BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013D04

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767908.1|  PREDICTED: ras-related protein RABA5b-like         361   5e-123   Nicotiana sylvestris
ref|XP_009611217.1|  PREDICTED: ras-related protein RABA5b              360   9e-123   Nicotiana tomentosiformis
ref|XP_004247033.1|  PREDICTED: ras-related protein RABA5b-like         354   2e-120   Solanum lycopersicum
emb|CDP03946.1|  unnamed protein product                                352   1e-119   Coffea canephora [robusta coffee]
ref|XP_009762686.1|  PREDICTED: ras-related protein RABA5b-like         352   2e-119   Nicotiana sylvestris
ref|XP_011089627.1|  PREDICTED: ras-related protein RABA5b-like         348   7e-118   Sesamum indicum [beniseed]
ref|XP_011089021.1|  PREDICTED: ras-related protein RABA5b              343   5e-116   
gb|EYU40652.1|  hypothetical protein MIMGU_mgv1a013587mg                335   1e-112   Erythranthe guttata [common monkey flower]
gb|EYU39173.1|  hypothetical protein MIMGU_mgv1a013470mg                331   3e-111   Erythranthe guttata [common monkey flower]
gb|KDP45261.1|  hypothetical protein JCGZ_15126                         323   3e-108   Jatropha curcas
ref|XP_007049622.1|  RAB GTPase A5B                                     322   8e-108   
ref|XP_004149322.1|  PREDICTED: ras-related protein RABA5e-like         320   5e-107   Cucumis sativus [cucumbers]
ref|XP_010069602.1|  PREDICTED: ras-related protein RABA5b              320   5e-107   Eucalyptus grandis [rose gum]
ref|XP_010241769.1|  PREDICTED: ras-related protein RABA5c              320   8e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010666947.1|  PREDICTED: ras-related protein RABA5e              318   3e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010524651.1|  PREDICTED: ras-related protein RABA5b              318   5e-106   Tarenaya hassleriana [spider flower]
ref|XP_008458081.1|  PREDICTED: ras-related protein RABA5b              317   6e-106   Cucumis melo [Oriental melon]
ref|XP_010100807.1|  Ras-related protein RABA5c                         317   1e-105   Morus notabilis
gb|EPS67330.1|  hypothetical protein M569_07446                         316   1e-105   Genlisea aurea
ref|XP_002303077.1|  GTP-binding family protein                         317   1e-105   Populus trichocarpa [western balsam poplar]
gb|KJB84096.1|  hypothetical protein B456_N003900                       317   2e-105   Gossypium raimondii
ref|XP_004290147.1|  PREDICTED: ras-related protein RABA5b              316   2e-105   Fragaria vesca subsp. vesca
gb|KFK38199.1|  hypothetical protein AALP_AA3G082000                    316   2e-105   Arabis alpina [alpine rockcress]
ref|XP_009124351.1|  PREDICTED: ras-related protein RABA5b              316   3e-105   Brassica rapa
ref|XP_011024576.1|  PREDICTED: ras-related protein RABA5e-like         316   3e-105   Populus euphratica
ref|XP_010909337.1|  PREDICTED: ras-related protein RABA5e-like         315   4e-105   Elaeis guineensis
ref|XP_006407840.1|  hypothetical protein EUTSA_v10021494mg             315   5e-105   Eutrema salsugineum [saltwater cress]
ref|XP_006437222.1|  hypothetical protein CICLE_v10032706mg             315   5e-105   Citrus clementina [clementine]
ref|NP_001240985.1|  ras-related protein RABA5b-like                    315   6e-105   Glycine max [soybeans]
gb|KJB10858.1|  hypothetical protein B456_001G229200                    317   7e-105   Gossypium raimondii
ref|XP_002533058.1|  protein with unknown function                      315   7e-105   Ricinus communis
gb|KDO60895.1|  hypothetical protein CISIN_1g027703mg                   315   7e-105   Citrus sinensis [apfelsine]
ref|XP_002884647.1|  hypothetical protein ARALYDRAFT_896904             315   8e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_011073833.1|  PREDICTED: ras-related protein RABA5c              315   9e-105   Sesamum indicum [beniseed]
ref|XP_010054657.1|  PREDICTED: ras-related protein RABA5c              314   1e-104   Eucalyptus grandis [rose gum]
ref|XP_003622764.1|  Ras-related protein ARA-1                          314   1e-104   Medicago truncatula
ref|NP_187397.1|  RAB GTPase-like protein A5B                           314   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484821.1|  PREDICTED: ras-related protein RABA5b-like         314   1e-104   Citrus sinensis [apfelsine]
ref|XP_010451591.1|  PREDICTED: ras-related protein RABA5b-like i...    314   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_007200458.1|  hypothetical protein PRUPE_ppa011281mg             313   2e-104   Prunus persica
ref|XP_010486288.1|  PREDICTED: ras-related protein RABA5b isofor...    313   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_002263362.1|  PREDICTED: ras-related protein RABA5e              313   4e-104   Vitis vinifera
ref|XP_002527386.1|  protein with unknown function                      313   4e-104   Ricinus communis
ref|XP_010999992.1|  PREDICTED: ras-related protein RABA5d-like         313   5e-104   Populus euphratica
ref|XP_008382566.1|  PREDICTED: ras-related protein RABA5b-like         312   6e-104   Malus domestica [apple tree]
ref|XP_006298457.1|  hypothetical protein CARUB_v10014528mg             313   6e-104   
emb|CAA98183.1|  RAB11G                                                 312   7e-104   Lotus japonicus
ref|XP_008372555.1|  PREDICTED: ras-related protein RABA5b-like         312   8e-104   Malus domestica [apple tree]
ref|XP_003552753.1|  PREDICTED: ras-related protein RABA5d-like         312   1e-103   
ref|XP_009372186.1|  PREDICTED: ras-related protein RABA5c-like         312   1e-103   
ref|XP_010650400.1|  PREDICTED: ras-related protein RABA5c-like         311   1e-103   
ref|XP_008222663.1|  PREDICTED: ras-related protein RABA5e              311   2e-103   Prunus mume [ume]
ref|XP_007223957.1|  hypothetical protein PRUPE_ppa011186mg             311   2e-103   Prunus persica
gb|KDP42877.1|  hypothetical protein JCGZ_23819                         311   2e-103   Jatropha curcas
ref|XP_004492211.1|  PREDICTED: ras-related protein RABA5b-like         311   2e-103   Cicer arietinum [garbanzo]
ref|XP_010464360.1|  PREDICTED: ras-related protein RABA5b-like         313   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009619604.1|  PREDICTED: ras-related protein RABA5c-like         311   3e-103   Nicotiana tomentosiformis
ref|XP_007140715.1|  hypothetical protein PHAVU_008G135600g             310   3e-103   Phaseolus vulgaris [French bean]
dbj|BAA02108.1|  GTP-binding protein                                    310   3e-103   Pisum sativum [garden pea]
ref|XP_009383827.1|  PREDICTED: ras-related protein RABA5c-like         310   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH21456.1|  RAB GTPase-like protein A1D                             310   4e-103   Medicago truncatula
ref|XP_006478881.1|  PREDICTED: ras-related protein RABA5c-like         310   5e-103   Citrus sinensis [apfelsine]
gb|AGZ15280.1|  putative RAB11G                                         310   6e-103   Taraxacum brevicorniculatum
ref|XP_007033994.1|  RAB GTPase A5E isoform 1                           310   6e-103   
ref|XP_009791655.1|  PREDICTED: ras-related protein RABA5c-like         310   7e-103   Nicotiana sylvestris
ref|XP_008811658.1|  PREDICTED: ras-related protein RABA5e              310   8e-103   Phoenix dactylifera
ref|XP_004248020.1|  PREDICTED: ras-related protein RABA5c-like         309   1e-102   Solanum lycopersicum
ref|XP_006358795.1|  PREDICTED: ras-related protein RABA5b-like         309   1e-102   Solanum tuberosum [potatoes]
ref|XP_003532321.1|  PREDICTED: ras-related protein RABA5d              309   2e-102   
ref|XP_004296709.1|  PREDICTED: ras-related protein RABA5e              309   2e-102   Fragaria vesca subsp. vesca
gb|ACJ84485.1|  unknown                                                 309   2e-102   Medicago truncatula
ref|XP_009628055.1|  PREDICTED: ras-related protein RABA5c-like         308   2e-102   Nicotiana tomentosiformis
gb|AAA74116.1|  putative                                                308   3e-102   Nicotiana tabacum [American tobacco]
ref|XP_007139106.1|  hypothetical protein PHAVU_008G001800g             308   3e-102   Phaseolus vulgaris [French bean]
ref|XP_006366713.1|  PREDICTED: ras-related protein RABA5e-like         308   4e-102   Solanum tuberosum [potatoes]
ref|XP_009334262.1|  PREDICTED: ras-related protein RABA5c-like         308   4e-102   Pyrus x bretschneideri [bai li]
emb|CDP10336.1|  unnamed protein product                                308   5e-102   Coffea canephora [robusta coffee]
ref|XP_002321111.1|  Ras-related protein ARA-4                          307   8e-102   
ref|XP_011042789.1|  PREDICTED: ras-related protein RABA5d-like         307   9e-102   Populus euphratica
ref|XP_009385993.1|  PREDICTED: ras-related protein RABA5c-like         307   9e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009358989.1|  PREDICTED: ras-related protein RABA5b              307   9e-102   Pyrus x bretschneideri [bai li]
ref|XP_008380689.1|  PREDICTED: ras-related protein RABA5e              306   1e-101   Malus domestica [apple tree]
ref|XP_004248001.1|  PREDICTED: ras-related protein RABA5e-like         306   1e-101   Solanum lycopersicum
ref|XP_006856830.1|  hypothetical protein AMTR_s00055p00167390          306   1e-101   Amborella trichopoda
ref|XP_010926654.1|  PREDICTED: ras-related protein RABA5e-like i...    306   2e-101   
ref|XP_009348339.1|  PREDICTED: ras-related protein RABA5e              306   2e-101   Pyrus x bretschneideri [bai li]
gb|KHG13174.1|  Ras-related RABA5d -like protein                        306   2e-101   Gossypium arboreum [tree cotton]
ref|XP_004515580.1|  PREDICTED: ras-related protein RABA5e-like         306   2e-101   Cicer arietinum [garbanzo]
ref|XP_010927595.1|  PREDICTED: ras-related protein RABA5c-like         305   5e-101   Elaeis guineensis
ref|XP_004152077.1|  PREDICTED: ras-related protein RABA5d-like         305   5e-101   Cucumis sativus [cucumbers]
ref|XP_006294977.1|  hypothetical protein CARUB_v10024045mg             305   6e-101   Capsella rubella
ref|XP_008792967.1|  PREDICTED: ras-related protein RABA5d-like         304   8e-101   Phoenix dactylifera
ref|XP_009339876.1|  PREDICTED: ras-related protein RABA5e              305   9e-101   Pyrus x bretschneideri [bai li]
ref|XP_008453919.1|  PREDICTED: ras-related protein RABA5d              304   9e-101   Cucumis melo [Oriental melon]
gb|AFK35472.1|  unknown                                                 304   1e-100   Medicago truncatula
ref|XP_002881887.1|  hypothetical protein ARALYDRAFT_903694             304   1e-100   
gb|EYU32725.1|  hypothetical protein MIMGU_mgv1a013434mg                304   1e-100   Erythranthe guttata [common monkey flower]
ref|XP_009415105.1|  PREDICTED: ras-related protein RABA5e-like         303   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_181842.1|  Ras-related protein ARA-4                             304   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411588.1|  hypothetical protein EUTSA_v10017231mg             303   2e-100   Eutrema salsugineum [saltwater cress]
ref|XP_010522214.1|  PREDICTED: ras-related protein RABA5d              303   2e-100   Tarenaya hassleriana [spider flower]
emb|CDY42801.1|  BnaC03g24050D                                          303   2e-100   Brassica napus [oilseed rape]
gb|KFK37154.1|  hypothetical protein AALP_AA4G220200                    303   3e-100   Arabis alpina [alpine rockcress]
ref|XP_007034146.1|  RAB GTPase A5E isoform 1                           303   3e-100   Theobroma cacao [chocolate]
ref|XP_010506172.1|  PREDICTED: ras-related protein RABA5c-like         303   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010542762.1|  PREDICTED: ras-related protein RABA5d-like         303   4e-100   Tarenaya hassleriana [spider flower]
gb|KJB28019.1|  hypothetical protein B456_005G022300                    302   5e-100   Gossypium raimondii
gb|KJB27937.1|  hypothetical protein B456_005G017600                    302   5e-100   Gossypium raimondii
ref|XP_010508467.1|  PREDICTED: ras-related protein RABA5c              302   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_009133574.1|  PREDICTED: ras-related protein RABA5c              302   9e-100   Brassica rapa
emb|CDX83500.1|  BnaA03g20060D                                          301   1e-99    
gb|EMS53467.1|  Ras-related protein RABA5c                              301   1e-99    Triticum urartu
ref|XP_003574801.1|  PREDICTED: ras-related protein RABA5c-like         301   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_004973932.1|  PREDICTED: ras-related protein RABA5d-like         301   1e-99    Setaria italica
ref|XP_010517866.1|  PREDICTED: ras-related protein RABA5c-like         301   2e-99    Camelina sativa [gold-of-pleasure]
gb|EMT31969.1|  Ras-related protein ARA-4                               301   2e-99    
ref|XP_010457681.1|  PREDICTED: ras-related protein RABA5e-like         300   4e-99    Camelina sativa [gold-of-pleasure]
gb|KJB71848.1|  hypothetical protein B456_011G144500                    301   5e-99    Gossypium raimondii
sp|P19892.1|RAA5E_ARATH  RecName: Full=Ras-related protein RABA5e...    300   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410298.1|  hypothetical protein EUTSA_v10017221mg             299   1e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010069409.1|  PREDICTED: ras-related protein RABA5e-like         299   1e-98    Eucalyptus grandis [rose gum]
ref|NP_563750.2|  RAB GTPase homolog A5E                                300   1e-98    
emb|CDY17945.1|  BnaC04g02740D                                          299   1e-98    Brassica napus [oilseed rape]
gb|EPS70637.1|  hypothetical protein M569_04122                         299   1e-98    Genlisea aurea
dbj|BAJ85419.1|  predicted protein                                      298   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL36203.1|  putative RAS-related protein ARA-1                      298   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KHG12252.1|  Ras-related RABA5e -like protein                        298   2e-98    Gossypium arboreum [tree cotton]
gb|KHG11710.1|  Ras-related RABA5d -like protein                        298   2e-98    Gossypium arboreum [tree cotton]
ref|XP_010553589.1|  PREDICTED: ras-related protein RABA5c-like         298   2e-98    Tarenaya hassleriana [spider flower]
ref|XP_006659598.1|  PREDICTED: ras-related protein RABA5c-like         298   2e-98    Oryza brachyantha
ref|XP_009142914.1|  PREDICTED: ras-related protein RABA5c-like         298   3e-98    Brassica rapa
ref|NP_001152371.1|  ras-related protein ARA-4                          298   3e-98    Zea mays [maize]
ref|XP_010475301.1|  PREDICTED: ras-related protein RABA5e-like         298   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_002444720.1|  hypothetical protein SORBIDRAFT_07g026600          297   5e-98    Sorghum bicolor [broomcorn]
ref|XP_002881188.1|  hypothetical protein ARALYDRAFT_902201             297   5e-98    Arabidopsis lyrata subsp. lyrata
ref|NP_180726.1|  RAB GTPase-like protein A5D                           297   7e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673314.1|  PREDICTED: ras-related protein RABA5d-like         296   9e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK31198.1|  hypothetical protein AALP_AA6G080900                    296   1e-97    Arabis alpina [alpine rockcress]
gb|ABK21873.1|  unknown                                                 296   1e-97    Picea sitchensis
ref|NP_001062290.1|  Os08g0525000                                       296   1e-97    
gb|KFK42915.1|  hypothetical protein AALP_AA1G054800                    296   2e-97    Arabis alpina [alpine rockcress]
ref|XP_010485339.1|  PREDICTED: ras-related protein RABA5e isofor...    296   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_006293514.1|  hypothetical protein CARUB_v10024030mg             296   2e-97    Capsella rubella
ref|XP_002889568.1|  hypothetical protein ARALYDRAFT_887774             295   4e-97    Arabidopsis lyrata subsp. lyrata
emb|CDP10276.1|  unnamed protein product                                295   4e-97    Coffea canephora [robusta coffee]
ref|XP_006305597.1|  hypothetical protein CARUB_v10010263mg             295   7e-97    Capsella rubella
ref|XP_006417985.1|  hypothetical protein EUTSA_v10008743mg             295   7e-97    Eutrema salsugineum [saltwater cress]
ref|XP_010485340.1|  PREDICTED: ras-related protein RABA5e isofor...    293   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010469687.1|  PREDICTED: ras-related protein RABA5d              293   2e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009144057.1|  PREDICTED: ras-related protein RABA5d              292   6e-96    Brassica rapa
ref|XP_010926653.1|  PREDICTED: ras-related protein RABA5e-like i...    292   8e-96    
ref|XP_007033995.1|  RAB GTPase A5E isoform 2                           291   8e-96    
ref|XP_010451632.1|  PREDICTED: ras-related protein RABA5b-like i...    291   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010486290.1|  PREDICTED: ras-related protein RABA5b isofor...    291   1e-95    
ref|XP_009383333.1|  PREDICTED: ras-related protein RABA5c-like         291   2e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84764.1|  BnaA03g14660D                                          290   3e-95    
gb|AAM62720.1|  putative RAS superfamily GTP-binding protein            290   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414098.1|  PREDICTED: ras-related protein RABA5d-like         290   7e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010510172.1|  PREDICTED: ras-related protein RABA5d-like         289   9e-95    Camelina sativa [gold-of-pleasure]
emb|CDX79430.1|  BnaC03g17660D                                          289   1e-94    
ref|XP_009118574.1|  PREDICTED: ras-related protein RABA5e              288   2e-94    Brassica rapa
emb|CDY06181.1|  BnaA09g50220D                                          288   4e-94    
ref|XP_009132810.1|  PREDICTED: ras-related protein RABA5d-like         286   9e-94    Brassica rapa
gb|EEC83910.1|  hypothetical protein OsI_29960                          293   9e-94    Oryza sativa Indica Group [Indian rice]
emb|CDY10008.1|  BnaC08g44430D                                          288   1e-93    Brassica napus [oilseed rape]
ref|XP_007034147.1|  RAB GTPase A5E isoform 2                           286   2e-93    
gb|EEE69027.1|  hypothetical protein OsJ_28001                          292   3e-93    Oryza sativa Japonica Group [Japonica rice]
gb|KJB28020.1|  hypothetical protein B456_005G022300                    285   3e-93    Gossypium raimondii
ref|XP_010557057.1|  PREDICTED: ras-related protein RABA5d-like         283   3e-92    Tarenaya hassleriana [spider flower]
gb|AAA68983.1|  small GTP-binding protein                               282   5e-92    Brassica napus [oilseed rape]
gb|EPS70121.1|  hypothetical protein M569_04642                         280   5e-91    Genlisea aurea
gb|ABR17569.1|  unknown                                                 275   3e-89    Picea sitchensis
gb|ACN40515.1|  unknown                                                 275   3e-89    Picea sitchensis
gb|KHN12586.1|  Ras-related protein RABA5e                              263   4e-85    Glycine soja [wild soybean]
ref|XP_008244729.1|  PREDICTED: ras-related protein RABA5d              261   3e-84    
gb|KHN18294.1|  Ras-related protein RABA5d                              256   4e-82    Glycine soja [wild soybean]
ref|XP_002961452.1|  rab family GTPase                                  255   1e-81    Selaginella moellendorffii
ref|XP_002971361.1|  rab family GTPase                                  255   2e-81    Selaginella moellendorffii
ref|XP_001780193.1|  Rab11/RabA-family small GTPase                     251   5e-80    
ref|XP_011095944.1|  PREDICTED: ras-related protein RABA5a              251   1e-79    Sesamum indicum [beniseed]
ref|XP_001783000.1|  Rab11/RabA-family small GTPase                     250   2e-79    
ref|XP_001753288.1|  Rab11/RabA-family small GTPase                     249   4e-79    
ref|XP_002976591.1|  rab family GTPase                                  248   2e-78    Selaginella moellendorffii
ref|XP_010494988.1|  PREDICTED: ras-related protein RABA5a-like         247   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010688595.1|  PREDICTED: ras-related protein RABA5a              248   2e-78    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY25963.1|  BnaC09g20240D                                          247   4e-78    Brassica napus [oilseed rape]
gb|ABD64975.1|  Ras family GTP-binding protein                          246   5e-78    Brassica oleracea
ref|XP_009101412.1|  PREDICTED: ras-related protein RABA5a-like         246   8e-78    Brassica rapa
emb|CDP04500.1|  unnamed protein product                                246   8e-78    Coffea canephora [robusta coffee]
emb|CDY17729.1|  BnaA06g35480D                                          246   9e-78    Brassica napus [oilseed rape]
ref|XP_009114272.1|  PREDICTED: ras-related protein RABA5a              246   1e-77    
ref|XP_004250277.1|  PREDICTED: ras-related protein RABA5a              246   1e-77    Solanum lycopersicum
ref|XP_001772977.1|  Rab11/RabA-family small GTPase                     245   1e-77    
ref|XP_006398449.1|  hypothetical protein EUTSA_v10001017mg             245   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_010441443.1|  PREDICTED: ras-related protein RABA5a              245   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_002973313.1|  rab family GTPase                                  245   2e-77    Selaginella moellendorffii
ref|XP_002863339.1|  hypothetical protein ARALYDRAFT_494220             245   2e-77    
ref|XP_010530048.1|  PREDICTED: ras-related protein RABA5a              245   2e-77    Tarenaya hassleriana [spider flower]
ref|NP_199563.1|  RAB GTPase homolog A5A                                245   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010655425.1|  PREDICTED: ras-related protein RABA5a              244   3e-77    Vitis vinifera
ref|XP_006352344.1|  PREDICTED: ras-related protein RABA5a-like i...    244   4e-77    Solanum tuberosum [potatoes]
gb|ABD64936.1|  Ras-related GTP-binding protein, putative               244   5e-77    Brassica oleracea
ref|XP_006365849.1|  PREDICTED: ras-related protein RABA5a-like i...    244   7e-77    
ref|XP_004239823.1|  PREDICTED: ras-related protein RABA5a-like         244   7e-77    
ref|XP_009776623.1|  PREDICTED: ras-related protein RABA5a-like         243   9e-77    Nicotiana sylvestris
ref|XP_009625286.1|  PREDICTED: ras-related protein RABA5a-like         243   1e-76    Nicotiana tomentosiformis
ref|XP_009775501.1|  PREDICTED: ras-related protein RABA5a-like         243   1e-76    Nicotiana sylvestris
gb|EYU27682.1|  hypothetical protein MIMGU_mgv1a013213mg                243   1e-76    Erythranthe guttata [common monkey flower]
ref|XP_011086244.1|  PREDICTED: ras-related protein RABA5a-like i...    243   1e-76    Sesamum indicum [beniseed]
ref|XP_009128976.1|  PREDICTED: ras-related protein RABA5a-like         243   2e-76    Brassica rapa
gb|ADE77345.1|  unknown                                                 243   2e-76    Picea sitchensis
gb|ABD65003.1|  Ras-related GTP-binding protein, putative               242   3e-76    Brassica oleracea
ref|XP_004139534.1|  PREDICTED: ras-related protein RABA5a-like         242   3e-76    Cucumis sativus [cucumbers]
ref|XP_008384161.1|  PREDICTED: ras-related protein RABA5a isofor...    242   3e-76    
ref|XP_008345797.1|  PREDICTED: ras-related protein RABA5a-like i...    241   5e-76    Malus domestica [apple tree]
ref|XP_009350510.1|  PREDICTED: ras-related protein RABA5a-like         241   5e-76    
ref|XP_008463615.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    241   5e-76    Cucumis melo [Oriental melon]
gb|EYU33848.1|  hypothetical protein MIMGU_mgv1a012931mg                241   7e-76    Erythranthe guttata [common monkey flower]
ref|XP_008792135.1|  PREDICTED: ras-related protein RABA5a-like         241   7e-76    Phoenix dactylifera
emb|CAA82710.1|  guanine nucleotide regulatory protein                  241   8e-76    Vicia faba [broad bean]
emb|CDY28925.1|  BnaA02g25510D                                          241   9e-76    Brassica napus [oilseed rape]
ref|XP_009402895.1|  PREDICTED: ras-related protein RABA5a-like         240   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265418.1|  PREDICTED: ras-related protein RABA5a              240   1e-75    Nelumbo nucifera [Indian lotus]
gb|KHF97840.1|  Ras-related protein RABA5a                              240   2e-75    Gossypium arboreum [tree cotton]
gb|KEH42936.1|  RAB GTPase-like protein C2B                             240   2e-75    Medicago truncatula
gb|KJB69168.1|  hypothetical protein B456_011G009000                    239   3e-75    Gossypium raimondii
ref|XP_007143969.1|  hypothetical protein PHAVU_007G117800g             239   3e-75    Phaseolus vulgaris [French bean]
