PREDICTED: diphosphomevalonate decarboxylase-like [Xiphophorus 
maculatus]
Length=403

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 20/117 (17%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAY+FDAGPNAV+    ++     VQ +  +FPP+ +              G+  IK L
Sbjct  302  RVAYSFDAGPNAVIFTL-QQFVPEFVQLVQHFFPPDRN--------------GEDFIKGL  346

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V+    P E+K NI  +   KG ++Y I T+ G GP V+ D ++ LL+ E GLPK
Sbjct  347  -PVKGAALPMELKQNIGLEPVPKG-INYIISTKAGPGPRVVDDPSEHLLSAE-GLPK  400



>gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic 
construct]
 gb|AAX43880.1| mevalonate (diphospho) decarboxylase, partial [synthetic construct]
Length=401

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHGFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_003970115.1| PREDICTED: diphosphomevalonate decarboxylase-like [Takifugu rubripes]
Length=397

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +V+YTFDAGPNAV+    +     L Q +  +FPP ++              G   I+ L
Sbjct  296  RVSYTFDAGPNAVIFTLKQHVPEFL-QVVQHFFPPETN--------------GGHFIRGL  340

Query  428  NDVEALPPPPEIKDNI---PTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V+ +  P E+K +I   P  N   +SY I T+ G GP V+ D  Q LL  + GLPK
Sbjct  341  -PVKRVFLPDELKQSIGLQPMDN--GISYVISTKAGPGPCVVDDPAQHLLGSD-GLPK  394



>ref|XP_007992523.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007992524.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Chlorocebus 
sabaeus]
Length=401

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 57/117 (49%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GDA +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHSFPPGSN--------------GDAFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L + +  LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDNPSAHLLGPD-GLPK  398



>ref|XP_005256369.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Homo 
sapiens]
Length=379

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +    A  V  +   FPP S+              GD  +K L
Sbjct  278  KVAYTFDAGPNAVIFTLD-DTVAEFVAAVWHGFPPGSN--------------GDTFLKGL  322

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  323  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  376



>ref|XP_001376834.1| PREDICTED: diphosphomevalonate decarboxylase [Monodelphis domestica]
Length=398

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 62/142 (44%), Gaps = 26/142 (18%)
 Frame = -2

Query  686  SECIHDLTLCLSYIFGDMKVTKK*IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFP  507
            S  I  L  C +  +G  KV        AYTFDAGPNAV+           V  +   FP
Sbjct  279  SRQIISLVHCFNAYYGKTKV--------AYTFDAGPNAVIFTLEETVDE-FVAVIKQVFP  329

Query  506  PNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPG  330
            P  +              GD  +K L  VE +    E+K  +P +   G + Y I T+ G
Sbjct  330  PEMN--------------GDKFLKGL-PVEPVELSEEVKSALPMEPFPGGIRYIITTQVG  374

Query  329  RGPVVLSDETQALLNPETGLPK  264
             GP VL +  + LL P+ GLPK
Sbjct  375  PGPQVLEEPQRQLLGPD-GLPK  395



>dbj|GAM24015.1| hypothetical protein SAMD00019534_071900 [Acytostelium subglobosum 
LB1]
Length=402

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 25/124 (20%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMI--ARNR-KAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGI  438
            + AYTFDAGPNA +   A N  +  AL V+    +FP    +DL++Y  GD +       
Sbjct  284  KCAYTFDAGPNACIYLPADNVIEVLALFVK----HFPT---SDLAAYYRGDAA-------  329

Query  437  KDLNDVEALPPPPEIKDNIPTKN------KGDVSYFICTRPGRGPVVLSDETQALLNPET  276
             ++  +    PP   +    T +       G + Y + T+ G GP VLS E+++L++P T
Sbjct  330  -NVEKIANYQPPTNTQSLYSTPSAATQELAGSLKYILHTKIGPGPCVLS-ESESLIDPST  387

Query  275  GLPK  264
            GLPK
Sbjct  388  GLPK  391



>ref|XP_002111980.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
 gb|EDV25947.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
Length=385