ref|XP_007026285.1|  RAB GTPase A5A isoform 1                           239   4e-75    Theobroma cacao [chocolate]
ref|XP_006605347.1|  PREDICTED: uncharacterized protein LOC100789...    239   5e-75    Glycine max [soybeans]
ref|XP_004495529.1|  PREDICTED: ras-related protein RABA5a-like i...    239   5e-75    Cicer arietinum [garbanzo]
ref|XP_002528238.1|  protein with unknown function                      239   5e-75    Ricinus communis
gb|KJB67359.1|  hypothetical protein B456_010G188100                    239   5e-75    Gossypium raimondii
ref|XP_004293379.1|  PREDICTED: ras-related protein RABA5a              239   5e-75    Fragaria vesca subsp. vesca
ref|XP_010052941.1|  PREDICTED: ras-related protein RABA5a-like         239   6e-75    Eucalyptus grandis [rose gum]
ref|XP_006449885.1|  hypothetical protein CICLE_v10017675mg             239   6e-75    Citrus clementina [clementine]
ref|XP_004958435.1|  PREDICTED: ras-related protein RABA5a-like         239   6e-75    Setaria italica
ref|XP_006443137.1|  hypothetical protein CICLE_v10022137mg             237   6e-75    
ref|XP_003536164.1|  PREDICTED: ras-related protein RABA5a-like i...    239   6e-75    Glycine max [soybeans]
emb|CAA98186.1|  RAB11J                                                 239   6e-75    Lotus japonicus
ref|XP_010094689.1|  Ras-related protein RABA5a                         239   7e-75    Morus notabilis
dbj|BAJ99159.1|  predicted protein                                      238   8e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002461085.1|  hypothetical protein SORBIDRAFT_02g040430          238   8e-75    Sorghum bicolor [broomcorn]
ref|XP_007211991.1|  hypothetical protein PRUPE_ppa011035mg             238   1e-74    Prunus persica
gb|EPS57442.1|  hypothetical protein M569_17375                         238   1e-74    Genlisea aurea
ref|NP_001242668.1|  uncharacterized protein LOC100789187               238   1e-74    
gb|AAD48018.1|  Rab GTP-binding protein Rab11a                          238   1e-74    Gossypium hirsutum [American cotton]
ref|XP_007026286.1|  RAB GTPase A5A isoform 2                           239   1e-74    
ref|XP_006658004.1|  PREDICTED: ras-related protein RABA5a-like         238   2e-74    Oryza brachyantha
ref|XP_008785540.1|  PREDICTED: ras-related protein RABA5a-like         237   4e-74    Phoenix dactylifera
ref|NP_001060379.1|  Os07g0634200                                       236   4e-74    
ref|XP_009388661.1|  PREDICTED: ras-related protein RABA5a-like         236   6e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS61230.1|  hypothetical protein M569_13568                         236   8e-74    Genlisea aurea
gb|KDP36442.1|  hypothetical protein JCGZ_09512                         236   8e-74    Jatropha curcas
ref|XP_009399771.1|  PREDICTED: ras-related protein RABA5a-like         236   9e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002323139.1|  GTP-binding family protein                         236   1e-73    Populus trichocarpa [western balsam poplar]
ref|NP_001131951.1|  uncharacterized protein LOC100193344               236   1e-73    Zea mays [maize]
ref|XP_003562615.1|  PREDICTED: ras-related protein RABA5a              236   1e-73    Brachypodium distachyon [annual false brome]
ref|XP_002985624.1|  rab family GTPase                                  235   1e-73    Selaginella moellendorffii
ref|XP_002974254.1|  rab family GTPase                                  235   1e-73    Selaginella moellendorffii
ref|XP_010914967.1|  PREDICTED: ras-related protein RABA5a-like         235   2e-73    
ref|XP_010925279.1|  PREDICTED: ras-related protein RABA5a-like         235   2e-73    Elaeis guineensis
ref|XP_002307897.1|  GTP-binding family protein                         234   6e-73    Populus trichocarpa [western balsam poplar]
gb|EMS66232.1|  Ras-related protein RABA5a                              237   1e-72    Triticum urartu
ref|XP_010057822.1|  PREDICTED: ras-related protein RABA5a-like         232   2e-72    Eucalyptus grandis [rose gum]
gb|EAZ40784.1|  hypothetical protein OsJ_25262                          233   3e-72    Oryza sativa Japonica Group [Japonica rice]
gb|AAB47558.1|  Nt-rab11e homolog                                       230   3e-72    Mesembryanthemum crystallinum
gb|AAD48019.1|  Rab GTP-binding protein Rab11b                          231   4e-72    Gossypium hirsutum [American cotton]
ref|XP_011004494.1|  PREDICTED: ras-related protein RABA5a-like         231   8e-72    Populus euphratica
ref|XP_006676182.1|  hypothetical protein BATDEDRAFT_85182              228   5e-71    Batrachochytrium dendrobatidis JAM81
ref|XP_002108851.1|  conserved hypothetical protein                     228   1e-70    Trichoplax adhaerens
ref|XP_001691863.1|  small rab-related GTPase                           227   1e-70    Chlamydomonas reinhardtii
ref|XP_006650877.1|  PREDICTED: ras-related protein RABA2a-like         227   3e-70    Oryza brachyantha
emb|CAA54507.1|  GTP binding protein                                    224   3e-70    Glycine max [soybeans]
gb|ABK22282.1|  unknown                                                 226   3e-70    Picea sitchensis
ref|XP_008384163.1|  PREDICTED: ras-related protein RABA5a isofor...    226   4e-70    
ref|XP_010672725.1|  PREDICTED: ras-related protein RABA4d              226   4e-70    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008345798.1|  PREDICTED: ras-related protein RABA5a-like i...    226   6e-70    Malus domestica [apple tree]
ref|XP_009400079.1|  PREDICTED: ras-related protein RABA1f-like         226   6e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389492.1|  hypothetical protein POPTR_0022s00350g             225   8e-70    Populus trichocarpa [western balsam poplar]
ref|XP_007148577.1|  hypothetical protein PHAVU_006G220200g             225   1e-69    
ref|XP_005785543.1|  ras-related protein                                225   1e-69    
emb|CBY08492.1|  unnamed protein product                                225   1e-69    
ref|XP_011011334.1|  PREDICTED: ras-related protein RABA2a              225   1e-69    
ref|XP_003532818.1|  PREDICTED: ras-related protein Rab11A-like         224   1e-69    
ref|XP_010926662.1|  PREDICTED: ras-related protein RABA4d-like         224   2e-69    
gb|KHN29041.1|  Ras-related protein Rab11A                              225   2e-69    
ref|XP_004969476.1|  PREDICTED: ras-related protein RABA1f-like         224   2e-69    
ref|XP_009394820.1|  PREDICTED: ras-related protein Rab11B-like         224   2e-69    
ref|XP_002532404.1|  protein with unknown function                      225   2e-69    
ref|XP_001756119.1|  Rab11/RabA-family small GTPase                     224   2e-69    
ref|XP_005843019.1|  hypothetical protein CHLNCDRAFT_33302              224   2e-69    
gb|ACO11934.1|  Ras-related protein Rab-11B                             224   2e-69    
ref|XP_001766403.1|  predicted protein                                  224   2e-69    
ref|XP_003035463.1|  GTPase                                             224   3e-69    
ref|XP_002950461.1|  RabA/Rab11                                         224   3e-69    
ref|XP_001772994.1|  Rab11/RabA-family small GTPase                     224   3e-69    
gb|KIO07819.1|  hypothetical protein M404DRAFT_997960                   224   3e-69    
ref|XP_001776696.1|  Rab11/RabA-family small GTPase                     224   3e-69    
gb|ACO12107.1|  Ras-related protein Rab-11B                             224   4e-69    
ref|XP_011047877.1|  PREDICTED: ras-related protein RABA2a-like         224   4e-69    
ref|XP_001757189.1|  Rab11/RabA-family small GTPase                     224   4e-69    
ref|XP_007159716.1|  hypothetical protein PHAVU_002G261400g             224   5e-69    
gb|KIM68075.1|  hypothetical protein SCLCIDRAFT_1209458                 223   5e-69    
ref|XP_007764993.1|  GTPase                                             223   6e-69    
ref|XP_006458621.1|  hypothetical protein AGABI2DRAFT_134329            223   6e-69    
ref|XP_009393549.1|  PREDICTED: ras-related protein Rab11D-like         223   7e-69    
gb|KJB36087.1|  hypothetical protein B456_006G140300                    223   7e-69    
ref|XP_010276281.1|  PREDICTED: ras-related protein RABA1f-like         223   7e-69    
ref|XP_009790362.1|  PREDICTED: ras-related protein RABA1f              223   7e-69    
ref|XP_001839906.1|  GTPase                                             223   8e-69    
ref|XP_010926325.1|  PREDICTED: ras-related protein Rab11D-like i...    223   9e-69    
ref|XP_004229604.1|  PREDICTED: ras-related protein RGP1                223   9e-69    
gb|ADD24151.1|  Ras-related protein Rab-11A                             223   9e-69    
ref|XP_006859000.1|  hypothetical protein AMTR_s00068p00145200          223   9e-69    
gb|KHG20755.1|  Ras-related RABA4d -like protein                        223   1e-68    
ref|XP_002282798.1|  PREDICTED: ras-related protein RABA4d              223   1e-68    
ref|XP_002264444.1|  PREDICTED: ras-related protein RABA2a              223   1e-68    
ref|XP_002513185.1|  protein with unknown function                      223   1e-68    
gb|KHG02480.1|  Ras-related RABA4d -like protein                        223   1e-68    
ref|NP_001051860.1|  Os03g0843100                                       223   1e-68    
ref|XP_007028923.1|  RAB GTPase A4D                                     223   1e-68    
ref|XP_001659918.1|  AAEL009317-PA                                      222   1e-68    
ref|XP_001238828.3|  AGAP004559-PA                                      222   1e-68    
ref|XP_001845712.1|  conserved hypothetical protein                     222   1e-68    
ref|XP_002969056.1|  rab family GTPase                                  222   1e-68    
ref|XP_010245424.1|  PREDICTED: ras-related protein RABA2a              222   1e-68    
emb|CDJ83585.1|  Ras domain containing protein                          222   1e-68    
gb|KDE05872.1|  Ras-like protein Rab-11B                                222   1e-68    
ref|XP_004086096.1|  PREDICTED: ras-related protein Rab-11A             222   2e-68    
emb|CDO97631.1|  unnamed protein product                                222   2e-68    
ref|XP_007041174.1|  RAB GTPase 11C                                     222   2e-68    
ref|XP_008782165.1|  PREDICTED: ras-related protein Rab11D-like         222   2e-68    
ref|XP_006628795.1|  PREDICTED: ras-related protein Rab-11A-like        222   2e-68    
ref|XP_003458518.1|  PREDICTED: ras-related protein Rab-11A-like        222   2e-68    
ref|XP_002461823.1|  hypothetical protein SORBIDRAFT_02g008790          222   2e-68    
ref|XP_008874506.1|  hypothetical protein H310_10046                    222   2e-68    
ref|XP_002969267.1|  rab family GTPase                                  222   2e-68    
ref|XP_002972485.1|  rab family GTPase                                  222   2e-68    
gb|KIY62515.1|  ras-domain-containing protein                           222   2e-68    
ref|XP_003525046.1|  PREDICTED: ras-related protein Rab11A              222   2e-68    
sp|P22129.1|RB11B_DIPOM  RecName: Full=Ras-related protein Rab-11...    222   2e-68    
ref|XP_009590361.1|  PREDICTED: ras-related protein RABA4d-like         222   2e-68    
gb|AFK11003.1|  ras-related protein Rab-11A isoform 1                   222   2e-68    
ref|XP_007264419.1|  ras-domain-containing protein                      222   2e-68    
gb|AAB97114.1|  small GTP-binding protein                               222   2e-68    
ref|XP_002984315.1|  rab family GTPase                                  222   2e-68    
gb|ABR18090.1|  unknown                                                 222   2e-68    
ref|XP_003562556.1|  PREDICTED: ras-related protein RABA2a-like         222   2e-68    
ref|NP_001007360.1|  ras-related protein Rab-11A                        222   2e-68    
gb|EJT45277.1|  hypothetical protein A1Q1_06346                         221   2e-68    
gb|ACU16457.1|  unknown                                                 222   2e-68    
ref|XP_005990165.1|  PREDICTED: ras-related protein Rab-11A             221   2e-68    
ref|XP_009409079.1|  PREDICTED: ras-related protein RABA1f-like         221   2e-68    
ref|XP_010865296.1|  PREDICTED: ras-related protein Rab-11A             221   2e-68    
ref|XP_005645863.1|  ras-related protein Rab2BV                         221   2e-68    
gb|AEE62823.1|  unknown                                                 221   2e-68    
ref|XP_008373738.1|  PREDICTED: ras-related protein RABA4d              222   3e-68    
gb|AFA52576.1|  Rab11 family GTPase                                     223   3e-68    
ref|XP_002892514.1|  hypothetical protein ARALYDRAFT_888208             221   3e-68    
ref|XP_010896300.1|  PREDICTED: ras-related protein Rab-11A             221   3e-68    
ref|XP_009392437.1|  PREDICTED: ras-related protein RABA1f-like i...    221   3e-68    
ref|XP_010232115.1|  PREDICTED: ras-related protein RABA1f-like         221   3e-68    
gb|ADT91500.1|  small monomeric GTPase                                  221   3e-68    
ref|XP_008308552.1|  PREDICTED: ras-related protein Rab-11A             221   3e-68    
gb|KHG18297.1|  Ras-related RABA2a -like protein                        221   3e-68    
gb|ELU17603.1|  hypothetical protein CAPTEDRAFT_226009                  221   3e-68    
gb|EJU05816.1|  ras-domain-containing protein                           221   3e-68    
ref|XP_009763158.1|  PREDICTED: ras-related protein RABA4d-like         221   3e-68    
ref|XP_006349310.1|  PREDICTED: ras-related protein RABA2a-like         221   3e-68    
gb|EYU35014.1|  hypothetical protein MIMGU_mgv1a013570mg                221   3e-68    
ref|XP_004234844.1|  PREDICTED: ras-related protein RABA4d-like         221   4e-68    
ref|XP_010641615.1|  PREDICTED: ras-related protein Rab-11A             221   4e-68    
ref|XP_009629631.1|  PREDICTED: ras-related protein RABA5a-like i...    221   4e-68    
gb|ABK24490.1|  unknown                                                 221   4e-68    
ref|XP_006366509.1|  PREDICTED: ras-related protein RGP1-like           221   4e-68    
ref|XP_010544112.1|  PREDICTED: ras-related protein RABA2a              221   4e-68    
gb|KJB47889.1|  hypothetical protein B456_008G046400                    221   4e-68    
ref|XP_002605587.1|  hypothetical protein BRAFLDRAFT_266781             221   4e-68    
ref|XP_008240816.1|  PREDICTED: ras-related protein RABA4d              221   4e-68    
ref|XP_004230439.1|  PREDICTED: ras-related protein RABA2a              221   4e-68    
gb|AAP48704.1|  rab11-2                                                 221   4e-68    
gb|EYU28111.1|  hypothetical protein MIMGU_mgv1a013511mg                221   4e-68    
ref|XP_009769694.1|  PREDICTED: ras-related protein RABA2a              221   4e-68    
gb|ABX10878.1|  RAB11B                                                  221   4e-68    
ref|NP_001005827.1|  ras-related protein Rab-11A                        221   4e-68    
gb|ELR60022.1|  Ras-related protein Rab-11B                             221   5e-68    
ref|XP_005305427.1|  PREDICTED: ras-related protein Rab-11A             221   5e-68    
ref|XP_006660539.1|  PREDICTED: ras-related protein RABA1f-like         221   5e-68    
ref|NP_001240030.1|  uncharacterized protein LOC100797258               221   5e-68    
ref|NP_116006.1|  ras-related protein Rab-11B                           221   5e-68    
gb|ABX10876.1|  RAB11B                                                  221   5e-68    
ref|XP_007212038.1|  hypothetical protein PRUPE_ppa011278mg             221   5e-68    
emb|CDY50888.1|  BnaCnng19800D                                          221   5e-68    
ref|XP_004886674.1|  PREDICTED: ras-related protein Rab-11B isofo...    221   5e-68    
ref|XP_001878474.1|  predicted protein                                  221   5e-68    
ref|XP_008119051.1|  PREDICTED: ras-related protein Rab-11A             221   5e-68    
gb|ACL68712.1|  FI09227p                                                221   5e-68    
ref|XP_004068248.1|  PREDICTED: ras-related protein Rab-11B-like        221   5e-68    
dbj|BAG59943.1|  unnamed protein product                                222   5e-68    
ref|XP_005081376.1|  PREDICTED: ras-related protein Rab-11B             221   5e-68    
ref|NP_004654.1|  ras-related protein Rab-11A isoform 1                 221   5e-68    
ref|XP_008672109.1|  PREDICTED: hypothetical protein isoform X1         221   5e-68    
ref|NP_477170.1|  Rab11, isoform B                                      221   6e-68    
ref|XP_008811552.1|  PREDICTED: ras-related protein RABA1f              221   6e-68    
gb|ABQ59034.1|  RAB11B protein                                          221   6e-68    
gb|AAP36283.1|  Homo sapiens RAB11A, member RAS oncogene family         221   6e-68    
ref|NP_001012569.1|  ras-related protein Rab-11B                        221   6e-68    
ref|XP_009340444.1|  PREDICTED: ras-related protein RABA1f-like         221   6e-68    
gb|KHN39681.1|  Ras-related protein RABA2a                              221   6e-68    
ref|XP_008777885.1|  PREDICTED: ras-related protein RABA1f-like         221   6e-68    
emb|CDP07731.1|  unnamed protein product                                221   6e-68    
ref|XP_007204003.1|  hypothetical protein PRUPE_ppa025526mg             221   6e-68    
ref|XP_002639326.1|  C. briggsae CBR-RAB-11.1 protein                   220   6e-68    
ref|XP_010917311.1|  PREDICTED: ras-related protein Rab11D-like         221   6e-68    
ref|NP_001131943.1|  Ras protein Rab11A                                 221   6e-68    
gb|AAP51290.1|  Rab11-1a                                                221   6e-68    
ref|XP_004711990.1|  PREDICTED: ras-related protein Rab-11A             221   6e-68    
gb|AAF36458.1|AF127669_1  small GTPase                                  221   7e-68    
ref|XP_006381042.1|  Ras-related GTP-binding family protein             221   7e-68    
ref|XP_005830706.1|  hypothetical protein GUITHDRAFT_159767             221   7e-68    
gb|EGT39029.1|  hypothetical protein CAEBREN_12928                      220   7e-68    
gb|EMT24020.1|  Ras-related protein ARA-4                               223   7e-68    
gb|KIM87425.1|  hypothetical protein PILCRDRAFT_814947                  220   7e-68    
gb|AAI52631.1|  Zgc:92772 protein                                       220   7e-68    
ref|XP_010927862.1|  PREDICTED: ras-related protein RABA2a-like         221   7e-68    
ref|XP_004294134.1|  PREDICTED: ras-related protein RABA1f              220   7e-68    
gb|KJB32873.1|  hypothetical protein B456_005G265900                    220   8e-68    
ref|XP_010930425.1|  PREDICTED: ras-related protein RABA2a-like         220   8e-68    
ref|XP_009148263.1|  PREDICTED: ras-related protein RABA2a              220   8e-68    
emb|CDX93495.1|  BnaA06g05530D                                          220   8e-68    
gb|ABK25126.1|  unknown                                                 221   8e-68    
gb|AAP51289.1|  Rab11-1c                                                220   8e-68    
gb|EMT13463.1|  Ras-related protein Rab11B                              220   8e-68    
ref|XP_775464.1|  hypothetical protein CNBE1790                         220   8e-68    
gb|AFR95462.1|  GTP-binding protein ypt3                                220   8e-68    
ref|XP_009413627.1|  PREDICTED: ras-related protein Rab11D-like         220   8e-68    
ref|XP_010919004.1|  PREDICTED: ras-related protein RABA1f              220   8e-68    
ref|XP_009380596.1|  PREDICTED: ras-related protein RABA1f-like         220   9e-68    
ref|XP_006421492.1|  hypothetical protein CICLE_v10005824mg             220   9e-68    
ref|XP_011210245.1|  PREDICTED: ras-related protein Rab-11A isofo...    220   9e-68    
gb|AAV38342.1|  RAB11B, member RAS oncogene family                      220   9e-68    
gb|KDP42462.1|  hypothetical protein JCGZ_00259                         220   9e-68    
ref|XP_007002577.1|  hypothetical protein TREMEDRAFT_42942              220   9e-68    
emb|CAG04850.1|  unnamed protein product                                220   9e-68    
ref|XP_009830528.1|  hypothetical protein H257_06851                    220   9e-68    
ref|XP_004535602.1|  PREDICTED: ras-related protein Rab-11A-like ...    220   9e-68    
ref|XP_010030204.1|  PREDICTED: ras-related protein RABA2a              220   9e-68    
ref|XP_010686371.1|  PREDICTED: ras-related protein RABA1f              220   9e-68    
gb|KHN27367.1|  Ras-related protein RABA4d                              220   9e-68    
ref|XP_006305601.1|  hypothetical protein CARUB_v10010267mg             220   9e-68    
emb|CDY55638.1|  BnaA03g58300D                                          220   1e-67    
emb|CDP10094.1|  unnamed protein product                                220   1e-67    
ref|XP_005178336.1|  PREDICTED: ras-related protein Rab-11A             220   1e-67    
ref|XP_010458259.1|  PREDICTED: ras-related protein RABA2a-like         220   1e-67    
ref|XP_006350040.1|  PREDICTED: ras-related protein RABA1f-like i...    220   1e-67    
ref|XP_009388403.1|  PREDICTED: ras-related protein RABA1f              220   1e-67    
gb|ACL98126.1|  RAB11B protein                                          220   1e-67    
emb|CAG46492.1|  RAB11B                                                 220   1e-67    
ref|XP_002526431.1|  protein with unknown function                      220   1e-67    
ref|XP_010754800.1|  PREDICTED: ras-related protein Rab-11B-like        220   1e-67    
ref|XP_004300007.1|  PREDICTED: ras-related protein RABA2a              220   1e-67    
ref|XP_010555372.1|  PREDICTED: ras-related protein RABA4b              220   1e-67    
ref|NP_001167800.1|  uncharacterized protein LOC100381498               220   1e-67    
ref|XP_001902705.1|  Ras-related protein Rab-11B                        220   1e-67    
ref|XP_001775770.1|  predicted protein                                  220   1e-67    
ref|NP_172434.1|  RAB GTPase 11C                                        220   1e-67    
ref|XP_009120881.1|  PREDICTED: ras-related protein RABA4d              220   1e-67    
ref|NP_187823.1|  RAB GTPase-like protein A4D                           220   1e-67    
gb|EDL33304.1|  mCG14915, isoform CRA_b                                 220   1e-67    
ref|XP_007873896.1|  hypothetical protein PNEG_01920                    219   1e-67    
ref|XP_004348926.1|  Ras-like protein Rab-11B                           220   1e-67    
ref|NP_001131787.1|  uncharacterized protein LOC100193158               220   1e-67    
ref|XP_009409482.1|  PREDICTED: ras-related protein RABA1f-like         220   1e-67    
emb|CDY00758.1|  BnaC03g37420D                                          220   1e-67    
gb|EHH29575.1|  GTP-binding protein YPT3                                220   1e-67    
ref|XP_002073567.1|  GK14185                                            219   1e-67    
ref|XP_010908030.1|  PREDICTED: ras-related protein RABA2a-like         220   1e-67    
ref|XP_003974065.1|  PREDICTED: ras-related protein Rab-11B-like        220   1e-67    
gb|AAX37062.1|  RAB11B member RAS oncogene family                       220   1e-67    
sp|Q40191.1|RB11A_LOTJA  RecName: Full=Ras-related protein Rab11A...    220   1e-67    
ref|XP_008452243.1|  PREDICTED: ras-related protein RABA2a              219   1e-67    
ref|XP_007112158.1|  PREDICTED: ras-related protein Rab-11A-like        219   1e-67    
ref|XP_002531672.1|  protein with unknown function                      220   1e-67    
ref|XP_010681762.1|  PREDICTED: ras-related protein RABA2a              219   1e-67    
emb|CAG38733.1|  RAB11B                                                 220   1e-67    
ref|XP_007906492.1|  PREDICTED: ras-related protein Rab-11B             219   1e-67    
ref|XP_011085322.1|  PREDICTED: ras-related protein RABA1d-like         219   1e-67    
ref|XP_010490210.1|  PREDICTED: ras-related protein RABA2a isofor...    219   1e-67    
ref|XP_003702539.1|  PREDICTED: ras-related protein Rab-11A-like        220   1e-67    
ref|XP_007385104.1|  GTPase                                             219   1e-67    
ref|NP_033023.1|  ras-related protein Rab-11B                           219   2e-67    
ref|XP_003439919.1|  PREDICTED: ras-related protein Rab-11B-like        219   2e-67    
ref|XP_009135214.1|  PREDICTED: ras-related protein RABA4d-like         220   2e-67    
ref|NP_001147252.1|  ras-related protein Rab11C                         219   2e-67    
gb|AJC97118.1|  Rab11A                                                  219   2e-67    
ref|XP_004133721.1|  PREDICTED: ras-related protein RABA2a-like         219   2e-67    
ref|NP_001151078.1|  ras-related protein Rab11C                         219   2e-67    
ref|XP_001607057.1|  PREDICTED: ras-related protein Rab-11A             219   2e-67    
tpg|DAA61047.1|  TPA: hypothetical protein ZEAMMB73_722788              220   2e-67    
ref|XP_006852544.1|  hypothetical protein AMTR_s00021p00189630          219   2e-67    



>ref|XP_009767908.1| PREDICTED: ras-related protein RABA5b-like [Nicotiana sylvestris]
Length=213

 Score =   361 bits (926),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 186/198 (94%), Positives = 196/198 (99%), Gaps = 0/198 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEIDGKEIKAQVWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFENIKRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFENIKRWLDELNTHCDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFFIETSALDSTNVNTAFEIVIR+IYKN+SRK+LNSDSYKAE
Sbjct  130  NIRDVSVEEGKSLAEEEGLFFIETSALDSTNVNTAFEIVIREIYKNLSRKVLNSDSYKAE  189

Query  159  LSVNRVSLANGADMSKQN  106
            LSVNRVSL+NG DMSKQN
Sbjct  190  LSVNRVSLSNGTDMSKQN  207



>ref|XP_009611217.1| PREDICTED: ras-related protein RABA5b [Nicotiana tomentosiformis]
Length=213

 Score =   360 bits (924),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 187/197 (95%), Positives = 195/197 (99%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFENIKRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFENIKRWLDELNTHCDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFFIETSALDSTNVNTAFEIVIR+IYKN+SRK+LNSDSYKAE
Sbjct  130  NIRDVSVEEGKNLAEEEGLFFIETSALDSTNVNTAFEIVIREIYKNLSRKVLNSDSYKAE  189

Query  159  LSVNRVSLANGADMSKQ  109
            LSVNRVSLANG DMSKQ
Sbjct  190  LSVNRVSLANGTDMSKQ  206



>ref|XP_004247033.1| PREDICTED: ras-related protein RABA5b-like [Solanum lycopersicum]
Length=210

 Score =   354 bits (909),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/197 (93%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  7    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  66

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R TTFENIKRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  67   QERFRAVTSAYYRGAVGALIVYDISRSTTFENIKRWLDELNTHCDTTVARMLVGNKCDLE  126

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVE+GK LAEEEGLFFIETSALDSTNV TAFEIVIR+IYKNVSRK+LNSDSYKAE
Sbjct  127  NIRDVSVEDGKNLAEEEGLFFIETSALDSTNVKTAFEIVIREIYKNVSRKVLNSDSYKAE  186

Query  159  LSVNRVSLANGADMSKQ  109
            LS NRVSLANG DMSKQ
Sbjct  187  LSFNRVSLANGTDMSKQ  203



>emb|CDP03946.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   352 bits (904),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKE+KAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEIKAQVWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE+ KRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  69   QERFRAVTSAYYRGAVGALIVYDISRKTTFESTKRWLDELNTHCDTTVARMLVGNKCDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IRDVSVEEGK LAEEEGLFFIETSAL+STNVN AFEIVIR+IY NVSRK LNSDSYKAE
Sbjct  129  DIRDVSVEEGKSLAEEEGLFFIETSALNSTNVNAAFEIVIREIYNNVSRKTLNSDSYKAE  188

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSLANG D+SKQNK
Sbjct  189  LSVNRVSLANGIDLSKQNK  207



>ref|XP_009762686.1| PREDICTED: ras-related protein RABA5b-like [Nicotiana sylvestris]
Length=213

 Score =   352 bits (902),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/197 (92%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEIDGKEIKAQVWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFENIK WL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFENIKCWLDELNTHCDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEGK LAEEEGLFFIETSALDSTNV TAFEIVIR+IYKN+SRK+LNSDSYK E
Sbjct  130  NIRDVSIEEGKNLAEEEGLFFIETSALDSTNVKTAFEIVIREIYKNLSRKVLNSDSYKTE  189

Query  159  LSVNRVSLANGADMSKQ  109
            LSVNRVSLANG DMSKQ
Sbjct  190  LSVNRVSLANGTDMSKQ  206



>ref|XP_011089627.1| PREDICTED: ras-related protein RABA5b-like [Sesamum indicum]
Length=214

 Score =   348 bits (892),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 193/197 (98%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKEVKAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVELDGKEVKAQVWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+RKTTFE++KRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  69   QERFRAVTSAYYRGAVGALVVYDISRKTTFESVKRWLDELNTHCDTTVARMLVGNKCDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSV+EGK LAEEEGLFFIETSALDSTNVN AFEIVIR+IY+ VSRK+LNSDSYKAE
Sbjct  129  NIREVSVDEGKSLAEEEGLFFIETSALDSTNVNKAFEIVIREIYEKVSRKILNSDSYKAE  188

Query  159  LSVNRVSLANGADMSKQ  109
            LSVNRVSLANG D+SKQ
Sbjct  189  LSVNRVSLANGVDLSKQ  205



>ref|XP_011089021.1| PREDICTED: ras-related protein RABA5b [Sesamum indicum]
Length=216

 Score =   343 bits (880),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 192/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVV++DGKE+KAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVDLDGKEIKAQVWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RK+TFE+IKRWL+ELNTHCDTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKSTFESIKRWLDELNTHCDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSV+EGK LAEEEGLFFIETSALDSTNVN AFEIVIR+IY  VSRK+LNSDSYKAE
Sbjct  130  NIREVSVDEGKGLAEEEGLFFIETSALDSTNVNKAFEIVIREIYDKVSRKILNSDSYKAE  189

Query  159  LSVNRVSLANGADMSKQ  109
            LSVNRVSLANG D+SK+
Sbjct  190  LSVNRVSLANGVDLSKE  206



>gb|EYU40652.1| hypothetical protein MIMGU_mgv1a013587mg [Erythranthe guttata]
Length=216

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQV+E+DGKEVKAQVWDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVLELDGKEVKAQVWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR TTFE+IKRWL+ELNTHCDT VA+MLVGNK DLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRITTFESIKRWLDELNTHCDTAVAKMLVGNKSDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEE K LAEEEGLFFIETSALDSTNVN +FEIVIR+IY  VSRK+LNSDSYKAE
Sbjct  130  HIRQVSVEEAKTLAEEEGLFFIETSALDSTNVNKSFEIVIREIYNKVSRKVLNSDSYKAE  189

Query  159  LSVNRVSLANGADMSKQNK  103
            L+VNRV+LANG D+SKQ +
Sbjct  190  LTVNRVNLANGVDLSKQKR  208



>gb|EYU39173.1| hypothetical protein MIMGU_mgv1a013470mg [Erythranthe guttata]
Length=219

 Score =   331 bits (849),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVE+DGKEVKAQVWDTAG
Sbjct  13   YLFKIVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVELDGKEVKAQVWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRK TFEN KRWLEELN HCDT VA+MLVGNK DLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKATFENTKRWLEELNIHCDTAVAKMLVGNKSDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+VSVEEGK LAEEEGLFFIETSAL+STNV  AFEIVIR IY  VSRK+LNSDSYKAE
Sbjct  133  EIREVSVEEGKSLAEEEGLFFIETSALESTNVMKAFEIVIRAIYDKVSRKILNSDSYKAE  192

Query  159  LSVNRVSLANGADMSKQN  106
            LSV+RV+LA G D+SKQN
Sbjct  193  LSVDRVTLAKGVDLSKQN  210



>gb|KDP45261.1| hypothetical protein JCGZ_15126 [Jatropha curcas]
Length=215

 Score =   323 bits (829),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 187/196 (95%), Gaps = 1/196 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+T+F+++KRWLEEL+THCDT VARMLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRRTSFDSVKRWLEELSTHCDTAVARMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAEEE LFF+ETSALDSTNV TAFE+VIR+IYKNVSRK+LNSDSYKAE
Sbjct  133  NIREVSVEEGKSLAEEESLFFMETSALDSTNVQTAFEVVIREIYKNVSRKILNSDSYKAE  192

Query  159  LSVNRVSLA-NGADMS  115
            L+VNRVSL  +GA  S
Sbjct  193  LTVNRVSLVKDGAKQS  208



>ref|XP_007049622.1| RAB GTPase A5B [Theobroma cacao]
 gb|EOX93779.1| RAB GTPase A5B [Theobroma cacao]
Length=217

 Score =   322 bits (826),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 191/198 (96%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+++F++IKRWL+EL+THCDTT+ARMLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDISRRSSFDSIKRWLDELSTHCDTTMARMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSALDSTNV TAFEIVIR+IY NVSRK LNSD+YKAE
Sbjct  133  NIRDVSVEEGKSLAEEEGLFFMETSALDSTNVQTAFEIVIREIYNNVSRKALNSDAYKAE  192

Query  159  LSVNRVSLA-NGADMSKQ  109
            LSVNRV+L  +GA+ SK+
Sbjct  193  LSVNRVTLVKDGANSSKE  210



>ref|XP_004149322.1| PREDICTED: ras-related protein RABA5e-like [Cucumis sativus]
 ref|XP_004163075.1| PREDICTED: ras-related protein RABA5e-like [Cucumis sativus]
 gb|KGN44658.1| RAB11G [Cucumis sativus]
Length=215

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/197 (85%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+TTF++ KRWL+EL  HCDT   RMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDITRRTTFDSAKRWLDELGVHCDTATVRMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSDSYKAE
Sbjct  132  NIRDVSVEEGKNLAEEEGLFFMETSALDSTNVRTAFELVIREIYNNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLANGADMSKQ  109
            LS NRVSLA+G   SK+
Sbjct  192  LSENRVSLADGGASSKK  208



>ref|XP_010069602.1| PREDICTED: ras-related protein RABA5b [Eucalyptus grandis]
 gb|KCW58002.1| hypothetical protein EUGRSUZ_H00732 [Eucalyptus grandis]
Length=215

 Score =   320 bits (820),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFA DEFD N+KATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVLIGDSAVGKSNLLSRFALDEFDINTKATIGVEFQTQVVEIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+TTFE++KRWL+EL+THCDT VARMLVGNKCDL 
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDITRRTTFESVKRWLDELDTHCDTAVARMLVGNKCDLN  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS EEGK LAE EGLFF+ETSALDSTNV  +FEIVIR+IYKN+SRK+LNSDSYKAE
Sbjct  130  NIREVSTEEGKALAEAEGLFFMETSALDSTNVQISFEIVIREIYKNISRKVLNSDSYKAE  189

Query  159  LSVNRVSLA-NGADMSKQN  106
            LSVNRV+LA NGAD S ++
Sbjct  190  LSVNRVTLAKNGADSSGRS  208



>ref|XP_010241769.1| PREDICTED: ras-related protein RABA5c [Nelumbo nucifera]
Length=216

 Score =   320 bits (819),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 187/200 (94%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNMNSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTFE++ RWL+ELNTH DTTVARMLVGNKCDL 
Sbjct  69   QERFRAVTSAYYRGAVGALIVYDISRRTTFESVGRWLDELNTHSDTTVARMLVGNKCDLG  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSDSYKAE
Sbjct  129  NIRDVSIEEGKALAESEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKVLNSDSYKAE  188

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD S QN+
Sbjct  189  LSVNRVSLVNNGADGSNQNQ  208



>ref|XP_010666947.1| PREDICTED: ras-related protein RABA5e [Beta vulgaris subsp. vulgaris]
Length=216

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFAR+EFDHN+KATIGVEFQT  VE++GKE+K+Q+WDTAG
Sbjct  10   YLFKIVVIGDSAVGKSNLLSRFARNEFDHNTKATIGVEFQTVCVEINGKEIKSQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTFE+I RWL+ELNTHCDT VAR+LVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRRTTFESINRWLDELNTHCDTAVARLLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSV+E K +AE EGLFFIETSALDSTNV TAFEI I++IY N+SRKLLNSDSYKAE
Sbjct  130  NIREVSVDEAKSVAESEGLFFIETSALDSTNVKTAFEIAIKEIYNNISRKLLNSDSYKAE  189

Query  159  LSVNRVSLA-NGADMSK  112
            LSVNRV+LA +G+D ++
Sbjct  190  LSVNRVTLAKDGSDSNR  206



>ref|XP_010524651.1| PREDICTED: ras-related protein RABA5b [Tarenaya hassleriana]
Length=215

 Score =   318 bits (814),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  14   YLFKIVLIGDSAVGKSNLLTRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR++TFE++KRWLEELNTHCDT VA+MLVGNKCDLE
Sbjct  74   QERFRAVTSAYYRGAFGALIVYDITRRSTFESVKRWLEELNTHCDTAVAQMLVGNKCDLE  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAEEEGLFF+ETSALDSTNV+ AFEIVI++I+ NVSRK+LNSD+YKAE
Sbjct  134  NIRAVSVEEGKSLAEEEGLFFMETSALDSTNVDKAFEIVIKEIFNNVSRKILNSDAYKAE  193

Query  159  LSVNRVSLANGADMSKQN  106
            LSVNRVSL N  D +K++
Sbjct  194  LSVNRVSLVNNGDSTKRS  211



>ref|XP_008458081.1| PREDICTED: ras-related protein RABA5b [Cucumis melo]
Length=216

 Score =   317 bits (813),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF++ KRWL+EL  HCDT   RMLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSAKRWLDELGVHCDTATVRMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSALDSTNV TAFE+VIR+I+ NVSRK+LNSDSYKAE
Sbjct  133  NIRDVSVEEGKNLAEEEGLFFMETSALDSTNVRTAFELVIREIFNNVSRKVLNSDSYKAE  192

Query  159  LSVNRVSLANGADMSKQ  109
            LS NRVSLA+G   SK+
Sbjct  193  LSENRVSLADGGASSKK  209



>ref|XP_010100807.1| Ras-related protein RABA5c [Morus notabilis]
 gb|EXB84505.1| Ras-related protein RABA5c [Morus notabilis]
Length=212

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 186/194 (96%), Gaps = 1/194 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVLIGDSAVGKSNLLSRFARNEFDQNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTF+++KRWL+EL THCDTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDISRRTTFDSVKRWLDELTTHCDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSAL+STNV TAFE+VIR+I+ N+SRK+LNS+SYKAE
Sbjct  130  NIRDVSVEEGKSLAEEEGLFFMETSALESTNVQTAFEMVIREIFNNISRKVLNSESYKAE  189

Query  159  LSVNRVSLA-NGAD  121
            LSV+RVSL  NG D
Sbjct  190  LSVDRVSLVKNGTD  203



>gb|EPS67330.1| hypothetical protein M569_07446, partial [Genlisea aurea]
Length=201

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFARDEFDH+SKATIGVEFQTQVV+VDG+EVKAQVWDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRFARDEFDHHSKATIGVEFQTQVVQVDGREVKAQVWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFENI+RWL+ELNTHCDT VARMLVGNK DLE
Sbjct  69   QERFRAVTSAYYRGAVGALVVYDISRRSTFENIERWLDELNTHCDTAVARMLVGNKSDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EGLFFIETSALD+TNVN AF IVIR+IY  VSRK+L+SDSYKAE
Sbjct  129  NIREVSVEEGKSLAEGEGLFFIETSALDATNVNEAFHIVIREIYDKVSRKILSSDSYKAE  188

Query  159  LSVNRVSL  136
            LSVNRVS+
Sbjct  189  LSVNRVSV  196



>ref|XP_002303077.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE82350.1| GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   317 bits (811),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/197 (81%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKE+KAQ+WDTAG
Sbjct  14   YLFKIVVIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEIKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+T+F+++KRWL+EL THCDT +ARMLVGNKCDL+
Sbjct  74   QERFRAVTSAYYRGAVGALIVYDITRRTSFDSVKRWLDELGTHCDTAIARMLVGNKCDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR+VS +EGK LAEEE LFF+ETSALDSTNV  AFE+VIR+IY N+SRK+LNSDSYKAE
Sbjct  134  SIREVSRDEGKSLAEEESLFFMETSALDSTNVEAAFEVVIREIYNNMSRKILNSDSYKAE  193

Query  159  LSVNRVSLANGADMSKQ  109
            L+ NRVSL NG   SK+
Sbjct  194  LTANRVSLVNGDTSSKK  210



>gb|KJB84096.1| hypothetical protein B456_N003900 [Gossypium raimondii]
Length=217

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 189/198 (95%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQVVE+DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQVVEIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+++F++IKRWL+EL THCDTTVARM+VGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDISRRSSFDSIKRWLDELYTHCDTTVARMVVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEE LFF+ETSAL+STNV TAFE+VIR+IY NVSRK LNS++YKAE
Sbjct  133  NIRDVSVEEGKSLAEEEDLFFMETSALESTNVQTAFEVVIREIYNNVSRKALNSEAYKAE  192

Query  159  LSVNRVSLA-NGADMSKQ  109
            LSVNRV+L  +GA+ SK+
Sbjct  193  LSVNRVTLVKDGANTSKE  210



>ref|XP_004290147.1| PREDICTED: ras-related protein RABA5b [Fragaria vesca subsp. 
vesca]
Length=213

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVLIGDSAVGKSNLLSRFARNEFDQNSKATIGVEFQTQAVEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+RKTTFE+++RWL EL  HCDT VA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRKTTFESVERWLNELTMHCDTAVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR V++E+GK LAEE+GLFF+ETSALD+TNV  AFE+VIR+IY NVSRK+LNSDSYKAE
Sbjct  132  DIRAVTIEDGKSLAEEKGLFFMETSALDATNVQEAFEVVIREIYNNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N AD +K
Sbjct  192  LSVNRVSLVNKADSTK  207



>gb|KFK38199.1| hypothetical protein AALP_AA3G082000 [Arabis alpina]
Length=217

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 181/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR +TFE++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSSTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEG+FF+ETSALDSTNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  DIRAVSVEEGKALAEEEGMFFMETSALDSTNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGAD  121
            LSVNRVSL N  D
Sbjct  191  LSVNRVSLVNNKD  203



>ref|XP_009124351.1| PREDICTED: ras-related protein RABA5b [Brassica rapa]
Length=213

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR +TFE++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSSTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKA+
Sbjct  131  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFSNVSRKLLNSDAYKAQ  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D ++
Sbjct  191  LSVNRVSLVNNGDGTQ  206



>ref|XP_011024576.1| PREDICTED: ras-related protein RABA5e-like [Populus euphratica]
Length=218

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV+++GKE+KAQ+WDTAG
Sbjct  14   YLFKIVVIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIEGKEIKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+T+F+++KRWL+EL THCDT +ARMLVGNKCDL+
Sbjct  74   QERFRAVTSAYYRGAVGALIVYDITRRTSFDSVKRWLDELGTHCDTAIARMLVGNKCDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR+VS +EGK LAEEE LFF+ETSALDSTNV  AFE+VIR+IY N+SRK+LNSDSYKAE
Sbjct  134  SIREVSRDEGKSLAEEESLFFMETSALDSTNVEAAFEVVIREIYNNMSRKILNSDSYKAE  193

Query  159  LSVNRVSLANGADMSKQ  109
            L+ NRVSL NG + SK+
Sbjct  194  LTANRVSLVNGDNSSKK  210



>ref|XP_010909337.1| PREDICTED: ras-related protein RABA5e-like [Elaeis guineensis]
Length=215

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ NSKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARDEFNINSKATIGVEFQTQSVDIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL+TH DTT+ARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVSRWLQELSTHSDTTIARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVE+GK LAE E LFFIETSALDSTNV  AFEIVIRDIY N+SRK LNSDSYK E
Sbjct  130  NIREVSVEDGKSLAEAEELFFIETSALDSTNVQKAFEIVIRDIYNNISRKALNSDSYKEE  189

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVSL +NG D SKQ
Sbjct  190  LSLNRVSLGSNGTDESKQ  207