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 58/118 (49%), Gaps = 20/118 (17%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +  YTFDAGPNAV+    +    +L   +  YFP   + D  SY+          G+ + 
Sbjct  284  KACYTFDAGPNAVLYVLAKDVPQIL-SAVCHYFPCTENHD--SYI---------QGLSNY  331

Query  428  NDVEALPPPPE---IKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            +DV+  P   E     D IP    G ++  I TR G GP V+ D+ ++LL  + GLPK
Sbjct  332  SDVKEFPKEIENTICLDPIP----GSLTGIIHTRVGSGPRVILDDNESLLGGD-GLPK  384



>ref|XP_004058175.1| PREDICTED: diphosphomevalonate decarboxylase [Gorilla gorilla 
gorilla]
Length=400

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +    A  V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLD-DTVAEFVAAVRHGFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILHDPCAHLLGPD-GLPK  397



>ref|XP_010792093.1| PREDICTED: diphosphomevalonate decarboxylase [Notothenia coriiceps]
Length=402

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 58/120 (48%), Gaps = 26/120 (22%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILG-----DA  444
            ++AYTFDAGPNAV+    +      VQ +  +FPP S+        G + I G      A
Sbjct  301  RLAYTFDAGPNAVIYTLQQHVPE-FVQAVQHFFPPESN--------GGQFIQGLPVNQAA  351

Query  443  GIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              ++L     L P P          KG +SY I T+ G GP V+ D TQ L+  + G+PK
Sbjct  352  LSEELKQAIGLEPMP----------KG-ISYIISTKAGPGPRVVEDPTQHLIGSD-GMPK  399



>gb|KIK57461.1| hypothetical protein GYMLUDRAFT_86887 [Gymnopus luxurians FD-317 
M1]
Length=421

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 57/114 (50%), Gaps = 13/114 (11%)
 Frame = -2

Query  602  AYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLND  423
            AYTFDAGPNAV I    +    ++Q LL YFP     D ++    D   L + G      
Sbjct  317  AYTFDAGPNAV-IYTEAEHIKTIIQLLLNYFP----IDFAAAPFHDSFALFEGG-----H  366

Query  422  VEALPPPPEIKDNIP-TKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
             +A P P    +N+     K  V   I T+ G GP VL +E ++LLN E G+PK
Sbjct  367  PKAAPIPKGFNENVSRVWEKDSVKGLIHTKIGDGPRVLGEE-ESLLNKE-GMPK  418



>ref|XP_010625831.1| PREDICTED: diphosphomevalonate decarboxylase [Fukomys damarensis]
 gb|KFO31855.1| Diphosphomevalonate decarboxylase [Fukomys damarensis]
Length=402

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 58/118 (49%), Gaps = 18/118 (15%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+       A  +V  +   FPP ++              GD  +K L
Sbjct  299  KVAYTFDAGPNAVLFTLEDTMAE-IVAVVRHAFPPEAN--------------GDKFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK*R  258
              V  +P   E+K  +  +   G V Y I T+ G GP VL+D    LL P+ GLPK R
Sbjct  344  -PVTPVPVSDELKATLAMEPAPGGVQYVIATQVGPGPQVLNDPDAHLLGPD-GLPKPR  399



>ref|XP_004437181.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratotherium simum 
simum]
Length=400

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 56/118 (47%), Gaps = 22/118 (19%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  L   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDNTVAE-FVAALRHSFPPESN--------------GDKFLKGL  343

Query  428  NDVEALPPPPEIKDNI---PTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E+K  +   PT   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  -PVRPAPLSDELKAALGMDPT--PGGVKYIIATQVGPGPQILDDPHAHLLGPD-GLPK  397



>emb|CDS06586.1| hypothetical protein LRAMOSA09114 [Absidia idahoensis var. thermophila]
Length=405

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 61/116 (53%), Gaps = 10/116 (9%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGI-KD  432
            + AYT+DAGPNAV+ A N++    ++Q +  YFP   D    SY     +++GDA + +D
Sbjct  296  KAAYTYDAGPNAVIYA-NKENMREIIQLVAHYFPGTID----SYFTDPYNVIGDAPLGQD  350