>ref|XP_006407840.1| hypothetical protein EUTSA_v10021494mg [Eutrema salsugineum]
 gb|ESQ49293.1| hypothetical protein EUTSA_v10021494mg [Eutrema salsugineum]
Length=217

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR +TFE++KRWL+EL+THCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSSTFESVKRWLQELHTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALDSTNV+ AFE+VIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  EIRAVSVEEGKALAEEEGLFFMETSALDSTNVDKAFEVVIREIFSNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  191  LSVNRVSLVNNQDGSE  206



>ref|XP_006437222.1| hypothetical protein CICLE_v10032706mg [Citrus clementina]
 gb|ESR50462.1| hypothetical protein CICLE_v10032706mg [Citrus clementina]
Length=220

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+++F+++KRWLEEL THCDT V RMLVGNKCDL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDITRRSSFDSVKRWLEELTTHCDTAVGRMLVGNKCDLD  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIRDVS EEGK LAEEEGLFF+ETSALDSTNV  AFE+VIR+IY N+SRK+LNSD+YKAE
Sbjct  133  SIRDVSTEEGKSLAEEEGLFFMETSALDSTNVEAAFEVVIREIYSNISRKILNSDAYKAE  192

Query  159  LSVNRVSLA-NGADMSK  112
            LSVNRV+L  +GA+ SK
Sbjct  193  LSVNRVTLVKDGANSSK  209



>ref|NP_001240985.1| ras-related protein RABA5b-like [Glycine max]
 gb|AEO14876.1| rfls8 protein [Glycine max]
 gb|KHN10937.1| Ras-related protein RABA5b [Glycine soja]
Length=213

 Score =   315 bits (807),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKE+KAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQLVEIDGKEIKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++IKRWL+EL T  D+TVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRGTFDSIKRWLQELTTQNDSTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS EEGK LAEEEGLFF+ETSALD+TNV TAFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  131  NIREVSTEEGKSLAEEEGLFFMETSALDATNVQTAFEIVIREIYNNISRKVLNSDSYKAE  190

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL NGA  SKQ  
Sbjct  191  LSVNRVSLVNGAG-SKQGP  208



>gb|KJB10858.1| hypothetical protein B456_001G229200, partial [Gossypium raimondii]
 gb|KJB10859.1| hypothetical protein B456_001G229200, partial [Gossypium raimondii]
Length=285

 Score =   317 bits (813),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD+NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  81   YLFKIVLIGDSAVGKSNLLSRFARNEFDNNSKATIGVEFQTQCVEIDGKEVKAQIWDTAG  140

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+++F++IKRWL+EL THCDTT+ RMLVGNKCDLE
Sbjct  141  QERFRAVTSAYYRGAVGALIVYDITRRSSFDSIKRWLDELTTHCDTTLTRMLVGNKCDLE  200

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY NVSRK LNSDSYK E
Sbjct  201  NIRDVSVEEGKSLAEEEGLFFLETSALESTNVQTAFEIVIREIYNNVSRKALNSDSYKGE  260

Query  159  LSVNRVSLA-NGADMSK  112
            LS N+V+L  +GA+ SK
Sbjct  261  LSGNKVTLVKDGANASK  277



>ref|XP_002533058.1| protein with unknown function [Ricinus communis]
 gb|EEF29328.1| protein with unknown function [Ricinus communis]
Length=218

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFAR+EFD NSKATIGVEFQTQVV+++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARNEFDSNSKATIGVEFQTQVVDIEGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+++F+++KRWLEEL+THCDTT ARMLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRRSSFDSVKRWLEELSTHCDTTAARMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS EEGK LAEEE LFF+ETSALDSTNV  AFE+VIR+IY N+SRK LNSDSYKAE
Sbjct  133  NIREVSREEGKTLAEEESLFFMETSALDSTNVEAAFEVVIREIYHNMSRKTLNSDSYKAE  192

Query  159  LSVNRVSLA-NGADMSKQN  106
            L+VNRVSL  N A+ SKQ+
Sbjct  193  LTVNRVSLVKNNANSSKQS  211



>gb|KDO60895.1| hypothetical protein CISIN_1g027703mg [Citrus sinensis]
Length=220

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 185/197 (94%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+++F+++KRWLEEL THCDT V RMLVGNKCDL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDITRRSSFDSVKRWLEELTTHCDTAVGRMLVGNKCDLD  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIRDVS EEGK LAEEEGLFF+ETSALDSTNV  AFE+VIR+IY N+SRK+LNSD+YKAE
Sbjct  133  SIRDVSTEEGKSLAEEEGLFFMETSALDSTNVEAAFEVVIREIYSNISRKVLNSDAYKAE  192

Query  159  LSVNRVSLA-NGADMSK  112
            LSVNRV+L  +GA+ SK
Sbjct  193  LSVNRVTLVKDGANSSK  209



>ref|XP_002884647.1| hypothetical protein ARALYDRAFT_896904 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60906.1| hypothetical protein ARALYDRAFT_896904 [Arabidopsis lyrata subsp. 
lyrata]
Length=217

 Score =   315 bits (806),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TFE++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSDTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  191  LSVNRVSLVNNQDGSE  206



>ref|XP_011073833.1| PREDICTED: ras-related protein RABA5c [Sesamum indicum]
Length=219

 Score =   315 bits (806),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSLEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFE+I RWL+EL TH DTTVA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDISRRSTFESIPRWLDELKTHSDTTVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  132  NIRDVSVEEGKSLAESEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLAN-GADMSKQ  109
            LSVNRVSL N GAD SKQ
Sbjct  192  LSVNRVSLVNDGADGSKQ  209



>ref|XP_010054657.1| PREDICTED: ras-related protein RABA5c [Eucalyptus grandis]
 gb|KCW87824.1| hypothetical protein EUGRSUZ_A00215 [Eucalyptus grandis]
 gb|KCW87825.1| hypothetical protein EUGRSUZ_A00215 [Eucalyptus grandis]
Length=218

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 189/200 (95%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR++TF+++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDITRRSTFDSVSRWLDELKTHSDTTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIRDV+VEEGK LAE EGLFF+ETSALD+TNV TAFEIVI++IY NVSRK+LNSD+YKAE
Sbjct  132  SIRDVTVEEGKSLAESEGLFFMETSALDATNVKTAFEIVIKEIYNNVSRKVLNSDAYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRV+LA NGAD SK+++
Sbjct  192  LSVNRVTLAGNGADGSKRSQ  211



>ref|XP_003622764.1| Ras-related protein ARA-1 [Medicago truncatula]
 gb|AES78982.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=215

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 186/198 (94%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQMVEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TFE+IKRWL+EL T  D+TVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDISRRGTFESIKRWLDELTTQNDSTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS+EEGK LAEEEGLFF+ETSALDSTNV TAFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  132  NIREVSIEEGKALAEEEGLFFMETSALDSTNVQTAFEIVIREIYNNISRKVLNSDSYKAE  191

Query  159  LSVNRVSLANGADMSKQN  106
            LSVNRV+L NG+  SK+N
Sbjct  192  LSVNRVTLVNGSG-SKKN  208



>ref|NP_187397.1| RAB GTPase-like protein A5B [Arabidopsis thaliana]
 sp|Q9SRS5.1|RAA5B_ARATH RecName: Full=Ras-related protein RABA5b; Short=AtRABA5b [Arabidopsis 
thaliana]
 gb|AAF02165.1|AC009853_25 putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL62436.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAN72184.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AEE74539.1| RAB GTPase-like protein A5B [Arabidopsis thaliana]
Length=217

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TFE++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRGDTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  191  LSVNRVSLVNNQDGSE  206



>ref|XP_006484821.1| PREDICTED: ras-related protein RABA5b-like [Citrus sinensis]
Length=220

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVV++DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVDIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+++F ++KRWLEEL THCDT V RMLVGNKCDL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDITRRSSFNSVKRWLEELTTHCDTAVGRMLVGNKCDLD  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIRDVS EEGK LAEEEGLFF+ETSALDSTNV  AFE+VIR+IY N+SRK+LNSD+YKAE
Sbjct  133  SIRDVSTEEGKSLAEEEGLFFMETSALDSTNVEAAFEVVIREIYSNISRKVLNSDAYKAE  192

Query  159  LSVNRVSLA-NGADMSK  112
            LSVNRV+L  +GA+ SK
Sbjct  193  LSVNRVTLVKDGANSSK  209



>ref|XP_010451591.1| PREDICTED: ras-related protein RABA5b-like isoform X1 [Camelina 
sativa]
Length=217

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TF+++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSDTFQSVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  191  LSVNRVSLVNNQDGSE  206



>ref|XP_007200458.1| hypothetical protein PRUPE_ppa011281mg [Prunus persica]
 gb|EMJ01657.1| hypothetical protein PRUPE_ppa011281mg [Prunus persica]
Length=216

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 184/197 (93%), Gaps = 1/197 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK VKAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IRDVSVE+GK LAEEEGLFF+ETSAL++TNV TAFE+VIR+IY NVSRK+LNSDSYKAE
Sbjct  130  DIRDVSVEDGKSLAEEEGLFFMETSALNATNVQTAFEMVIREIYSNVSRKVLNSDSYKAE  189

Query  159  LSVNRVSLA-NGADMSK  112
            LSVNRV+L  NGAD  K
Sbjct  190  LSVNRVNLVKNGADSRK  206



>ref|XP_010486288.1| PREDICTED: ras-related protein RABA5b isoform X1 [Camelina sativa]
 ref|XP_010486289.1| PREDICTED: ras-related protein RABA5b isoform X2 [Camelina sativa]
Length=217

 Score =   313 bits (803),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TF+++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSDTFQSVKRWLQELNTHCDTAVAQMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  131  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  190

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  191  LSVNRVSLVNNQDGSE  206



>ref|XP_002263362.1| PREDICTED: ras-related protein RABA5e [Vitis vinifera]
 emb|CAN69655.1| hypothetical protein VITISV_000615 [Vitis vinifera]
 emb|CBI18743.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EFD +SKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  8    YLFKIVIIGDSAVGKSNLLSRYARNEFDLHSKATIGVEFQTQCVDIDGKEVKAQIWDTAG  67

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFE+I RWL+EL  HCDTTVARMLVGNKCDLE
Sbjct  68   QERFRAVTSAYYRGAFGALLVYDISRRSTFESIARWLDELKIHCDTTVARMLVGNKCDLE  127

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS EEGK LAE EGLFF+ETSALD+TNV TAFE+VIR+I+ NVSRK+L+SDSYKAE
Sbjct  128  NIRDVSTEEGKNLAEAEGLFFMETSALDATNVKTAFEMVIREIFNNVSRKVLHSDSYKAE  187

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGA  SKQN+
Sbjct  188  LSVNRVSLVNNGAAASKQNQ  207



>ref|XP_002527386.1| protein with unknown function [Ricinus communis]
 gb|EEF34993.1| protein with unknown function [Ricinus communis]
Length=218

 Score =   313 bits (801),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDV+VEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  131  NIRDVTVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  190

Query  159  LSVNRVSLANGADMSKQNK  103
            LS+NRV+L N +D SKQ++
Sbjct  191  LSLNRVTLVNNSDGSKQSQ  209



>ref|XP_010999992.1| PREDICTED: ras-related protein RABA5d-like [Populus euphratica]
Length=217

 Score =   313 bits (801),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/197 (82%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQTMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF++I RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSIGRWLDELQTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  131  NIRDVSVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDSYKAE  190

Query  159  LSVNRVSLANGADMSKQ  109
            LS+NRV+L N  + SKQ
Sbjct  191  LSLNRVNLVNNGNDSKQ  207



>ref|XP_008382566.1| PREDICTED: ras-related protein RABA5b-like [Malus domestica]
Length=215

 Score =   312 bits (800),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VS+E+GK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  130  DIRAVSMEDGKSLAEEEGLFFMETSALNSTNVQTAFEIVIREIYNNVSRKILNSDSYKAE  189

Query  159  LSVNRVSLA-NGAD  121
            LSVNRVSL  NGAD
Sbjct  190  LSVNRVSLVKNGAD  203



>ref|XP_006298457.1| hypothetical protein CARUB_v10014528mg, partial [Capsella rubella]
 gb|EOA31355.1| hypothetical protein CARUB_v10014528mg, partial [Capsella rubella]
Length=235

 Score =   313 bits (802),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  29   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  88

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TFE++KRWL+EL+THCDT VA+MLVGNKCDLE
Sbjct  89   QERFRAVTSAYYRGAFGALIVYDITRSDTFESVKRWLQELHTHCDTAVAQMLVGNKCDLE  148

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  149  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  208

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  209  LSVNRVSLVNNQDGSE  224



>emb|CAA98183.1| RAB11G [Lotus japonicus]
Length=219

 Score =   312 bits (800),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDITRRTTFDSVSRWLDELKTHCDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VS+EEGK LAE +GLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  132  NIRAVSIEEGKSLAEAQGLFFMETSALDSTNVRTAFEMVIREIYNNVSRKVLNSDTYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSV+RVSL  NGA  SKQ+K
Sbjct  192  LSVDRVSLVNNGAATSKQSK  211



>ref|XP_008372555.1| PREDICTED: ras-related protein RABA5b-like [Malus domestica]
Length=215

 Score =   312 bits (799),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VS+EEGK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  130  DIRAVSLEEGKNLAEEEGLFFMETSALNSTNVQTAFEIVIREIYNNVSRKVLNSDSYKAE  189

Query  159  LSVNRVSL-ANGAD  121
            LSVNRVSL  NGAD
Sbjct  190  LSVNRVSLMKNGAD  203



>ref|XP_003552753.1| PREDICTED: ras-related protein RABA5d-like [Glycine max]
Length=219

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSV+EGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNS++YKAE
Sbjct  132  NIRAVSVDEGKSLAEAEGLFFMETSALDSTNVKTAFEMVIREIYTNVSRKVLNSETYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGA  SKQN+
Sbjct  192  LSVNRVSLVNNGASTSKQNQ  211



>ref|XP_009372186.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
Length=215

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VS+E+GK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  130  DIRAVSMEDGKSLAEEEGLFFMETSALNSTNVQTAFEIVIREIYNNVSRKVLNSDSYKAE  189

Query  159  LSVNRVSLA-NGAD  121
            LSVNRVSL  NGAD
Sbjct  190  LSVNRVSLVKNGAD  203



>ref|XP_010650400.1| PREDICTED: ras-related protein RABA5c-like [Vitis vinifera]
 emb|CAN66526.1| hypothetical protein VITISV_043978 [Vitis vinifera]
Length=215

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNINSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TF+++ RWL+EL TH +TTVARMLVGNK DLE
Sbjct  69   QERFRAVTSAYYRGAVGALVVYDISRRSTFDSVARWLDELKTHSETTVARMLVGNKSDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFFIETSALDSTNV  AFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  129  NIRDVSVEEGKSLAEAEGLFFIETSALDSTNVKKAFEIVIREIYNNISRKVLNSDSYKAE  188

Query  159  LSVNRVSL-ANGADMSKQ  109
            LSVNRVSL +NGAD +KQ
Sbjct  189  LSVNRVSLVSNGADGAKQ  206



>ref|XP_008222663.1| PREDICTED: ras-related protein RABA5e [Prunus mume]
Length=220

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRKTTFE++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKTTFESVGRWLDELKTHSDTTVAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVE+GK LAE EGLFF+ETSALDSTNV  AFE+VI++IY NVSRK+LNSD+YKAE
Sbjct  133  NIRDVSVEDGKSLAEAEGLFFMETSALDSTNVIKAFELVIQEIYDNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD SK+++
Sbjct  193  LSVNRVSLVNNGADGSKKSQ  212



>ref|XP_007223957.1| hypothetical protein PRUPE_ppa011186mg [Prunus persica]
 gb|EMJ25156.1| hypothetical protein PRUPE_ppa011186mg [Prunus persica]
Length=220

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRKTTFE++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKTTFESVGRWLDELKTHSDTTVAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVE+GK LAE EGLFF+ETSALDSTNV  AFE+VI++IY NVSRK+LNSD+YKAE
Sbjct  133  NIRDVSVEDGKGLAEAEGLFFMETSALDSTNVIKAFELVIQEIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD SK+++
Sbjct  193  LSVNRVSLVNNGADGSKKSQ  212



>gb|KDP42877.1| hypothetical protein JCGZ_23819 [Jatropha curcas]
Length=219

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 187/200 (94%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEEEGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  131  NIRDVSVEEGKSLAEEEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  190

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LS+NRV+L  NG D SKQ++
Sbjct  191  LSLNRVTLVNNGTDGSKQSQ  210



>ref|XP_004492211.1| PREDICTED: ras-related protein RABA5b-like [Cicer arietinum]
Length=215

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ+VE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQMVEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++IKRWL+EL T  D+TVA MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRGTFDSIKRWLDELTTQNDSTVATMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS EEGK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  131  NIREVSTEEGKTLAEEEGLFFMETSALESTNVQTAFEIVIREIYNNISRKVLNSDSYKAE  190

Query  159  LSVNRVSLANGADMSKQN  106
            LSVNRVSL NGA  SK+N
Sbjct  191  LSVNRVSLVNGAG-SKKN  207



>ref|XP_010464360.1| PREDICTED: ras-related protein RABA5b-like [Camelina sativa]
Length=261

 Score =   313 bits (801),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  55   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  114

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TF ++KRWL+ELNTHCDT VA+MLVGNKCDLE
Sbjct  115  QERFRAVTSAYYRGAFGALIVYDITRSDTFHSVKRWLQELNTHCDTAVAQMLVGNKCDLE  174

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  175  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  234

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  235  LSVNRVSLVNTQDDSE  250



>ref|XP_009619604.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana tomentosiformis]
 ref|XP_009765591.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana sylvestris]
Length=216

 Score =   311 bits (796),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFE++ RWL+ELNTHCDTTVA+MLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAFGALLVYDISRRSTFESVTRWLDELNTHCDTTVAKMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEG  LAE EGLFF+ETSALDSTNVN AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  131  NIRDVSIEEGAKLAEAEGLFFMETSALDSTNVNKAFEIVIREIYSNVSRKVLNSDSYKAE  190

Query  159  LSVNRVSL  136
            LS+NRVSL
Sbjct  191  LSINRVSL  198



>ref|XP_007140715.1| hypothetical protein PHAVU_008G135600g [Phaseolus vulgaris]
 gb|ESW12709.1| hypothetical protein PHAVU_008G135600g [Phaseolus vulgaris]
Length=213

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQVVE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQVVEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+ TF++ KRWLEEL T  D+TVARMLVGNK DLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRGTFDSSKRWLEELTTQNDSTVARMLVGNKSDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS EEGK LAEEEGLFF+ETSALDSTNV TAFEIVIR+IY N+SRK LNSDSYKAE
Sbjct  131  NIREVSTEEGKSLAEEEGLFFMETSALDSTNVQTAFEIVIREIYNNISRKTLNSDSYKAE  190

Query  159  LSVNRVSLANGA  124
            L+VNRVSL NGA
Sbjct  191  LTVNRVSLVNGA  202



>dbj|BAA02108.1| GTP-binding protein [Pisum sativum]
 prf||2001457A GTP-binding protein
Length=215

 Score =   310 bits (795),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVEFQTQTVEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF++IKRWL+EL T  D+TVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALVVYDISRRGTFDSIKRWLDELTTQNDSTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R+VS EEGK  AEEEGLFF+ETSALDSTNV  AFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  131  SLREVSTEEGKAFAEEEGLFFMETSALDSTNVQKAFEIVIREIYNNISRKVLNSDSYKAE  190

Query  159  LSVNRVSLANGADMSKQN  106
            LSVNRVSL NGA  SK+N
Sbjct  191  LSVNRVSLVNGAG-SKKN  207



>ref|XP_009383827.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=216

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 163/198 (82%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ V+VDGKEVKAQ+WDTAG
Sbjct  11   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSVDVDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA+GAL+VYDI+R +TF++I RWL+ELNTH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGALGALLVYDISRCSTFDSIARWLDELNTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R+VSVEEGK LAE EGLFFIETSALDSTNV TAFEIVI++IY N+SRK+LNSDSYKAE
Sbjct  131  TLREVSVEEGKALAEAEGLFFIETSALDSTNVKTAFEIVIKEIYNNISRKILNSDSYKAE  190

Query  159  LSVNRVSL-ANGADMSKQ  109
            LSVNRVSL +NG D  KQ
Sbjct  191  LSVNRVSLSSNGNDEQKQ  208



>gb|KEH21456.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=220

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDL+
Sbjct  74   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  134  NIRDVSIEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKVLNSDTYKAE  193

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NG   SKQ+K
Sbjct  194  LSVNRVSLVNNGNSTSKQSK  213



>ref|XP_006478881.1| PREDICTED: ras-related protein RABA5c-like [Citrus sinensis]
Length=222

 Score =   310 bits (795),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/198 (82%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  15   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  74

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+TTF++I RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  75   QERFRAVTSAYYRGAVGALIVYDITRRTTFDSISRWLDELKTHSDTTVARMLVGNKCDLE  134

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR+VS EEGK LAE EGLFF+ETSALDSTNV +AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  135  SIRNVSTEEGKSLAEAEGLFFMETSALDSTNVKSAFEIVIREIYSNVSRKVLNSDSYKAE  194

Query  159  LSVNRVSLANG-ADMSKQ  109
            LS+NRV+L     D SKQ
Sbjct  195  LSLNRVTLVKSETDGSKQ  212



>gb|AGZ15280.1| putative RAB11G, partial [Taraxacum brevicorniculatum]
Length=217

 Score =   310 bits (794),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQTMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR TTF+++ RWLEEL TH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDITRGTTFDSVTRWLEELKTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVE+GK LA +EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK+LNSDSYKAE
Sbjct  131  NIRAVSVEDGKNLAMKEGLFFMETSALDSTNVKTAFELVIREIYNNMSRKVLNSDSYKAE  190

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LS++RV+L  +G D SKQN+
Sbjct  191  LSMDRVTLTDDGGDGSKQNQ  210



>ref|XP_007033994.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
 gb|EOY04920.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
Length=217

 Score =   310 bits (794),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  131  TIRDVSVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  190

Query  159  LSVNRVSLANG-ADMSKQNK  103
            L+VNRV+L     D SKQ +
Sbjct  191  LTVNRVTLTKSETDGSKQTQ  210



>ref|XP_009791655.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana sylvestris]
Length=218

 Score =   310 bits (793),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDITR+TTF++I RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDITRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EG+FF+ETSALD+TNVN AFE+VIR+IY +VSRK+LNSDSYKAE
Sbjct  132  NIRAVSVEEGKSLAESEGMFFMETSALDATNVNKAFEMVIREIYNSVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NG D SKQN+
Sbjct  192  LSVNRVSLVDNGTDGSKQNQ  211



>ref|XP_008811658.1| PREDICTED: ras-related protein RABA5e [Phoenix dactylifera]
Length=215

 Score =   310 bits (793),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 184/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ V++DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNINSKATIGVEFQTQSVDIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL+TH DTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVSRWLQELSTHSDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVE+GK LAE EGLFFIETSALDSTNV  AFEIVI +IY N+SRK+LNSDSYK E
Sbjct  130  NIREVSVEDGKSLAEAEGLFFIETSALDSTNVKKAFEIVIGEIYNNISRKVLNSDSYKEE  189

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVSL +NG D SKQ
Sbjct  190  LSLNRVSLSSNGTDESKQ  207



>ref|XP_004248020.1| PREDICTED: ras-related protein RABA5c-like [Solanum lycopersicum]
Length=216

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFE++ RWL+ELNTHCDTTVA+MLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAFGALLVYDISRRSTFESVTRWLDELNTHCDTTVAKMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEG  LAE EGLFF+ETSALDSTNVN AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  131  NIRDVSIEEGAKLAEAEGLFFMETSALDSTNVNKAFEIVIREIYSNVSRKVLNSDSYKAE  190

Query  159  LSVNRVSL  136
            LS+NRV+L
Sbjct  191  LSINRVNL  198



>ref|XP_006358795.1| PREDICTED: ras-related protein RABA5b-like [Solanum tuberosum]
Length=216

 Score =   309 bits (791),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQV+E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARDEFNLHSKATIGVEFQTQVLEINGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFE++ RWL+ELNTHCDTTVA+MLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAFGALLVYDISRRSTFESVTRWLDELNTHCDTTVAKMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEG  LAE EGLFF+ETSALDSTNVN AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  131  NIRDVSIEEGAKLAEAEGLFFMETSALDSTNVNKAFEIVIREIYSNVSRKVLNSDSYKAE  190

Query  159  LSVNRVSL  136
            LS+NRV+L
Sbjct  191  LSINRVNL  198



>ref|XP_003532321.1| PREDICTED: ras-related protein RABA5d [Glycine max]
 emb|CAA54506.1| GTPase [Glycine max]
 gb|KHN24970.1| Ras-related protein RABA5d [Glycine soja]
Length=219

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VS++EGK LAE EGLFF+ETSALDSTNV  AFE+VIR+IY NVSRK+LNS++YKAE
Sbjct  132  NIRAVSIDEGKSLAEAEGLFFMETSALDSTNVKMAFEMVIREIYNNVSRKVLNSETYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGA  SKQN+
Sbjct  192  LSVNRVSLVNNGAATSKQNQ  211



>ref|XP_004296709.1| PREDICTED: ras-related protein RABA5e [Fragaria vesca subsp. 
vesca]
Length=220

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+TTFE++ RWL+EL TH DTT+A MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRRTTFESVGRWLDELKTHSDTTMAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EG+FF+ETSALDSTNV+ AFE+VIR+IY  VSRK+LNSD+YKAE
Sbjct  133  NIRNVSVEEGKSLAEAEGMFFMETSALDSTNVDKAFELVIREIYSTVSRKVLNSDTYKAE  192

Query  159  LSVNRVSL-ANGADMSKQNK  103
            LSVNRVSL +NGA+ SK+++
Sbjct  193  LSVNRVSLVSNGAEGSKKSQ  212



>gb|ACJ84485.1| unknown [Medicago truncatula]
 gb|AFK41722.1| unknown [Medicago truncatula]
Length=220

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/200 (81%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDT G
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTTG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDL+
Sbjct  74   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVS+EEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  134  NIRDVSIEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKVLNSDTYKAE  193

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NG   SKQ+K
Sbjct  194  LSVNRVSLVNNGNSTSKQSK  213



>ref|XP_009628055.1| PREDICTED: ras-related protein RABA5c-like [Nicotiana tomentosiformis]
Length=218

 Score =   308 bits (790),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+TTF++I RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDISRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EG+FF+ETSALD+TNVN AFE+VIR+IY +VSRK+LNSDSYKAE
Sbjct  132  NIRAVSVEEGKSLAESEGMFFMETSALDATNVNKAFEMVIREIYNSVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NG D SKQN+
Sbjct  192  LSVNRVSLVDNGTDGSKQNQ  211



>gb|AAA74116.1| putative, partial [Nicotiana tabacum]
Length=209

 Score =   308 bits (789),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 185/200 (93%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  3    YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  62

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDITR+TTF++I RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  63   QERFRAVTSAYYRGAFGALVVYDITRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLD  122

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EG+FF+ETSALD+TNVN AF++VIR+IY +VSRK+LNSDSYKAE
Sbjct  123  NIRAVSVEEGKSLAESEGMFFMETSALDATNVNKAFDMVIREIYNSVSRKVLNSDSYKAE  182

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NG D SKQN+
Sbjct  183  LSVNRVSLVDNGTDGSKQNQ  202



>ref|XP_007139106.1| hypothetical protein PHAVU_008G001800g [Phaseolus vulgaris]
 gb|ESW11100.1| hypothetical protein PHAVU_008G001800g [Phaseolus vulgaris]
Length=218

 Score =   308 bits (789),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  132  NIRAVSVEEGKSLAEAEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKVLNSDAYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N    + +N+
Sbjct  192  LSVNRVSLVNNGPATSKNQ  210



>ref|XP_006366713.1| PREDICTED: ras-related protein RABA5e-like [Solanum tuberosum]
Length=217

 Score =   308 bits (789),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+TTF++I RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALVVYDISRRTTFDSIPRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VS+EEGK LAE EG+FF+ETSALDSTNVN AFEIVIR+IY +VSRK+LNSDSYKAE
Sbjct  131  NIRAVSIEEGKSLAESEGMFFMETSALDSTNVNKAFEIVIREIYNSVSRKVLNSDSYKAE  190

Query  159  LSVNRVSLAN-GADMSKQNK  103
            LSVNRV+L N G D SKQ +
Sbjct  191  LSVNRVNLVNDGTDGSKQKQ  210



>ref|XP_009334262.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
 ref|XP_009334263.1| PREDICTED: ras-related protein RABA5c-like [Pyrus x bretschneideri]
Length=215

 Score =   308 bits (788),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VS+E+GK LAEEEGLFF+ETSAL+STNV TAFEIVIR+IY +V RK+LNSDSYKAE
Sbjct  130  DIRAVSMEDGKSLAEEEGLFFMETSALNSTNVQTAFEIVIREIYNHVRRKVLNSDSYKAE  189

Query  159  LSVNRVSLA-NGAD  121
            LSVNRVSL  NGAD
Sbjct  190  LSVNRVSLVKNGAD  203



>emb|CDP10336.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 9/208 (4%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSLEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+TTFE+I RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALLVYDISRRTTFESIPRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVN--------TAFEIVIRDIYKNVSRKLL  184
            +IRDVSVEEGK LAE EGLFF+ETSALDSTN +        TAFE+VIR+IY NVSRK+L
Sbjct  131  NIRDVSVEEGKSLAESEGLFFMETSALDSTNTSALDSTNVITAFEMVIREIYNNVSRKVL  190

Query  183  NSDSYKAELSVNRVSLAN-GADMSKQNK  103
            NSDSYKAELSVNR+SL N G+D +KQ +
Sbjct  191  NSDSYKAELSVNRISLVNDGSDGTKQTQ  218



>ref|XP_002321111.1| Ras-related protein ARA-4 [Populus trichocarpa]
 gb|EEE99426.1| Ras-related protein ARA-4 [Populus trichocarpa]
Length=217

 Score =   307 bits (786),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHSDTTVAMMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEE K LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  131  NIRDVSVEEAKCLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  190

Query  159  LSVNRVSLANGADMSKQ  109
            LS+NRV+L N  + SKQ
Sbjct  191  LSLNRVTLVNNGNDSKQ  207



>ref|XP_011042789.1| PREDICTED: ras-related protein RABA5d-like [Populus euphratica]
Length=217

 Score =   307 bits (786),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHSDTTVAMMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  131  NIRDVSVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  190

Query  159  LSVNRVSLANGADMSKQ  109
            LS+NRV+L N    SKQ
Sbjct  191  LSLNRVTLVNNGSDSKQ  207



>ref|XP_009385993.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=214

 Score =   307 bits (786),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 185/198 (93%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ V +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSVVIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTF+++ RWL+EL TH DTTVA+MLVGNKCDL+
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDISRRTTFDSVPRWLQELETHSDTTVAKMLVGNKCDLD  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR++SVEEGK LAE EGLFFIETSALDSTNV  AFEIVIR+IY NVSRK+LNSDSYK+E
Sbjct  130  NIRNISVEEGKSLAEAEGLFFIETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDSYKSE  189

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVSL +NG+D +KQ
Sbjct  190  LSLNRVSLTSNGSDETKQ  207



>ref|XP_009358989.1| PREDICTED: ras-related protein RABA5b [Pyrus x bretschneideri]
Length=215

 Score =   307 bits (786),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 180/192 (94%), Gaps = 1/192 (1%)
 Frame = -2

Query  693  FKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQE  514
            FKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK +KAQ+WDTAGQE
Sbjct  12   FKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMIKAQIWDTAGQE  71

Query  513  RFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLESI  334
            RFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE +
Sbjct  72   RFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLEDL  131

Query  333  RDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAELS  154
            R VS+EEGK LAEE+GLFF+ETSAL+STNV TAFEIVIR+IY NVSRK+LNSDSYKAELS
Sbjct  132  RAVSLEEGKNLAEEQGLFFMETSALNSTNVQTAFEIVIREIYNNVSRKVLNSDSYKAELS  191

Query  153  VNRVSLA-NGAD  121
            VNRVSL  NGAD
Sbjct  192  VNRVSLVKNGAD  203



>ref|XP_008380689.1| PREDICTED: ras-related protein RABA5e [Malus domestica]
Length=220

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 183/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRKTTFE++ RWL+EL TH DTT+A MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKTTFESVGRWLDELKTHSDTTLAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVE+G+ LAE EGLFF+ETSALDSTNV  AFE+VI++IY NVSRK+LNSD+YKAE
Sbjct  133  DIRAVSVEDGRSLAEAEGLFFMETSALDSTNVIKAFELVIQEIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD SK+ +
Sbjct  193  LSVNRVSLVNNGADGSKKTQ  212



>ref|XP_004248001.1| PREDICTED: ras-related protein RABA5e-like [Solanum lycopersicum]
Length=217

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 184/200 (92%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNLHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+TTF++I RWL+EL TH DTTVAR+LVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALVVYDISRRTTFDSIPRWLDELKTHSDTTVARILVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EG+FF+ETSALDSTNVN AFEIVIR+IY +VSRK+LNSDSYKAE
Sbjct  131  NIRAVSVEEGKSLAESEGMFFMETSALDSTNVNKAFEIVIREIYNSVSRKVLNSDSYKAE  190

Query  159  LSVNRVSLAN-GADMSKQNK  103
            LSVNRV+L N G D SKQ +
Sbjct  191  LSVNRVNLVNDGTDGSKQKQ  210



>ref|XP_006856830.1| hypothetical protein AMTR_s00055p00167390 [Amborella trichopoda]
 gb|ERN18297.1| hypothetical protein AMTR_s00055p00167390 [Amborella trichopoda]
Length=214

 Score =   306 bits (785),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEINGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+N+ RWLEEL TH DTTV+R+LVGNKCDL 
Sbjct  69   QERFRAVTSAYYRGAVGALIVYDISRRTTFDNVTRWLEELKTHSDTTVSRILVGNKCDLV  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  129  DIRDVSVEEGKALAEAEGLFFMETSALDSTNVKAAFEIVIREIYNNVSRKVLNSDSYKAE  188

Query  159  LSVNRVSLANGA-DMSKQNK  103
            LS+NRVSL + A + S Q K
Sbjct  189  LSLNRVSLVDDANEHSDQTK  208



>ref|XP_010926654.1| PREDICTED: ras-related protein RABA5e-like isoform X2 [Elaeis 
guineensis]
Length=214

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+  DEFD +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYTLDEFDLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF++I RWL ELNTH DTTVARMLVGNKCDL 
Sbjct  69   QERFRAVTSAYYRGAFGALVVYDISRRSTFDSISRWLHELNTHSDTTVARMLVGNKCDLA  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EGLFFIETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  129  NIREVSVEEGKSLAEAEGLFFIETSALDSTNVKTAFEIVIKEIYNNVSRKVLNSDSYKAE  188

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVS+  +G D SKQ
Sbjct  189  LSLNRVSITGSGTDESKQ  206



>ref|XP_009348339.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
 ref|XP_009348340.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
Length=220

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/200 (80%), Positives = 181/200 (91%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ  E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSTEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRKTTFE++ RWL+EL TH D TVA MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKTTFESVGRWLDELKTHSDATVAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVE+G+ LAE EGLFF+ETSALDSTNV  AFE+VI++IY NVSRK+LNSD+YKAE
Sbjct  133  NIRSVSVEDGRSLAEAEGLFFMETSALDSTNVKKAFELVIQEIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD  K+ K
Sbjct  193  LSVNRVSLVNNGADGLKKTK  212



>gb|KHG13174.1| Ras-related RABA5d -like protein [Gossypium arboreum]
Length=215

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELN+H DTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAFGALLVYDISRRATFDNVARWLDELNSHSDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            + R+VS++EGK LAE EGLFFIETSALDSTNV TAFEIVIR+IY NVSRK+L+SDSYKAE
Sbjct  130  NTREVSLDEGKSLAESEGLFFIETSALDSTNVWTAFEIVIREIYNNVSRKVLSSDSYKAE  189

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N  ++ KQ+K
Sbjct  190  LSVNRVSLVNDDEL-KQSK  207



>ref|XP_004515580.1| PREDICTED: ras-related protein RABA5e-like [Cicer arietinum]
Length=219

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  13   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLEIDSKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTF+++ RWL+EL THCDTTVA MLVGNKCDL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDISRRTTFDSVGRWLDELKTHCDTTVAMMLVGNKCDLD  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  133  NIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLAN-GADMSKQN  106
            LSVNRVSL N G   SK+N
Sbjct  193  LSVNRVSLVNDGNSTSKKN  211



>ref|XP_010927595.1| PREDICTED: ras-related protein RABA5c-like [Elaeis guineensis]
Length=217

 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/198 (80%), Positives = 183/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQTLDIEGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+++ RWL EL+TH DTTVARMLVGNKCDL 
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDISRRSTFDSVPRWLHELDTHSDTTVARMLVGNKCDLA  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EGLFFIETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVSVEEGKSLAEAEGLFFIETSALDSTNVKTAFEIVIKEIYNNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVS+  NG D SKQ
Sbjct  192  LSLNRVSITGNGTDESKQ  209



>ref|XP_004152077.1| PREDICTED: ras-related protein RABA5d-like [Cucumis sativus]
 ref|XP_004161590.1| PREDICTED: ras-related protein RABA5d-like [Cucumis sativus]
 gb|KGN53130.1| hypothetical protein Csa_4G017180 [Cucumis sativus]
Length=217

 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQV+++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQVMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R++TF+++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRSTFDSVGRWLDELKTHSDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVE+G  LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  132  NIRDVSVEDGTSLAEAEGLFFMETSALDSTNVKRAFEIVIREIYNNVSRKVLNSDTYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N    SKQ++
Sbjct  192  LSVNRVSLVNNGG-SKQSE  209



>ref|XP_006294977.1| hypothetical protein CARUB_v10024045mg [Capsella rubella]
 gb|EOA27875.1| hypothetical protein CARUB_v10024045mg [Capsella rubella]
Length=214

 Score =   305 bits (780),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  131  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  190

Query  159  LSVNRVSL  136
            LSVNRVSL
Sbjct  191  LSVNRVSL  198



>ref|XP_008792967.1| PREDICTED: ras-related protein RABA5d-like [Phoenix dactylifera]
Length=214

 Score =   304 bits (779),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/198 (79%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IG+SAVGKSNLLSR+ARDEF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGESAVGKSNLLSRYARDEFNLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+++ RWL EL TH DTTVARMLVGNKCDL 
Sbjct  69   QERFRAVTSAYYRGAFGALVVYDISRRSTFDSVSRWLHELTTHSDTTVARMLVGNKCDLA  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EG+FFIETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  129  NIREVSVEEGKSLAEAEGMFFIETSALDSTNVKTAFEIVIKEIYNNVSRKVLNSDSYKAE  188

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+N VS+  NG D SKQ
Sbjct  189  LSLNSVSITGNGTDESKQ  206



>ref|XP_009339876.1| PREDICTED: ras-related protein RABA5e [Pyrus x bretschneideri]
Length=220

 Score =   305 bits (780),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 182/200 (91%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITRKTTFE++ RWL+EL TH DTT+A MLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDITRKTTFESVGRWLDELKTHSDTTLAMMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVE+G+ LAE EGLFF+ETSALDSTNV  AFE+VI++IY NVSRK+LNSD+YKAE
Sbjct  133  DIRAVSVEDGRSLAEAEGLFFMETSALDSTNVIKAFELVIQEIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGAD S + +
Sbjct  193  LSVNRVSLVNNGADGSNKTQ  212



>ref|XP_008453919.1| PREDICTED: ras-related protein RABA5d [Cucumis melo]
Length=217

 Score =   304 bits (779),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQV+++DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQVMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R++TF+++ RWL+EL TH DTTVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRSTFDSVGRWLDELKTHSDTTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDV+VEEG  LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  132  NIRDVTVEEGTSLAEAEGLFFMETSALDSTNVKRAFEIVIREIYNNVSRKVLNSDTYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N    SKQ++
Sbjct  192  LSVNRVSLVNNGG-SKQSE  209



>gb|AFK35472.1| unknown [Medicago truncatula]
Length=215

 Score =   304 bits (779),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/198 (81%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EFD NSKATIGVE QTQ+VE+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVLIGDSAVGKSNLLSRFARNEFDSNSKATIGVELQTQMVEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TFE+IKRWL+EL T  D+TVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDISRRGTFESIKRWLDELTTQNDSTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VS+EEGK LAEEEGLFF+ETSALDSTNV TAFEIVIR+IY N+SRK+LN DSYKAE
Sbjct  132  NIREVSIEEGKALAEEEGLFFMETSALDSTNVQTAFEIVIREIYNNISRKVLNFDSYKAE  191

Query  159  LSVNRVSLANGADMSKQN  106
            L VNRV+L NG   SK+N
Sbjct  192  LFVNRVTLVNGFG-SKKN  208



>ref|XP_002881887.1| hypothetical protein ARALYDRAFT_903694 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58146.1| hypothetical protein ARALYDRAFT_903694 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  190  LTVNRVSL  197



>gb|EYU32725.1| hypothetical protein MIMGU_mgv1a013434mg [Erythranthe guttata]
Length=220

 Score =   304 bits (778),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 181/200 (91%), Gaps = 2/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFSMHSKATIGVEFQTQTLEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDITR++TF+++ RWL+EL TH DTTVA+MLVGNKCDL 
Sbjct  72   QERFRAVTSAYYRGAFGALVVYDITRRSTFDSVPRWLDELKTHSDTTVAKMLVGNKCDLG  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  132  NIRDVSVEEGKSLAESEGLFFMETSALDSTNVRKAFEIVIREIYNNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSLAN--GADMSKQN  106
            LSVNRVS+ N    D SK++
Sbjct  192  LSVNRVSIVNNGSGDGSKKS  211



>ref|XP_009415105.1| PREDICTED: ras-related protein RABA5e-like [Musa acuminata subsp. 
malaccensis]
Length=212

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVK+Q+WDTAG
Sbjct  7    YLFKIVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMEIDGKEVKSQIWDTAG  66

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTF+++ RWL+ELNTH DT VA+MLVGNKCDLE
Sbjct  67   QERFRAVTSAYYRGAVGALVVYDISRRTTFDSVPRWLQELNTHSDTAVAKMLVGNKCDLE  126

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IRD+S++EGK LAE EGLFFIETSALD TNV  AFEIVIR+IY N+SRK+LNSDSYKAE
Sbjct  127  DIRDISIDEGKSLAEAEGLFFIETSALDCTNVKKAFEIVIREIYNNISRKVLNSDSYKAE  186

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS +RVS+ +NG D +KQ
Sbjct  187  LSRDRVSITSNGNDEAKQ  204



>ref|NP_181842.1| Ras-related protein ARA-4 [Arabidopsis thaliana]
 sp|P28187.1|RAA5C_ARATH RecName: Full=Ras-related protein RABA5c; Short=AtRABA5c; AltName: 
Full=Ras-related protein Ara-4; AltName: Full=Ras-related 
protein Rab11F; Short=AtRab11F [Arabidopsis thaliana]
 dbj|BAA00831.1| small GTP-binding protein [Arabidopsis thaliana]
 gb|AAC64302.1| Ras-related GTP-binding protein (ARA-4) [Arabidopsis thaliana]
 gb|ABF83674.1| At2g43130 [Arabidopsis thaliana]
 dbj|BAH19889.1| AT2G43130 [Arabidopsis thaliana]
 gb|AEC10212.1| Ras-related protein ARA-4 [Arabidopsis thaliana]
Length=214

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  131  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_006411588.1| hypothetical protein EUTSA_v10017231mg [Eutrema salsugineum]
 gb|ESQ53041.1| hypothetical protein EUTSA_v10017231mg [Eutrema salsugineum]
Length=213

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  190  LTVNRVSL  197



>ref|XP_010522214.1| PREDICTED: ras-related protein RABA5d [Tarenaya hassleriana]
Length=217

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/198 (80%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI R+TTFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDIARRTTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY NVSRK LNSD+YKAE
Sbjct  131  NIRAVSVEEGKALAESEGLFFMETSALDSTNVKTAFEMVIREIYNNVSRKQLNSDTYKAE  190

Query  159  LSVNRVSLA-NGADMSKQ  109
            L+VNRVSL  N  ++SKQ
Sbjct  191  LTVNRVSLVKNDNEVSKQ  208



>emb|CDY42801.1| BnaC03g24050D [Brassica napus]
Length=213

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE  G FF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKGLAESHGFFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  190  LTVNRVSL  197



>gb|KFK37154.1| hypothetical protein AALP_AA4G220200 [Arabis alpina]
Length=214

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTT+A+ML+GNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTIAKMLIGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  131  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_007034146.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
 gb|EOY05072.1| RAB GTPase A5E isoform 1 [Theobroma cacao]
Length=214

 Score =   303 bits (776),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ VE+DGK+VKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNAHSKATIGVEFQTQSVEIDGKDVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELN+H DTTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAFGALLVYDISRRATFDNVARWLDELNSHSDTTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V++EEGK LAE EGLFFIETSALDSTNV TAFEIVIR+IY NVSR++LNSDSYKAE
Sbjct  130  NIREVTLEEGKSLAEAEGLFFIETSALDSTNVRTAFEIVIREIYNNVSRRVLNSDSYKAE  189

Query  159  LSVNRVSLAN  130
            L+VNRVSL N
Sbjct  190  LTVNRVSLVN  199



>ref|XP_010506172.1| PREDICTED: ras-related protein RABA5c-like [Camelina sativa]
Length=215

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  132  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNMSRKQLNSDSYKEE  191

Query  159  LSVNRVSL  136
            LS NRVSL
Sbjct  192  LSANRVSL  199



>ref|XP_010542762.1| PREDICTED: ras-related protein RABA5d-like [Tarenaya hassleriana]
Length=219

 Score =   303 bits (775),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 181/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYD++R+TTFE++ RWL+ELNTH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDVSRRTTFESVGRWLDELNTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VS+EEGK LAE EGLFF+ETSALDSTNV  AFE+VIRDIY NV RK LNSD+YKAE
Sbjct  131  NIRAVSMEEGKALAEAEGLFFMETSALDSTNVKRAFEMVIRDIYSNVGRKQLNSDTYKAE  190

Query  159  LSVNRVSLANGAD--MSKQ  109
            L+VNRVSL    D  +SKQ
Sbjct  191  LTVNRVSLVKNNDNLVSKQ  209



>gb|KJB28019.1| hypothetical protein B456_005G022300 [Gossypium raimondii]
Length=215