Query  431  LNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
                      P +   IP    G VS  + T+   GP VL++   +LL P+ GLPK
Sbjct  351  FVPKTHSSFNPNV---IPVFPAGSVSRLLHTKVDDGPRVLANPDDSLLTPQ-GLPK  402



>ref|XP_003805806.1| PREDICTED: diphosphomevalonate decarboxylase [Pan paniscus]
Length=400

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHGFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_003758532.1| PREDICTED: diphosphomevalonate decarboxylase [Sarcophilus harrisii]
Length=398

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 62/142 (44%), Gaps = 26/142 (18%)
 Frame = -2

Query  686  SECIHDLTLCLSYIFGDMKVTKK*IAQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFP  507
            S  I  L  C +  +G  KV        AYTFDAGPNAV+           V  +   FP
Sbjct  279  SRQIISLVHCFNAHYGKTKV--------AYTFDAGPNAVIFTLEDTVDE-FVAVIKQIFP  329

Query  506  PNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPG  330
            P  +              GD  +K L  VE +    E+K  +P +   G + Y I T+ G
Sbjct  330  PEVN--------------GDKFLKGL-PVEPVELSEELKSALPMEPCPGGIRYIIATQVG  374

Query  329  RGPVVLSDETQALLNPETGLPK  264
             GP VL D  Q LL P+ GLP+
Sbjct  375  PGPQVLQDPQQHLLGPD-GLPQ  395



>ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase [Pan troglodytes]
Length=400

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 55/116 (47%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GD  +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHGFPPGSN--------------GDTFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +   G V Y I T+ G GP +L D    LL P+ GLPK
Sbjct  344  Q-VRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_004905145.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Heterocephalus glaber]
Length=402

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 56/120 (47%), Gaps = 26/120 (22%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILG----DAG  441
            +VAYTFDAGPNAV+   +    A  V  +   FPP +D        GDK + G     A 
Sbjct  299  KVAYTFDAGPNAVLFTLD-DTMAEFVAVVRHTFPPEAD--------GDKFLKGLPVTPAP  349

Query  440  IKD-LNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            I D L    A+ P P           G V Y I T+ G GP VL D    LL P+ GLPK
Sbjct  350  ISDELKATLAMEPVP-----------GGVQYVIATQVGPGPQVLDDPDAHLLGPD-GLPK  397



>ref|XP_003325100.1| diphosphomevalonate decarboxylase [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP80681.1| diphosphomevalonate decarboxylase [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=427

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 54/110 (49%), Gaps = 17/110 (15%)
 Frame = -2

Query  602  AYTFDAGPNAVMIARNRKAAALLVQRLLFYFP-PNSD--TDLSSYVIGDKSILGDAGIKD  432
            AYTFDAGPNAV+ A  R    LL   +L YFP P+SD  TD  +Y    K   G      
Sbjct  314  AYTFDAGPNAVIYAPKRNMRKLL-NLILHYFPLPDSDPFTDPKAYFDLSKETPGQ-----  367

Query  431  LNDVEALPPPPEIKDNI-PTKNKGDVSYFICTRPGRGPVVLSDET-QALL  288
                  L  P     NI P   +G +S  I T+ G GP VL+++  Q LL
Sbjct  368  ------LALPIHFNHNISPVWKQGSISRLIHTQVGDGPQVLNNQLGQGLL  411



>ref|XP_004753891.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
 ref|XP_004814744.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
Length=400

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 58/123 (47%), Gaps = 32/123 (26%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+ A +       V  +   FPP S+        GDK + G       
Sbjct  299  KVAYTFDAGPNAVVFALH-DTVPEFVAAVRHCFPPESN--------GDKFLKG-------  342

Query  428  NDVEALPPPP-----EIK---DNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETG  273
                 LP PP     E+K   D  PT   G V Y I T+ G GP +L D    LL P+ G
Sbjct  343  -----LPVPPVPLSDELKAVLDVDPT--PGGVKYIIATQVGPGPQILEDPHAHLLGPD-G  394