 Score =   302 bits (774),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELN+H DTTVA+MLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAFGALLVYDISRRATFDNVARWLDELNSHSDTTVAKMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            + R+VS++EGK LAE EGLFFIETSALDSTNV TAFEIVIR+IY NVSRK+L+SDSYKA 
Sbjct  130  NTREVSLDEGKSLAESEGLFFIETSALDSTNVWTAFEIVIREIYNNVSRKVLSSDSYKAR  189

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N  ++ KQ+K
Sbjct  190  LSVNRVSLVNDDEL-KQSK  207



>gb|KJB27937.1| hypothetical protein B456_005G017600 [Gossypium raimondii]
Length=219

 Score =   302 bits (774),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMGIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKMHSDTTVARMLVGNKCDLE  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAEE  LFF+ETSALDSTNV  AFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  133  TIRDVSVEEGKALAEEHDLFFMETSALDSTNVKKAFELVIREIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLANG-ADMSKQNK  103
            L+VNRVSL     D SKQ +
Sbjct  193  LTVNRVSLTKTETDASKQTQ  212



>ref|XP_010508467.1| PREDICTED: ras-related protein RABA5c [Camelina sativa]
Length=214

 Score =   302 bits (774),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  131  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNMSRKQLNSDSYKEE  190

Query  159  LSVNRVSL  136
            LS NRVSL
Sbjct  191  LSSNRVSL  198



>ref|XP_009133574.1| PREDICTED: ras-related protein RABA5c [Brassica rapa]
Length=213

 Score =   302 bits (773),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE +GLFF+ETSAL STNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKGLAESQGLFFMETSALGSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  190  LTVNRVSL  197



>emb|CDX83500.1| BnaA03g20060D [Brassica napus]
Length=213

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMIIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE +GLFF+ETSAL STNV TAFE+VIR+IY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKGLAESQGLFFMETSALGSTNVKTAFEMVIREIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  190  LTVNRVSL  197



>gb|EMS53467.1| Ras-related protein RABA5c [Triticum urartu]
Length=217

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELNTH DTTVA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRGTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNVNTAFE+VI++IY +VSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAESEGLFFMETSALDSTNVNTAFELVIKEIYSSVSRKILNSDSYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            LS+NRVS+ +G     Q +
Sbjct  192  LSLNRVSIDDGDSKDGQKQ  210



>ref|XP_003574801.1| PREDICTED: ras-related protein RABA5c-like [Brachypodium distachyon]
Length=217

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 181/199 (91%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQTMEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYD++R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDVSRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNVNTAFE+VI++IY +VSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAESEGLFFMETSALDSTNVNTAFELVIKEIYSSVSRKILNSDSYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            L++NRVS+ N      Q +
Sbjct  192  LTLNRVSIHNDGSKDGQKQ  210



>ref|XP_004973932.1| PREDICTED: ras-related protein RABA5d-like [Setaria italica]
Length=217

 Score =   301 bits (772),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TFEN+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFENVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE E +FF+ETSALD+TNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAESMFFMETSALDATNVETAFEIVIKEIYSNVSRKILNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVS+  +  D  KQ
Sbjct  192  LSLNRVSIDGDSKDDQKQ  209



>ref|XP_010517866.1| PREDICTED: ras-related protein RABA5c-like [Camelina sativa]
Length=214

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMVIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TA E+VIR+IY N+SRK LNSDSYK E
Sbjct  131  SIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTALEMVIREIYSNMSRKQLNSDSYKEE  190

Query  159  LSVNRVSL  136
            LS NRVSL
Sbjct  191  LSANRVSL  198



>gb|EMT31969.1| Ras-related protein ARA-4 [Aegilops tauschii]
Length=217

 Score =   301 bits (771),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELNTH DTTVA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRGTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNVNTAFE+VI++IY +VSRK+LNSD+YKAE
Sbjct  132  NIREVPVEEGKALAESEGLFFMETSALDSTNVNTAFELVIKEIYSSVSRKILNSDTYKAE  191

Query  159  LSVNRVSLANGADMSKQNK  103
            LS+NRVS+ +G     Q +
Sbjct  192  LSLNRVSIDDGDSKDSQKQ  210



>ref|XP_010457681.1| PREDICTED: ras-related protein RABA5e-like [Camelina sativa]
Length=220

 Score =   300 bits (769),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELTIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VI DIY NVSRKLLNSD+YK E
Sbjct  131  NIRAVSVEEGKALAEAQGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKLLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>gb|KJB71848.1| hypothetical protein B456_011G144500 [Gossypium raimondii]
Length=258

 Score =   301 bits (772),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 181/199 (91%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  54   YLFKIVIIGDSAVGKSNLLSRYARNEFSPHSKATIGVEFQTQTMEINGKEVKAQIWDTAG  113

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDI+R+TTF+++ RWL+EL TH DTTVAR+LVGNKCDLE
Sbjct  114  QERFRAVTSAYYRGAAGALIVYDISRRTTFDSVGRWLDELKTHSDTTVARILVGNKCDLE  173

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNVN AFE+VIR+IY NVSRK+LNSD+ KAE
Sbjct  174  TIRDVSVEEGKSLAEAEGLFFMETSALDSTNVNKAFELVIREIYNNVSRKVLNSDTQKAE  233

Query  159  LSVNRVSLANGADMSKQNK  103
            L+VNRV+L    D SK+ +
Sbjct  234  LTVNRVTLTE-TDGSKKTQ  251



>sp|P19892.1|RAA5E_ARATH RecName: Full=Ras-related protein RABA5e; Short=AtRABA5e; AltName: 
Full=Ras-related protein Ara-1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF29387.1|AC009999_7 Strong similarity to a RAS-related protein ARA-1 from Arabidopsis 
thaliana gi|114085, and is a member of the RAS PF|00071 
family. EST gb|D01026 comes from this gene [Arabidopsis thaliana]
 gb|AAG48820.1|AF332457_1 putative RAS-related protein ARA-1 [Arabidopsis thaliana]
 gb|AAC13655.1| ras-related protein [Arabidopsis thaliana]
Length=218

 Score =   300 bits (767),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAEEEGLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK E
Sbjct  131  NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_006410298.1| hypothetical protein EUTSA_v10017221mg [Eutrema salsugineum]
 gb|ESQ51751.1| hypothetical protein EUTSA_v10017221mg [Eutrema salsugineum]
Length=219

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSIEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR++TFE++ RWL+ELNTH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRSTFESVGRWLDELNTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+YK +
Sbjct  131  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYKTQ  190

Query  159  LSV-NRVSL  136
            L+  NRVSL
Sbjct  191  LNANNRVSL  199



>ref|XP_010069409.1| PREDICTED: ras-related protein RABA5e-like [Eucalyptus grandis]
 gb|KCW57748.1| hypothetical protein EUGRSUZ_H00498 [Eucalyptus grandis]
Length=220

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLLSR+AR EFDH SKAT+GVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  15   YLFKIVIVGDSAVGKSNLLSRYARGEFDHASKATVGVEFQTQCLEIDGKEVKAQIWDTAG  74

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYD+TR++TF+++ RWL+ELN+H DTTVA+MLVGNKCDLE
Sbjct  75   QERFRAVTSAYYRGAFGALLVYDVTRRSTFDSVSRWLDELNSHSDTTVAKMLVGNKCDLE  134

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFFIETSALDSTNV+ AFEIVIR+IY NVSRK+LNSDSYK  
Sbjct  135  NIRDVSVEEGKKLAEAEGLFFIETSALDSTNVHKAFEIVIREIYDNVSRKVLNSDSYKVN  194

Query  159  LSVNRVSLANG  127
            L  N VSL +G
Sbjct  195  LESNGVSLVDG  205



>ref|NP_563750.2| RAB GTPase homolog A5E [Arabidopsis thaliana]
 gb|AAP06819.1| putative RAS-related protein ARA-1 [Arabidopsis thaliana]
 gb|AEE27897.1| RAB GTPase homolog A5E [Arabidopsis thaliana]
Length=261

 Score =   300 bits (769),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  54   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  113

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  114  QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  173

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAEEEGLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK E
Sbjct  174  NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDE  233

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  234  LTVNRVSL  241



>emb|CDY17945.1| BnaC04g02740D [Brassica napus]
Length=213

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +D KEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDNKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRTSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE +GLFF+ETSALDSTNV+TAFE+VIRDIY N+SRK LNSDSYK E
Sbjct  130  SIRAVSVEEGKSLAESQGLFFMETSALDSTNVSTAFEMVIRDIYSNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            ++ NRVSL
Sbjct  190  VTGNRVSL  197



>gb|EPS70637.1| hypothetical protein M569_04122, partial [Genlisea aurea]
Length=221

 Score =   299 bits (765),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 2/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  16   YLFKIVIIGDSAVGKSNLLSRYARNEFSLHSKATIGVEFQTQSLDIDGKEVKAQIWDTAG  75

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDI+R++TF++I RWL EL TH DTT+AR+LVGNKCDLE
Sbjct  76   QERFRAVTSAYYRGAFGALIVYDISRRSTFDSIPRWLNELKTHSDTTMARILVGNKCDLE  135

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IRDVSVEEGK LAE E LFF+ETSALDSTNV TAFE+VI +IY NVSRK+LNSDSYKAE
Sbjct  136  HIRDVSVEEGKSLAESETLFFMETSALDSTNVKTAFEMVIHEIYNNVSRKVLNSDSYKAE  195

Query  159  LSVNRVSLAN--GADMSKQN  106
            LS+NRVS+ N    D  K+N
Sbjct  196  LSLNRVSIVNEISDDGPKKN  215



>dbj|BAJ85419.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  14   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  74   QERFRAVTSAYYRGAFGALLVYDISRRGTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNVNTAFE+VI++IY +VSRK+LNSDSYKAE
Sbjct  134  NIREVPVEEGKALAESEGLFFMETSALDSTNVNTAFELVIKEIYNSVSRKILNSDSYKAE  193

Query  159  LSVNRVSL--ANGADMSKQ  109
            LS+NRVS+  ++  D  KQ
Sbjct  194  LSLNRVSIDDSDSKDGQKQ  212



>gb|AAL36203.1| putative RAS-related protein ARA-1 [Arabidopsis thaliana]
Length=218

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL++L  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDQLKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAEEEGLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK E
Sbjct  131  NIRAVSVEEGKALAEEEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>gb|KHG12252.1| Ras-related RABA5e -like protein [Gossypium arboreum]
Length=219

 Score =   298 bits (764),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 180/200 (90%), Gaps = 1/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMGIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL  H DTTVARMLVGNKCDL 
Sbjct  73   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKMHSDTTVARMLVGNKCDLG  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE+  LFF+ETSALDSTNV  AFE+VIR+IY NVSRK+LNSD+YKAE
Sbjct  133  TIRDVSVEEGKALAEQHDLFFMETSALDSTNVKKAFELVIREIYNNVSRKVLNSDTYKAE  192

Query  159  LSVNRVSLANG-ADMSKQNK  103
            L+VNRVSL+    D SK+ +
Sbjct  193  LTVNRVSLSKTETDASKKTQ  212



>gb|KHG11710.1| Ras-related RABA5d -like protein [Gossypium arboreum]
Length=215

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQTMEINGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDI+R+TTF+++ RWL+EL TH DTTVAR+LVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAAGALIVYDISRRTTFDSVGRWLDELKTHSDTTVARILVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNVN AFE+VIR+IY NVSRK+LNSD+ KAE
Sbjct  131  TIRDVSVEEGKSLAEAEGLFFMETSALDSTNVNKAFELVIREIYNNVSRKVLNSDTQKAE  190

Query  159  LSVNRVSL  136
            L+VNRV+L
Sbjct  191  LTVNRVTL  198



>ref|XP_010553589.1| PREDICTED: ras-related protein RABA5c-like [Tarenaya hassleriana]
Length=216

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 178/198 (90%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+ R+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  10   YLFKVVIIGDSAVGKSNLLSRYTRNEFNAHSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TF+N+ RWL+ELN H +T VARMLVGNK DLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRGSTFDNVGRWLDELNAHSETAVARMLVGNKRDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEG+ LAE EGLFF+ETSALDSTNV TAFE+VIR+IY N+SRK LNSD+YKAE
Sbjct  130  SIRAVSVEEGRSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDTYKAE  189

Query  159  LSVNRVSLA-NGADMSKQ  109
            L+V RVSL  NG D +KQ
Sbjct  190  LTVKRVSLVKNGNDGAKQ  207



>ref|XP_006659598.1| PREDICTED: ras-related protein RABA5c-like [Oryza brachyantha]
Length=216

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSLDIDGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAEGLFFMETSALDSTNVKTAFEIVIKEIYSNVSRKILNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVS+  +  D  KQ
Sbjct  192  LSLNRVSIDGDSKDDQKQ  209



>ref|XP_009142914.1| PREDICTED: ras-related protein RABA5c-like [Brassica rapa]
 emb|CDY70114.1| BnaAnng32660D [Brassica napus]
Length=213

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + +D KEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDNKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR +TFEN+ RWL+ELNTH DTTVA+ML+GNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRTSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VS+EEGK LAE +GLFF+ETSALDSTNV+TAFE+VIRDIY N+SRK LNSDSYK E
Sbjct  130  SIRAVSIEEGKSLAESQGLFFMETSALDSTNVSTAFEMVIRDIYGNISRKQLNSDSYKEE  189

Query  159  LSVNRVSL  136
            ++ NRVSL
Sbjct  190  VTGNRVSL  197



>ref|NP_001152371.1| ras-related protein ARA-4 [Zea mays]
 gb|ACF83174.1| unknown [Zea mays]
 gb|ACG47295.1| ras-related protein ARA-4 [Zea mays]
 tpg|DAA48143.1| TPA: hypothetical protein ZEAMMB73_561529 [Zea mays]
Length=216

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 178/199 (89%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSMAIEGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDITR++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL 
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDITRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLG  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR V VEEGK LAE EGLFF+ETSALD+TNV TAFEIVIR+IY NVSRK+LNSDSYKAE
Sbjct  132  DIRQVPVEEGKALAEAEGLFFMETSALDATNVRTAFEIVIREIYSNVSRKVLNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQN  106
            LS+NRVS+  +  D  KQ 
Sbjct  192  LSLNRVSIDGDSKDEQKQG  210



>ref|XP_010475301.1| PREDICTED: ras-related protein RABA5e-like [Camelina sativa]
Length=220

 Score =   298 bits (763),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELTIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK E
Sbjct  131  NIRAVSVEEGKALAEAQGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_002444720.1| hypothetical protein SORBIDRAFT_07g026600 [Sorghum bicolor]
 gb|EES14215.1| hypothetical protein SORBIDRAFT_07g026600 [Sorghum bicolor]
Length=216

 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 181/198 (91%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFSLHSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALD+TNV TAFEIVIR+IY +VSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAEGLFFMETSALDATNVRTAFEIVIREIYSSVSRKILNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRVS+  +  D  KQ
Sbjct  192  LSLNRVSIDGDSKDDKKQ  209



>ref|XP_002881188.1| hypothetical protein ARALYDRAFT_902201 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57447.1| hypothetical protein ARALYDRAFT_902201 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+YK E
Sbjct  131  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYKTE  190

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  191  LSMKNRVSL  199



>ref|NP_180726.1| RAB GTPase-like protein A5D [Arabidopsis thaliana]
 sp|Q9SIP0.1|RAA5D_ARATH RecName: Full=Ras-related protein RABA5d; Short=AtRABA5d [Arabidopsis 
thaliana]
 gb|AAD24853.1| putative RAS superfamily GTP-binding protein [Arabidopsis thaliana]
 gb|AAP88354.1| At2g31680 [Arabidopsis thaliana]
 dbj|BAE99691.1| putative RAS superfamily GTP-binding protein [Arabidopsis thaliana]
 gb|AEC08572.1| RAB GTPase-like protein A5D [Arabidopsis thaliana]
Length=219

 Score =   297 bits (761),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY N+SRK LNSD+YK E
Sbjct  131  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNISRKQLNSDTYKTE  190

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  191  LSMKNRVSL  199



>ref|XP_010673314.1| PREDICTED: ras-related protein RABA5d-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score =   296 bits (759),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTF+++ RWL+ELNTH DTTVARMLVGNK DL+
Sbjct  70   QERFRAVTSAYYRGAVGALVVYDITRRTTFDSVGRWLDELNTHSDTTVARMLVGNKFDLD  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSV+EGK LAEE GLFF+ETSA DSTNV TAFE+VI++IY +VSRK+LNSDSYKA+
Sbjct  130  DIRAVSVDEGKSLAEEHGLFFMETSAKDSTNVKTAFELVIKEIYSSVSRKVLNSDSYKAQ  189

Query  159  LSVNRVSLANGADMSKQNK  103
            LS+NRVSL N  D  KQN+
Sbjct  190  LSLNRVSLVN--DDKKQNQ  206



>gb|KFK31198.1| hypothetical protein AALP_AA6G080900 [Arabis alpina]
Length=220

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+YKAE
Sbjct  132  NIRAVSVEEGKTLAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYKAE  191

Query  159  LSV-NRVSL  136
            LS  NRVSL
Sbjct  192  LSTNNRVSL  200



>gb|ABK21873.1| unknown [Picea sitchensis]
Length=210

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQV+E+DGKEVKAQ+WDTAG
Sbjct  9    YLFKIVVIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQVMEIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+ TF+N+ RWLEEL  H D+ V +MLVGNK DLE
Sbjct  69   QERFRAVTSAYYRGAVGALIVYDISRRLTFDNVARWLEELKMHADSNVVKMLVGNKSDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V VE+G+ LAE EGLFFIETSALD+TNV  AF+IV+R+IY NVS+K+LNSDSYK+E
Sbjct  129  HIREVPVEDGRKLAESEGLFFIETSALDNTNVMPAFQIVVREIYNNVSKKMLNSDSYKSE  188

Query  159  LSVNRVSLANGADMSK  112
            LS+NRV + +G D  K
Sbjct  189  LSLNRVKIMDGEDPPK  204



>ref|NP_001062290.1| Os08g0525000 [Oryza sativa Japonica Group]
 dbj|BAC75417.1| putative GTP-binding protein(RAB11G) [Oryza sativa Japonica Group]
 dbj|BAF24204.1| Os08g0525000 [Oryza sativa Japonica Group]
 dbj|BAG95960.1| unnamed protein product [Oryza sativa Japonica Group]
Length=216

 Score =   296 bits (758),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAEGLFFMETSALDSTNVRTAFEIVIKEIYSNVSRKILNSDSYKAE  191

Query  159  LSVNRVSL-ANGADMSKQN  106
            LS+NRVS+  +  D  KQ+
Sbjct  192  LSLNRVSIEGDSKDDQKQS  210



>gb|KFK42915.1| hypothetical protein AALP_AA1G054800 [Arabis alpina]
Length=219

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRGTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSV+EGK LAEEEGLFF+ETSALDSTNV TAFE VI DIY NVSRK LNSD+YK E
Sbjct  131  NIRAVSVDEGKALAEEEGLFFVETSALDSTNVKTAFEKVILDIYNNVSRKQLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_010485339.1| PREDICTED: ras-related protein RABA5e isoform X1 [Camelina sativa]
Length=220

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELTIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK +
Sbjct  131  NIRAVSVEEGKALAEAQGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDK  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_006293514.1| hypothetical protein CARUB_v10024030mg [Capsella rubella]
 gb|EOA26412.1| hypothetical protein CARUB_v10024030mg [Capsella rubella]
Length=219

 Score =   296 bits (757),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKAHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+YK E
Sbjct  131  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYKTE  190

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  191  LSMKNRVSL  199



>ref|XP_002889568.1| hypothetical protein ARALYDRAFT_887774 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65827.1| hypothetical protein ARALYDRAFT_887774 [Arabidopsis lyrata subsp. 
lyrata]
Length=218

 Score =   295 bits (755),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMAIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSV+EGK LAE EGLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK +
Sbjct  131  NIRAVSVDEGKALAEAEGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDK  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>emb|CDP10276.1| unnamed protein product [Coffea canephora]
Length=215

 Score =   295 bits (755),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNPHSKATIGVEFQTQSIEIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDITRK TFE++++WL+ELN H D+TVA+MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDITRKDTFESVRKWLDELNAHSDSTVAKMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R VSVE+GK LAE EG FFIETSALDSTNV  AFEIVIR+IY NVSRK+LN D  K E
Sbjct  132  SMRQVSVEDGKSLAEAEGFFFIETSALDSTNVKQAFEIVIREIYSNVSRKVLNPDMSKTE  191

Query  159  LSVNRVSLAN  130
            LSVNRVSL +
Sbjct  192  LSVNRVSLVD  201



>ref|XP_006305597.1| hypothetical protein CARUB_v10010263mg [Capsella rubella]
 gb|EOA38495.1| hypothetical protein CARUB_v10010263mg [Capsella rubella]
Length=218

 Score =   295 bits (754),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK +
Sbjct  131  NIRAVSVEEGKTLAEAQGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDK  190

Query  159  LSVNRVSL  136
            L+V+RVSL
Sbjct  191  LTVHRVSL  198



>ref|XP_006417985.1| hypothetical protein EUTSA_v10008743mg [Eutrema salsugineum]
 gb|ESQ36338.1| hypothetical protein EUTSA_v10008743mg [Eutrema salsugineum]
Length=218

 Score =   295 bits (754),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE VI DIY NVSRK LNSD+YK E
Sbjct  131  HIRAVSVEEGKALAEAQGLFFVETSALDSTNVTTAFEKVILDIYNNVSRKQLNSDTYKDE  190

Query  159  LSVNRVSL  136
            L+VNRVSL
Sbjct  191  LTVNRVSL  198



>ref|XP_010485340.1| PREDICTED: ras-related protein RABA5e isoform X2 [Camelina sativa]
Length=196

 Score =   293 bits (749),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  +SKATIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSAHSKATIGVEFQTQSMEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+TTFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDITRRTTFESVGRWLDELTIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VI DIY NVSRK LNSD+YK +
Sbjct  131  NIRAVSVEEGKALAEAQGLFFVETSALDSTNVKTAFEMVILDIYNNVSRKQLNSDTYKDK  190

Query  159  LSVNRV  142
            L+VNRV
Sbjct  191  LTVNRV  196



>ref|XP_010469687.1| PREDICTED: ras-related protein RABA5d [Camelina sativa]
Length=220

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKIHSDTTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+YK E
Sbjct  132  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYKTE  191

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  192  LSMKNRVSL  200



>ref|XP_009144057.1| PREDICTED: ras-related protein RABA5d [Brassica rapa]
 emb|CDY55745.1| BnaA05g35310D [Brassica napus]
Length=219

 Score =   292 bits (748),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GKEV+AQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKEVRAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGA +VYDI+R+TTFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGAFVVYDISRRTTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VIRDIY N+SRK LNSD+YK +
Sbjct  131  SMRAVSVEEGKALAETQGLFFMETSALDSTNVKTAFEMVIRDIYTNISRKQLNSDTYKTQ  190

Query  159  L-SVNRVSL  136
            L S NRVSL
Sbjct  191  LGSNNRVSL  199



>ref|XP_010926653.1| PREDICTED: ras-related protein RABA5e-like isoform X1 [Elaeis 
guineensis]
Length=232

 Score =   292 bits (748),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 180/216 (83%), Gaps = 19/216 (9%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+  DEFD +SKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  9    YLFKVVIIGDSAVGKSNLLSRYTLDEFDLHSKATIGVEFQTQTLDIDGKEVKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELN------------------T  394
            QERFRAVTSAYYRGA GAL+VYDI+R++TF++I RWL ELN                   
Sbjct  69   QERFRAVTSAYYRGAFGALVVYDISRRSTFDSISRWLHELNIGTQFGDWLPGPLLLILRA  128

Query  393  HCDTTVARMLVGNKCDLESIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRD  214
            H DTTVARMLVGNKCDL +IR+VSVEEGK LAE EGLFFIETSALDSTNV TAFEIVI++
Sbjct  129  HSDTTVARMLVGNKCDLANIREVSVEEGKSLAEAEGLFFIETSALDSTNVKTAFEIVIKE  188

Query  213  IYKNVSRKLLNSDSYKAELSVNRVSL-ANGADMSKQ  109
            IY NVSRK+LNSDSYKAELS+NRVS+  +G D SKQ
Sbjct  189  IYNNVSRKVLNSDSYKAELSLNRVSITGSGTDESKQ  224



>ref|XP_007033995.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
 gb|EOY04921.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
Length=211

 Score =   291 bits (746),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 178/200 (89%), Gaps = 7/200 (4%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNPNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL       +ARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELK------IARMLVGNKCDLE  124

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IRDVSVEEGK LAE EGLFF+ETSALDSTNV  AFEIVIR+IY NVSRK+LNSD+YKAE
Sbjct  125  TIRDVSVEEGKSLAEAEGLFFMETSALDSTNVKKAFEIVIREIYNNVSRKVLNSDTYKAE  184

Query  159  LSVNRVSLANG-ADMSKQNK  103
            L+VNRV+L     D SKQ +
Sbjct  185  LTVNRVTLTKSETDGSKQTQ  204



>ref|XP_010451632.1| PREDICTED: ras-related protein RABA5b-like isoform X2 [Camelina 
sativa]
Length=210

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 7/196 (4%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TF+++K        HCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSDTFQSVK-------PHCDTAVAQMLVGNKCDLE  123

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  124  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  183

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  184  LSVNRVSLVNNQDGSE  199



>ref|XP_010486290.1| PREDICTED: ras-related protein RABA5b isoform X3 [Camelina sativa]
Length=210

 Score =   291 bits (744),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 7/196 (4%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRF+RDEFD NSKATIGVEFQTQ+VE++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR  TF+++K        HCDT VA+MLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAFGALIVYDITRSDTFQSVK-------PHCDTAVAQMLVGNKCDLE  123

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR VSVEEGK LAEEEGLFF+ETSALD+TNV+ AFEIVIR+I+ NVSRKLLNSD+YKAE
Sbjct  124  DIRAVSVEEGKALAEEEGLFFMETSALDATNVDKAFEIVIREIFNNVSRKLLNSDAYKAE  183

Query  159  LSVNRVSLANGADMSK  112
            LSVNRVSL N  D S+
Sbjct  184  LSVNRVSLVNNQDGSE  199



>ref|XP_009383333.1| PREDICTED: ras-related protein RABA5c-like [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   291 bits (745),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 182/198 (92%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+ GDSAVGKSNLLSR+AR+EF+ +SKATIGVEF TQ V++DGKEVKAQ+WDTAG
Sbjct  12   YLFKVVITGDSAVGKSNLLSRYARNEFNLHSKATIGVEFLTQTVDIDGKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            Q+RFRAVTSAYYRGA GAL+VYD++R++TF+++ RWL+ELNTH  TTVA+MLVGNKCDL 
Sbjct  72   QDRFRAVTSAYYRGAFGALVVYDVSRRSTFDSVSRWLDELNTHSYTTVAKMLVGNKCDLS  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+VSVEEGK LAE EGLFFIETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKA+
Sbjct  132  NIREVSVEEGKCLAEAEGLFFIETSALDSTNVKTAFEIVIKEIYDNVSRKVLNSDSYKAD  191

Query  159  LSVNRVSL-ANGADMSKQ  109
            LS+NRV+L ++GA+  KQ
Sbjct  192  LSINRVALFSDGANDQKQ  209



>emb|CDX84764.1| BnaA03g14660D [Brassica napus]
Length=219

 Score =   290 bits (743),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD++KAE
Sbjct  131  SMRAVSVEEGKALAETQGLFFMETSALDSTNVKTAFEMVIRDIYANVSRKQLNSDTHKAE  190

Query  159  LSVN-RVSL  136
            L  N RVSL
Sbjct  191  LKWNSRVSL  199



>gb|AAM62720.1| putative RAS superfamily GTP-binding protein [Arabidopsis thaliana]
Length=219

 Score =   290 bits (742),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVE +TQ +E++GKEVKAQ+WDTA 
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVELETQNMEIEGKEVKAQIWDTAC  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEGK LAE EGLFF+ETSALDSTNV TAFE+VIRDIY N+SRK LNSD+YK E
Sbjct  131  SIRAVSVEEGKALAETEGLFFMETSALDSTNVKTAFEMVIRDIYTNISRKQLNSDTYKTE  190

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  191  LSMKNRVSL  199



>ref|XP_010414098.1| PREDICTED: ras-related protein RABA5d-like [Camelina sativa]
Length=220

 Score =   290 bits (741),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 176/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKIHSDTTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            SIR VSVEEG+ LAE+EGLFF+ETSALDSTNV TAFE+VIRDIY NVSRK L+S++YK E
Sbjct  132  SIRAVSVEEGRALAEKEGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLSSNTYKTE  191

Query  159  LSV-NRVSL  136
            LS+ NRVSL
Sbjct  192  LSMKNRVSL  200



>ref|XP_010510172.1| PREDICTED: ras-related protein RABA5d-like [Camelina sativa]
Length=221

 Score =   289 bits (740),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 175/190 (92%), Gaps = 2/190 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMDIDGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVSRWLDELKIHSDTTVARMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSY-KA  163
            SIR VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD+Y K 
Sbjct  132  SIRAVSVEEGKALAETQGLFFMETSALDSTNVKTAFEMVIRDIYTNVSRKQLNSDTYNKT  191

Query  162  ELSV-NRVSL  136
            ELS+ NRVSL
Sbjct  192  ELSMKNRVSL  201



>emb|CDX79430.1| BnaC03g17660D [Brassica napus]
Length=219

 Score =   289 bits (739),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 175/189 (93%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD++KAE
Sbjct  131  NMRAVSVEEGKALAETQGLFFMETSALDSTNVKTAFEMVIRDIYANVSRKQLNSDTHKAE  190

Query  159  LSVN-RVSL  136
            L  N RVSL
Sbjct  191  LKWNSRVSL  199



>ref|XP_009118574.1| PREDICTED: ras-related protein RABA5e [Brassica rapa]
Length=218

 Score =   288 bits (738),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  11   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRMTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV  AFE VI DIY NVSRK LNSD+YK +
Sbjct  131  NIRAVSVEEGKSLAEAQGLFFVETSALDSTNVRIAFEKVILDIYNNVSRKQLNSDTYKDK  190

Query  159  LSVNRVSLANGAD  121
            L+V+RVSL    D
Sbjct  191  LTVSRVSLVKDDD  203



>emb|CDY06181.1| BnaA09g50220D [Brassica napus]
Length=243

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  36   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  95

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  96   QERFRAVTSAYYRGAVGALVVYDISRRMTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  155

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV  AFE VI DIY NVSRK LNSD+YK +
Sbjct  156  NIRAVSVEEGKSLAEAQGLFFVETSALDSTNVRIAFEKVILDIYNNVSRKQLNSDTYKDK  215

Query  159  LSVNRVSLANGAD  121
            L+V+RVSL    D
Sbjct  216  LTVSRVSLVKDDD  228



>ref|XP_009132810.1| PREDICTED: ras-related protein RABA5d-like [Brassica rapa]
Length=218

 Score =   286 bits (733),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 174/189 (92%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R VSVEEGK LAE +GLFF+ETSALDSTNV TAFE+VIRDIY NVSRK LNSD++K E
Sbjct  131  NMRAVSVEEGKALAETQGLFFMETSALDSTNVKTAFEMVIRDIYANVSRKQLNSDTHKTE  190

Query  159  LSVN-RVSL  136
            L  N RVSL
Sbjct  191  LKWNSRVSL  199



>gb|EEC83910.1| hypothetical protein OsI_29960 [Oryza sativa Indica Group]
Length=407

 Score =   293 bits (750),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +++DGK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDIDGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAEGLFFMETSALDSTNVRTAFEIVIKEIYSNVSRKILNSDSYKAE  191

Query  159  LSVNR  145
            LS+NR
Sbjct  192  LSLNR  196



>emb|CDY10008.1| BnaC08g44430D [Brassica napus]
Length=262

 Score =   288 bits (737),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+VVIGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +++DGKEVKAQ+WDTAG
Sbjct  55   YLFKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMDIDGKEVKAQIWDTAG  114

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE++ RWL+EL  H DTTVARMLVGNKCDLE
Sbjct  115  QERFRAVTSAYYRGAVGALVVYDISRRMTFESVGRWLDELKIHSDTTVARMLVGNKCDLE  174

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR VSVEEGK LAE +GLFF+ETSALDSTNV  AFE VI DIY NVSRK LNSD+YK +
Sbjct  175  NIRAVSVEEGKDLAEAQGLFFVETSALDSTNVRIAFEKVILDIYNNVSRKQLNSDTYKDK  234

Query  159  LSVNRVSLANGAD  121
            L+V+RVSL    D
Sbjct  235  LTVSRVSLVKDDD  247



>ref|XP_007034147.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
 gb|EOY05073.1| RAB GTPase A5E isoform 2 [Theobroma cacao]
Length=208

 Score =   286 bits (731),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 174/190 (92%), Gaps = 6/190 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF+ +SKATIGVEFQTQ VE+DGK+VKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLTRYARNEFNAHSKATIGVEFQTQSVEIDGKDVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELN      +ARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAFGALLVYDISRRATFDNVARWLDELN------LARMLVGNKCDLE  123

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V++EEGK LAE EGLFFIETSALDSTNV TAFEIVIR+IY NVSR++LNSDSYKAE
Sbjct  124  NIREVTLEEGKSLAEAEGLFFIETSALDSTNVRTAFEIVIREIYNNVSRRVLNSDSYKAE  183

Query  159  LSVNRVSLAN  130
            L+VNRVSL N
Sbjct  184  LTVNRVSLVN  193



>gb|EEE69027.1| hypothetical protein OsJ_28001 [Oryza sativa Japonica Group]
Length=407

 Score =   292 bits (747),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ ++++GK+VKAQ+WDTAG
Sbjct  12   YLFKVVIIGDSAVGKSNLLSRYARNEFNLHSKATIGVEFQTQSMDINGKDVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R++TF+N+ RWL+ELNTH DTTVA+MLVGNKCDL+
Sbjct  72   QERFRAVTSAYYRGAFGALLVYDISRRSTFDNVGRWLQELNTHSDTTVAKMLVGNKCDLD  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR+V VEEGK LAE EGLFF+ETSALDSTNV TAFEIVI++IY NVSRK+LNSDSYKAE
Sbjct  132  NIREVPVEEGKALAEAEGLFFMETSALDSTNVRTAFEIVIKEIYSNVSRKILNSDSYKAE  191

Query  159  LSVNR  145
            LS+NR
Sbjct  192  LSLNR  196



>gb|KJB28020.1| hypothetical protein B456_005G022300 [Gossypium raimondii]
Length=209

 Score =   285 bits (729),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 178/199 (89%), Gaps = 7/199 (4%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFAR+EF+ +SKATIGVEFQTQ VE+DGKEVKAQ+WDTAG
Sbjct  10   YLFKIVIIGDSAVGKSNLLSRFARNEFNAHSKATIGVEFQTQSVEIDGKEVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GAL+VYDI+R+ TF+N+ RWL+ELN      +A+MLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAFGALLVYDISRRATFDNVARWLDELN------LAKMLVGNKCDLE  123

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            + R+VS++EGK LAE EGLFFIETSALDSTNV TAFEIVIR+IY NVSRK+L+SDSYKA 
Sbjct  124  NTREVSLDEGKSLAESEGLFFIETSALDSTNVWTAFEIVIREIYNNVSRKVLSSDSYKAR  183

Query  159  LSVNRVSLANGADMSKQNK  103
            LSVNRVSL N  ++ KQ+K
Sbjct  184  LSVNRVSLVNDDEL-KQSK  201



>ref|XP_010557057.1| PREDICTED: ras-related protein RABA5d-like [Tarenaya hassleriana]
Length=217

 Score =   283 bits (723),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 177/199 (89%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQT+ +E++GKEVKAQ+ DTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNANSKATIGVEFQTRSMEIEGKEVKAQIGDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+TTFE++ RWL+EL TH DTTV R+LVGNK DLE
Sbjct  71   QERFRAVTSAYYRGAVGALLVYDISRRTTFESVGRWLDELKTHSDTTVVRLLVGNKSDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R VS+EEGK LAE EGLFF+ETSALDSTNV  AFE VIR+IY N+SRK LNSD+YKA+
Sbjct  131  NVRAVSMEEGKALAESEGLFFMETSALDSTNVKRAFERVIREIYDNLSRKQLNSDTYKAK  190

Query  159  LSVNRVSLA-NGADMSKQN  106
            L+V+RVSL  N  D SKQ 
Sbjct  191  LTVDRVSLVKNDKDGSKQG  209



>gb|AAA68983.1| small GTP-binding protein [Brassica napus]
Length=219

 Score =   282 bits (722),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E++GK+VKAQ+WDTAG
Sbjct  11   YLFKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQSMEIEGKDVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R++TFE++ RWL+EL TH DTTVARMLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALVVYDISRRSTFESVARWLDELKTHSDTTVARMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R VSVEEGK LAE +GLFF+ETSAL+STNV TAFE+VIRDIY N SRK LNSD +K E
Sbjct  131  NMRAVSVEEGKALAETQGLFFMETSALNSTNVKTAFEMVIRDIYANFSRKQLNSDMHKTE  190

Query  159  LSVN-RVSL  136
            L  N RVSL
Sbjct  191  LKWNSRVSL  199



>gb|EPS70121.1| hypothetical protein M569_04642, partial [Genlisea aurea]
Length=238

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 171/200 (86%), Gaps = 2/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDS VGKSNLLSR++R+EF+ +SK TIGVEFQTQ ++ DGKEVKAQ+WDTAG
Sbjct  14   YLFKIVIIGDSGVGKSNLLSRYSRNEFNLHSKTTIGVEFQTQSLDFDGKEVKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA GALIVYDITR++TF++I RWL ELNTHCD T  RMLVGNK DL+
Sbjct  74   QERFRAVTSAYYRGAFGALIVYDITRRSTFDSIPRWLNELNTHCDPTTTRMLVGNKSDLD  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRK--LLNSDSYK  166
            +IRDVSVEEG+ LAE E L F+ETSALDSTNVN AFE+VIR+I+  VS +  L NS+SYK
Sbjct  134  NIRDVSVEEGRNLAESERLLFVETSALDSTNVNEAFEVVIREIFDGVSSRMALKNSESYK  193

Query  165  AELSVNRVSLANGADMSKQN  106
            AELS NRVSL   + + K+N
Sbjct  194  AELSGNRVSLVRSSSVPKRN  213



>gb|ABR17569.1| unknown [Picea sitchensis]
Length=217

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 167/200 (84%), Gaps = 3/200 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E DGKE+KAQ+WDTAG
Sbjct  9    YLFKVVLIGDSAVGKSNLLSRYARNEFHMNSKATIGVEFQTQSMEFDGKEIKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE++ RWL+EL  H D  +  MLVGNKCDLE
Sbjct  69   QERFRAVTSAYYRGAVGALVVYDISRRHTFESVGRWLDELKMHSDMNIVTMLVGNKCDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R+V +EE K LAE E LFFIETSAL++TNVN AF+IVI+++Y N+SRK LNSDSYK +
Sbjct  129  TLREVPIEESKALAEAEKLFFIETSALNATNVNDAFQIVIKEVYNNMSRKALNSDSYKPK  188

Query  159  LSVNR---VSLANGADMSKQ  109
            L  NR   VSL    D + +
Sbjct  189  LLSNRSTKVSLVPNGDAATK  208



>gb|ACN40515.1| unknown [Picea sitchensis]
Length=217

 Score =   275 bits (703),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 166/196 (85%), Gaps = 3/196 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF  NSKATIGVEFQTQ +E DGKE+KAQ+WDTAG
Sbjct  9    YLFKVVLIGDSAVGKSNLLSRYARNEFHMNSKATIGVEFQTQSMEFDGKEIKAQIWDTAG  68

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE++ RWL+EL  H D  +  MLVGNKCDLE
Sbjct  69   QERFRAVTSAYYRGAVGALVVYDISRRHTFESVGRWLDELKMHSDMNIVTMLVGNKCDLE  128

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            ++R+V +EE K LAE E LFFIETSAL++TNVN AF+IVI+++Y N+SRK LNSDSYK++
Sbjct  129  TLREVPIEESKALAEAEKLFFIETSALNATNVNDAFQIVIKEVYNNMSRKALNSDSYKSK  188

Query  159  LSVNR---VSLANGAD  121
            L  NR   VSL    D
Sbjct  189  LLSNRSTKVSLVPNGD  204



>gb|KHN12586.1| Ras-related protein RABA5e [Glycine soja]
Length=180

 Score =   263 bits (673),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 157/171 (92%), Gaps = 1/171 (1%)
 Frame = -2

Query  612  NSKATIGVEFQTQVVEVDGKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTT  433
            +SKATIGVEFQTQ +E+D KEVKAQ+WDTAGQERFRAVTSAYYRGAVGALIVYDI+R+TT
Sbjct  2    HSKATIGVEFQTQCLEIDSKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDISRRTT  61

Query  432  FENIKRWLEELNTHCDTTVARMLVGNKCDLESIRDVSVeegkllaeeegLFFIETSALDS  253
            F+++ RWL+EL THCDTTVA MLVGNKCDLE+IR VSV+EGK LAE EGLFF+ETSALDS
Sbjct  62   FDSVGRWLDELKTHCDTTVAMMLVGNKCDLENIRAVSVDEGKSLAEAEGLFFMETSALDS  121

Query  252  TNVNTAFEIVIRDIYKNVSRKLLNSDSYKAELSVNRVSLA-NGADMSKQNK  103
            TNV TAFE+VIR+IY NVSRK+LNS++YKAELSVNRVSL  NGA  SKQN+
Sbjct  122  TNVKTAFEMVIREIYTNVSRKVLNSETYKAELSVNRVSLVNNGASTSKQNQ  172



>ref|XP_008244729.1| PREDICTED: ras-related protein RABA5d [Prunus mume]
Length=178

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/159 (85%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSRFAR+EFD N+KATIGVEF TQ +E+DGK VKAQ+WDTAG
Sbjct  10   YLFKVVLIGDSAVGKSNLLSRFARNEFDPNNKATIGVEFLTQELEIDGKMVKAQIWDTAG  69

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RKTTFE++KRWL+EL THC+TTVARMLVGNKCDLE
Sbjct  70   QERFRAVTSAYYRGAVGALIVYDISRKTTFESVKRWLDELTTHCETTVARMLVGNKCDLE  129

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIV  223
             IRDVSVE+GK LAEEEGLFF+ETSAL++TNV TAFE+V
Sbjct  130  DIRDVSVEDGKSLAEEEGLFFMETSALNATNVQTAFEMV  168



>gb|KHN18294.1| Ras-related protein RABA5d [Glycine soja]
Length=199

 Score =   256 bits (655),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 162/200 (81%), Gaps = 21/200 (11%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+I D AVGKSNLLSR+AR+EF+ +SKATIGVEFQTQ +E+D KEVKAQ+WDTAG
Sbjct  12   YLFKIVIIRDFAVGKSNLLSRYARNEFNMHSKATIGVEFQTQCLEIDSKEVKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+TTF+++ RWL+EL THCD TVA MLVGNKCDLE
Sbjct  72   QERFRAVTSAYYRGAVGALIVYDISRRTTFDSVGRWLDELKTHCDKTVAMMLVGNKCDLE  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            +IR V+++EGK LAE EGLFF+ETS LDSTNV TAFE+                    AE
Sbjct  132  NIRAVNIDEGKSLAEAEGLFFMETSVLDSTNVKTAFEM--------------------AE  171

Query  159  LSVNRVSLA-NGADMSKQNK  103
            LSVNRVSL  NGA  SKQN+
Sbjct  172  LSVNRVSLVNNGASTSKQNQ  191



>ref|XP_002961452.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ36712.1| rab family GTPase [Selaginella moellendorffii]
Length=218

 Score =   255 bits (652),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 163/200 (82%), Gaps = 2/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR++R+EF  NS+ATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRYSRNEFHLNSRATIGVEFQTQSMVIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGA+IVYDI++K TFEN++RWLEEL  + D ++  MLVGNK DLE
Sbjct  71   QERFRAVTSAYYRGAVGAMIVYDISQKQTFENVERWLEELRVYSDFSLVTMLVGNKSDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R VS+EE   LAE EGLFFIETSALDSTNV  AFE VI++I+  VS+K+L+SDS KA 
Sbjct  131  SLRQVSIEEATDLAEREGLFFIETSALDSTNVAAAFETVIKEIFGMVSKKILSSDSSKAR  190

Query  159  L--SVNRVSLANGADMSKQN  106
                  ++ L NG     Q+
Sbjct  191  TLSGTKKLGLENGNSSKPQD  210



>ref|XP_002971361.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ27959.1| rab family GTPase [Selaginella moellendorffii]
Length=218

 Score =   255 bits (651),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 163/200 (82%), Gaps = 2/200 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSR++R+EF  NS+ATIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLSRYSRNEFHLNSRATIGVEFQTQSMVIEGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGA+IVYDI++K TFEN++RWLEEL  + D ++  MLVGNK DLE
Sbjct  71   QERFRAVTSAYYRGAVGAMIVYDISQKQTFENVERWLEELRVYSDFSLVTMLVGNKSDLE  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
            S+R VS+EE   LAE EGLFFIETSALDSTNV  AFE VI++I+  VS+K+L+SDS KA 
Sbjct  131  SLRQVSIEEATDLAEREGLFFIETSALDSTNVAAAFETVIKEIFGMVSKKILSSDSSKAG  190

Query  159  L--SVNRVSLANGADMSKQN  106
                  ++ L NG     Q+
Sbjct  191  TLSGTKKLGLENGNSSKPQD  210



>ref|XP_001780193.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ54952.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=216

 Score =   251 bits (642),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNLNSKATIGVEFQTQSMEIDGKEIKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+RK TF+N+ RWL+EL  H D +V  MLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRKGTFDNVGRWLDELRVHSDASVVVMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
            +IR+VS EE  LLA+ E + FIETSA+D+TNV  AF+ V+++IY+ VS+K L S
Sbjct  131  NIREVSQEEATLLAQNEKMSFIETSAMDATNVTNAFQSVVKEIYRVVSKKPLTS  184



>ref|XP_011095944.1| PREDICTED: ras-related protein RABA5a [Sesamum indicum]
 ref|XP_011095945.1| PREDICTED: ras-related protein RABA5a [Sesamum indicum]
Length=225

 Score =   251 bits (640),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ VE++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVEINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE+I RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFESIGRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYK  166
              R+V+  EGK LAE +GLFFIETSALDS+NV++AFE V+R+IY  +SRK++ S   K
Sbjct  133  DAREVTTAEGKALAEAQGLFFIETSALDSSNVSSAFETVVREIYNILSRKVMQSQELK  190