Query  272  LPK  264
            LPK
Sbjct  395  LPK  397



>gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
Length=401

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+       A   V  +   FPP ++              GD  +K L
Sbjct  300  KVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHSFPPAAN--------------GDKFLKGL  344

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V  +    E+K ++ T+ + G V Y I T+ G GP VL D    LL P+ GLP+
Sbjct  345  Q-VAPVLLSDELKTSLATEPSPGGVQYIIATQVGPGPQVLDDPHHHLLGPD-GLPQ  398



>ref|XP_004842741.1| PREDICTED: diphosphomevalonate decarboxylase [Heterocephalus 
glaber]
Length=423

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 56/120 (47%), Gaps = 26/120 (22%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILG----DAG  441
            +VAYTFDAGPNAV+   +    A  V  +   FPP +D        GDK + G     A 
Sbjct  320  KVAYTFDAGPNAVLFTLD-DTMAEFVAVVRHTFPPEAD--------GDKFLKGLPVTPAP  370

Query  440  IKD-LNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            I D L    A+ P P           G V Y I T+ G GP VL D    LL P+ GLPK
Sbjct  371  ISDELKATLAMEPVP-----------GGVQYVIATQVGPGPQVLDDPDAHLLGPD-GLPK  418



>ref|XP_008308874.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
 ref|XP_008308875.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
Length=403

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 18/117 (15%)
 Frame = -2

Query  611  AQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKD  432
             +VAYTFDAGPNAV+    R      V  +  +FPP               I G   IK 
Sbjct  301  TRVAYTFDAGPNAVIFTLERHVPE-FVSVVQHFFPPE--------------INGGQFIKG  345

Query  431  LNDVEALPPPPEIKD-NIPTKNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
            L   ++L P   +K   +    KG +SY I T+PG GP V+ D ++ L+    GLPK
Sbjct  346  LPVKDSLLPEDLVKAIGLEPMPKG-ISYVISTKPGPGPCVVQDPSEHLIG-SNGLPK  400



>ref|XP_007549941.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia formosa]
Length=404

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 62/117 (53%), Gaps = 20/117 (17%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAY+FDAGPNAV+    ++     VQ +  +FPP+ +              G+  IK L
Sbjct  302  RVAYSFDAGPNAVIFTL-QQFVPEFVQLVQHFFPPDRN--------------GEDFIKGL  346

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V+      E+K NI  +   KG ++Y I T+ G GP V+ D +Q LL+ E GLPK
Sbjct  347  -PVKGAALSMELKQNIGLEPVPKG-INYIISTKAGPGPRVVDDPSQHLLSAE-GLPK  400



>ref|XP_010353864.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Rhinopithecus 
roxellana]
Length=401

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 19/117 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+   +   A   V  +   FPP S+              GDA +K L
Sbjct  299  KVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHSFPPGSN--------------GDAFLKGL  343

Query  428  NDVEALPPPPEIKDNIPTK--NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V   P   E++  +  +    G V Y I T+ G GP +L +    LL P+ GLPK
Sbjct  344  Q-VRPSPLSAELQAALAMEPTTPGGVKYIIATQVGPGPQILDNPCAHLLGPD-GLPK  398



>ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 sp|Q62967.1|MVD1_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
 gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
Length=401

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 57/116 (49%), Gaps = 18/116 (16%)
 Frame = -2

Query  608  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  429
            +VAYTFDAGPNAV+       A   V  +   FPP ++              GD  +K L
Sbjct  300  KVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHSFPPAAN--------------GDKFLKGL  344

Query  428  NDVEALPPPPEIKDNIPTK-NKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  264
              V  +    E+K ++ T+ + G V Y I T+ G GP VL D    LL P+ GLP+
Sbjct  345  Q-VAPVLLSDELKTSLATEPSPGGVQYIIATQVGPGPQVLDDPHHHLLGPD-GLPQ  398



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730