>ref|XP_001783000.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ52199.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=215

 Score =   250 bits (638),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKEVKAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNSNSKATIGVEFQTQSMEIDGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIV+DITR+ TFEN+ RWL+EL  H D++V  MLVGNK DL 
Sbjct  71   QERFRAVTSAYYRGAVGALIVFDITRRGTFENVSRWLDELKVHSDSSVVVMLVGNKSDLA  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V+VEE   LAE   + F+ETSAL+S NV  AF+ V+++I+K VS+K L +D  K+ 
Sbjct  131  HIREVTVEEATALAENNAMSFMETSALESVNVAEAFQTVLKEIHKIVSKKALTADPNKSN  190

Query  159  LSV-NRVSLANGADMSKQ  109
              V +   LA G D + +
Sbjct  191  TVVASGQRLAGGDDTTPR  208



>ref|XP_001753288.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ81917.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=216

 Score =   249 bits (636),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+ GKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNLNSKATIGVEFQTQSMEIGGKEIKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDI+R+ TFEN+ RWL+EL  H D +V  MLVGNKCDL+
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDISRRGTFENVGRWLDELRVHSDASVVVMLVGNKCDLD  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDS  172
            +IR+VS EE  LLA+ E + FIETSA+D+TNV  AF+ V+++IY+ VS+K L S +
Sbjct  131  NIREVSQEEATLLAQNEKMSFIETSAMDATNVTNAFQSVVKEIYRVVSKKPLASST  186



>ref|XP_002976591.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ22260.1| rab family GTPase [Selaginella moellendorffii]
Length=221

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            Y+FKVV+IGDSAVGKSNLL+R+AR+EF+HNSKATIGVEFQTQ + ++GKEVKAQVWDTAG
Sbjct  12   YIFKVVLIGDSAVGKSNLLTRYARNEFNHNSKATIGVEFQTQSMRINGKEVKAQVWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA+GAL+VYDITRK TFENI +WL+EL T+  ++V  MLVGNKCDL 
Sbjct  72   QERFRAVTSAYYRGALGALVVYDITRKQTFENISKWLDELRTYGGSSVVTMLVGNKCDLT  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSD  175
             IR+VSVEEGK LAE E LFF+ETSAL STNV TAF+ V+R+I+   SR+++  D
Sbjct  132  DIREVSVEEGKELAESENLFFMETSALASTNVKTAFQNVVREIFDAKSRRIVPDD  186



>ref|XP_010494988.1| PREDICTED: ras-related protein RABA5a-like [Camelina sativa]
 ref|XP_010494989.1| PREDICTED: ras-related protein RABA5a-like [Camelina sativa]
Length=221

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  VA +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVATILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             +R+VS  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DLREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_010688595.1| PREDICTED: ras-related protein RABA5a [Beta vulgaris subsp. vulgaris]
Length=226

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  14   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  73

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+V+DI+R+ TF+NI RWL EL+TH D  V  +LVGNK DL+
Sbjct  74   QERFRAVTSAYYRGAVGALLVFDISRRQTFDNIGRWLNELHTHSDMNVVTILVGNKSDLK  133

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFFIETSALDS+NV  AF+ V+R+IY  +SRK++ S   K  
Sbjct  134  DAREVSTAEGKALAEAQGLFFIETSALDSSNVAAAFQTVVREIYTILSRKVMQSHELKKN  193

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  194  ---DSSSLSNG  201



>emb|CDY25963.1| BnaC09g20240D [Brassica napus]
Length=219

 Score =   247 bits (630),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+RK TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRKQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>gb|ABD64975.1| Ras family GTP-binding protein [Brassica oleracea]
 emb|CDX77774.1| BnaC07g20280D [Brassica napus]
Length=221

 Score =   246 bits (629),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRQQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  GIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_009101412.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
 ref|XP_009101414.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
Length=222

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRQQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>emb|CDP04500.1| unnamed protein product [Coffea canephora]
Length=225

 Score =   246 bits (628),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ VE++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVEINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVSTAEGKALAEAQGLFFIETSALDSSNVAAAFQTVVKEIYNILSRKVIQSQELKQK  192

Query  159  LSVNRVSLANG  127
               +  S+ NG
Sbjct  193  ---DPSSIGNG  200



>emb|CDY17729.1| BnaA06g35480D [Brassica napus]
Length=221

 Score =   246 bits (628),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRQQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_009114272.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114273.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114274.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 ref|XP_009114275.1| PREDICTED: ras-related protein RABA5a [Brassica rapa]
 emb|CDY41053.1| BnaA09g18320D [Brassica napus]
Length=222

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+RK TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRKQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
                  SL+NG
Sbjct  193  DP--PASLSNG  201



>ref|XP_004250277.1| PREDICTED: ras-related protein RABA5a [Solanum lycopersicum]
Length=225

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFENI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRLTFENIGRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKSLAEAQGLFFIETSALDSSNVTAAFQTVVKEIYNILSRKVMQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>ref|XP_001772977.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ62202.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=215

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLLSR+AR+EF+ NSKATIGVEFQTQ +E+DGKE+KAQ+WDTAG
Sbjct  11   YLFKVVLIGDSAVGKSNLLSRYARNEFNSNSKATIGVEFQTQSMEIDGKELKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGALIVYDITR+ TFEN+ RW +EL  H D  V  MLVGNK DL 
Sbjct  71   QERFRAVTSAYYRGAVGALIVYDITRRGTFENVSRWFDELKVHSDANVVVMLVGNKSDLA  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V+ EE   LAE+  ++F+ETSAL++ NV  AF+ V+++I+K VS+K L +D  K  
Sbjct  131  HIREVTAEEATALAEKNTMYFMETSALEAVNVVEAFQTVLKEIHKIVSKKALTADPNKGN  190

Query  159  LSVNRVSLANGAD  121
              V       G+D
Sbjct  191  TVVASGQRLAGSD  203



>ref|XP_006398449.1| hypothetical protein EUTSA_v10001017mg [Eutrema salsugineum]
 gb|ESQ39902.1| hypothetical protein EUTSA_v10001017mg [Eutrema salsugineum]
Length=221

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_010441443.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010441444.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010441445.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
 ref|XP_010481311.1| PREDICTED: ras-related protein RABA5a [Camelina sativa]
Length=221

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             +R+VS  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DLREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_002973313.1| rab family GTPase [Selaginella moellendorffii]
 gb|EFJ25687.1| rab family GTPase [Selaginella moellendorffii]
Length=221

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            Y+FKVV+IGDSAVGKSNLL+R+AR+EF+ NSKATIGVEFQTQ + ++GKEVKAQVWDTAG
Sbjct  12   YIFKVVLIGDSAVGKSNLLTRYARNEFNQNSKATIGVEFQTQSMRINGKEVKAQVWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGA+GAL+VYDITRK TFENI +WL+EL T+  ++V  MLVGNKCDL 
Sbjct  72   QERFRAVTSAYYRGALGALVVYDITRKQTFENISKWLDELRTYGGSSVVTMLVGNKCDLT  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSD  175
            +IR+VSVEEGK LAE E LFF+ETSAL STNV TAF+ V+R+I+   SR+++  D
Sbjct  132  NIREVSVEEGKELAESENLFFMETSALASTNVKTAFQNVVREIFDAKSRRIVPDD  186



>ref|XP_002863339.1| hypothetical protein ARALYDRAFT_494220 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006281067.1| hypothetical protein CARUB_v10027090mg [Capsella rubella]
 gb|EFH39598.1| hypothetical protein ARALYDRAFT_494220 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA13965.1| hypothetical protein CARUB_v10027090mg [Capsella rubella]
Length=221

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             +R+VS  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DLREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_010530048.1| PREDICTED: ras-related protein RABA5a [Tarenaya hassleriana]
 ref|XP_010530049.1| PREDICTED: ras-related protein RABA5a [Tarenaya hassleriana]
Length=224

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             +R+VS  EGK LAE +GLFF+ETSALDS+NV  AFE V+R+IY  +SRK+++ +  K +
Sbjct  133  EVREVSTGEGKALAEAQGLFFMETSALDSSNVTAAFETVVREIYNILSRKVISQELNKQD  192

Query  159  LSVNRVSLANG  127
             +    SL+NG
Sbjct  193  PA----SLSNG  199



>ref|NP_199563.1| RAB GTPase homolog A5A [Arabidopsis thaliana]
 sp|Q9FGK5.1|RAA5A_ARATH RecName: Full=Ras-related protein RABA5a; Short=AtRABA5a [Arabidopsis 
thaliana]
 dbj|BAB09078.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAO44075.1| At5g47520 [Arabidopsis thaliana]
 dbj|BAD95258.1| GTP-binding protein-like [Arabidopsis thaliana]
 dbj|BAE99754.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AED95528.1| RAB GTPase homolog A5A [Arabidopsis thaliana]
Length=221

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             +R+VS  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DLREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_010655425.1| PREDICTED: ras-related protein RABA5a [Vitis vinifera]
Length=225

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 158/191 (83%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFF+ETSALDS+NV+ AF+ V+R+IY  +SRK++ S   +  
Sbjct  133  DAREVTTAEGKALAEAQGLFFMETSALDSSNVSAAFQTVVREIYNILSRKVMQSQELRKH  192

Query  159  LSVNRVSLANG  127
               + VSL NG
Sbjct  193  ---DTVSLGNG  200



>ref|XP_006352344.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352345.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Solanum 
tuberosum]
Length=225

 Score =   244 bits (624),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFENI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRLTFENIGRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKSLAEAQGLFFIETSALDSSNVAVAFQTVVKEIYNILSRKVMQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>gb|ABD64936.1| Ras-related GTP-binding protein, putative [Brassica oleracea]
Length=219

 Score =   244 bits (622),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+RK TF +I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRKQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSA DS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTAEGKALAEAQGLFFMETSARDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_006365849.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006365850.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Solanum 
tuberosum]
Length=226

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKININGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+NI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRLTFDNIGRWLNELQTHSDMNVVIILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV +AF+ V+R+IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKALAEAKGLFFIETSALDSSNVTSAFQTVVREIYNILSRKVIQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>ref|XP_004239823.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321395.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321396.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
 ref|XP_010321397.1| PREDICTED: ras-related protein RABA5a-like [Solanum lycopersicum]
Length=226

 Score =   244 bits (622),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKININGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+NI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRLTFDNIDRWLNELQTHSDMNVVIILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV +AF+ V+R+IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKALAEAKGLFFIETSALDSSNVTSAFQTVVREIYNILSRKVIQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>ref|XP_009776623.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776624.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776625.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009776626.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
Length=225

 Score =   243 bits (621),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRPTFDSIGRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV +AF+ V+R+IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKALAEAKGLFFIETSALDSSNVASAFQTVVREIYNILSRKVIQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>ref|XP_009625286.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana tomentosiformis]
 ref|XP_009625287.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana tomentosiformis]
Length=225

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+NI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDNISRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKSLAEAQGLFFIETSALDSSNVAVAFQTVVKEIYNILSRKVIQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>ref|XP_009775501.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
 ref|XP_009775503.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris]
Length=225

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+NI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDNISRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   + +
Sbjct  133  DAREVTTAEGKSLAEAQGLFFIETSALDSSNVAVAFQTVVKEIYNILSRKVIQSQELQKK  192

Query  159  LSVNRVSLANG  127
             S     LANG
Sbjct  193  DSGR---LANG  200



>gb|EYU27682.1| hypothetical protein MIMGU_mgv1a013213mg [Erythranthe guttata]
Length=227

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE+I RWL EL+TH D  V  +LVGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFESIGRWLNELHTHSDMNVVTILVGNKTDLR  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYK  166
              R+V V EGK LAE +GLFFIETSALDS+NV  AF+ V+R+I+  +S+K++ S   K
Sbjct  133  DAREVRVSEGKALAEAQGLFFIETSALDSSNVGVAFQTVVREIFNILSKKVIQSQELK  190



>ref|XP_011086244.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086245.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086246.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086247.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
 ref|XP_011086248.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Sesamum 
indicum]
Length=222

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGD+AVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E+ GKEVKAQ+WDTAG
Sbjct  13   YLFKIVMIGDAAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEISGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TFE   RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFEGTGRWLNELQTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+  EGK LAE +GLFFIETSALDS+NV+ AF+ V+++IY  +SRK++ S     E
Sbjct  133  DAREVTTAEGKALAEAQGLFFIETSALDSSNVSAAFQTVVKEIYNILSRKVMQSQ----E  188

Query  159  LSVNRVSLANG  127
            L+V      NG
Sbjct  189  LTVENPPDLNG  199



>ref|XP_009128976.1| PREDICTED: ras-related protein RABA5a-like [Brassica rapa]
Length=221

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIVINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRVQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>gb|ADE77345.1| unknown [Picea sitchensis]
Length=223

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+R+AR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARYARNEFYPNSKSTIGVEFQTQTMQIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+NI RWL+EL+TH D  V  ++VGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDISRRQTFDNISRWLDELHTHSDMNVVTVIVGNKTDLL  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS EEG  LAE + ++F+ETSALDSTNV  AF+ V+++IY  +SRK+L+    K E
Sbjct  133  DAREVSTEEGAALAEAQNIYFVETSALDSTNVQLAFQTVVKEIYNILSRKVLSCQEQKLE  192

Query  159  LSVN  148
              ++
Sbjct  193  SKIS  196



>gb|ABD65003.1| Ras-related GTP-binding protein, putative [Brassica oleracea]
 emb|CDY40561.1| BnaC02g33310D [Brassica napus]
Length=221

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIVINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRVQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK++ S     +
Sbjct  133  DIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMTSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_004139534.1| PREDICTED: ras-related protein RABA5a-like [Cucumis sativus]
 ref|XP_004163459.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA5a-like 
[Cucumis sativus]
 gb|KGN65039.1| hypothetical protein Csa_1G181510 [Cucumis sativus]
Length=224

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIEINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTAEGKSLAEAQGLFFIETSALDSSNVTNAFQTVVKEIYNILSRKVMISQELKKQ  192



>ref|XP_008384161.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_008384162.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_008349326.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
 ref|XP_009374877.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009374878.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344960.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344961.1| PREDICTED: ras-related protein RABA5a isoform X1 [Pyrus x bretschneideri]
Length=225

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFF+ETSALDS+NV+ AF++V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTSEGKALAEAQGLFFMETSALDSSNVSAAFQMVVKEIYNILSRKVMISQELKKQ  192



>ref|XP_008345797.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Malus 
domestica]
 ref|XP_008355913.1| PREDICTED: ras-related protein RABA5a isoform X1 [Malus domestica]
Length=225

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V+++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRHQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFF+ETSALDS+NV+ AF++V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTSEGKALAEAQGLFFMETSALDSSNVSAAFQMVVKEIYNILSRKVMISQELKKQ  192



>ref|XP_009350510.1| PREDICTED: ras-related protein RABA5a-like [Pyrus x bretschneideri]
Length=225

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V+++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRHQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFF+ETSALDS+NV+ AF++V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTSEGKALAEAQGLFFMETSALDSSNVSAAFQMVVKEIYNILSRKVMISQELKKQ  192



>ref|XP_008463615.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA5a [Cucumis 
melo]
Length=223

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFFIETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTAEGKSLAEAQGLFFIETSALDSSNVTNAFQTVVKEIYNILSRKVMISQELKKQ  192



>gb|EYU33848.1| hypothetical protein MIMGU_mgv1a012931mg [Erythranthe guttata]
Length=235

 Score =   241 bits (616),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLLSRFARDEF  NSK+TIGVEFQTQ +++ GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLSRFARDEFYPNSKSTIGVEFQTQKIKISGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TFENI RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALMVYDISRHETFENIGRWLNELRTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V+  EGK LAE EGLFFIETSALDS+NV+ AF+ V+ +IY  +SRK++ S
Sbjct  133  DAREVTTGEGKELAEAEGLFFIETSALDSSNVSAAFQTVVGEIYNILSRKVMQS  186



>ref|XP_008792135.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008792136.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008792137.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
Length=223

 Score =   241 bits (615),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 158/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGD+AVGKSNLL+R+AR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  12   YLFKIVLIGDAAVGKSNLLARYARNEFHPNSKSTIGVEFQTQKMDIDGKEIKAQIWDTAG  71

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL TH D  V  +LVGNK DL+
Sbjct  72   QERFRAVTSAYYRGAVGALVVYDISRRQTFDSVGRWLNELQTHSDMNVVTILVGNKTDLK  131

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKL-LNSDSYKA  163
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+ L+ D  K 
Sbjct  132  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKMHLSQDLKKP  191

Query  162  ELSVNRVSLANG  127
            ++S    SL NG
Sbjct  192  DMS----SLGNG  199



>emb|CAA82710.1| guanine nucleotide regulatory protein [Vicia faba]
 prf||2115367D small GTP-binding protein
Length=223

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFF+ETSALDS+NV +AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTPEGKALAEAQGLFFMETSALDSSNVVSAFQTVVKEIYNILSRKVMMSQELKKQ  192



>emb|CDY28925.1| BnaA02g25510D [Brassica napus]
Length=221

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQT+ + ++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTKKIVINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRVQTFQSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
             IR+V   EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK+++S     +
Sbjct  133  DIREVPTSEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMSSQELNKQ  192

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  193  ---DPASLSNG  200



>ref|XP_009402895.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402897.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402898.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402899.1| PREDICTED: ras-related protein RABA5a-like [Musa acuminata subsp. 
malaccensis]
Length=220

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 154/191 (81%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVMIGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKMQIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDICRRQTFDSIGRWLNELHTHSDMNVVIILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFFIETSALD +NV  AF+ ++++IY  +SRK+  S   K E
Sbjct  133  DAREVGTAEGKALAEAQGLFFIETSALDDSNVAAAFQTLVKEIYHILSRKVFQSQEQKKE  192

Query  159  LSVNRVSLANG  127
            LS    SL +G
Sbjct  193  LS----SLGSG  199



>ref|XP_010265418.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265419.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265420.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265421.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265422.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265423.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265424.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
 ref|XP_010265425.1| PREDICTED: ras-related protein RABA5a [Nelumbo nucifera]
Length=224

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +++DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +L+GNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILIGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V  EEGK LAE +GLFF+ETSALDS+NV  AF  V+++IY  +SRK++     KA+
Sbjct  133  DAREVKTEEGKALAEAQGLFFMETSALDSSNVTAAFRTVVKEIYNILSRKVILCQEKKAD  192

Query  159  LSVNRVSLANG  127
             +    SL NG
Sbjct  193  TA----SLGNG  199



>gb|KHF97840.1| Ras-related protein RABA5a [Gossypium arboreum]
Length=224

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVHIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVVTILVGNKSDLR  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+VS+ EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +S+K++ S
Sbjct  133  DAREVSIAEGKSLAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSKKVMMS  186



>gb|KEH42936.1| RAB GTPase-like protein C2B [Medicago truncatula]
Length=224

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYK  166
              R+V   EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K
Sbjct  133  DAREVPTTEGKALAEAQGLFFMETSALDSSNVVAAFQTVVKEIYNILSRKVMMSQELK  190



>gb|KJB69168.1| hypothetical protein B456_011G009000 [Gossypium raimondii]
Length=224

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 148/174 (85%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ V +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKVHLDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVVTILVGNKSDLR  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+VS+ EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +S+K++ S
Sbjct  133  DAREVSIAEGKSLAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSKKVMMS  186



>ref|XP_007143969.1| hypothetical protein PHAVU_007G117800g [Phaseolus vulgaris]
 gb|ESW15963.1| hypothetical protein PHAVU_007G117800g [Phaseolus vulgaris]
Length=228

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK++ S
Sbjct  133  DAREVATAEGKSLAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMMS  186



>ref|XP_007026285.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 ref|XP_007026287.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 gb|EOY28907.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
 gb|EOY28909.1| RAB GTPase A5A isoform 1 [Theobroma cacao]
Length=224

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLR  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMISHELKKQ  192

Query  159  -LSVNRVSLANGADMSKQN  106
              S+N  ++    D ++Q+
Sbjct  193  DASLNGKTVVLHGDETQQS  211



>ref|XP_006605347.1| PREDICTED: uncharacterized protein LOC100789187 isoform X1 [Glycine 
max]
 gb|KHN04985.1| Ras-related protein RABA5a [Glycine soja]
Length=226

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK++ S
Sbjct  133  DAREVATAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMMS  186



>ref|XP_004495529.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Cicer 
arietinum]
 ref|XP_004495530.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Cicer 
arietinum]
 ref|XP_004495531.1| PREDICTED: ras-related protein RABA5a-like isoform X3 [Cicer 
arietinum]
 ref|XP_004495532.1| PREDICTED: ras-related protein RABA5a-like isoform X4 [Cicer 
arietinum]
 ref|XP_004495533.1| PREDICTED: ras-related protein RABA5a-like isoform X5 [Cicer 
arietinum]
Length=225

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ +E++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMEINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V   EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S
Sbjct  133  DAREVPTTEGKALAEAQGLFFMETSALDSSNVVAAFQTVVKEIYNILSRKVMMS  186



>ref|XP_002528238.1| protein with unknown function [Ricinus communis]
 gb|EEF34153.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 157/191 (82%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ +WL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGKWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE + LFF+ETSALDS+NV  AF+ V+R+IY  +SRK+++++  K +
Sbjct  133  DAREVSTAEGKALAETQDLFFMETSALDSSNVTAAFQTVVREIYNILSRKVMSNEFNKQD  192

Query  159  LSVNRVSLANG  127
              +    + NG
Sbjct  193  APL----MGNG  199



>gb|KJB67359.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67360.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67361.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67362.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67363.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67364.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67365.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67366.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67367.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67368.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67369.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67370.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67371.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
 gb|KJB67372.1| hypothetical protein B456_010G188100 [Gossypium raimondii]
Length=224

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVITILVGNKSDLQ  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMMSHELKKQ  192



>ref|XP_004293379.1| PREDICTED: ras-related protein RABA5a [Fragaria vesca subsp. 
vesca]
Length=226

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARNEFFPNSKSTIGVEFQTQKIVIDGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R  TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRHQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMMSQELKKQ  192



>ref|XP_010052941.1| PREDICTED: ras-related protein RABA5a-like [Eucalyptus grandis]
 gb|KCW77088.1| hypothetical protein EUGRSUZ_D01430 [Eucalyptus grandis]
Length=225

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V+V E K LAE +GLFF+ETSALDS+NV  AF  V+ +IY+ +SRK++ S   K +
Sbjct  133  DAREVTVAEAKALAEAQGLFFMETSALDSSNVVAAFRTVVEEIYRILSRKVMASQELKKQ  192

Query  159  LSVNRVSLANG  127
               + + + NG
Sbjct  193  ---DPIWIGNG  200



>ref|XP_006449885.1| hypothetical protein CICLE_v10017675mg [Citrus clementina]
 ref|XP_006467317.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467318.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467319.1| PREDICTED: ras-related protein RABA5a-like isoform X3 [Citrus 
sinensis]
 ref|XP_006467320.1| PREDICTED: ras-related protein RABA5a-like isoform X4 [Citrus 
sinensis]
 ref|XP_006467321.1| PREDICTED: ras-related protein RABA5a-like isoform X5 [Citrus 
sinensis]
 gb|ESR63125.1| hypothetical protein CICLE_v10017675mg [Citrus clementina]
 gb|KDO78478.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
 gb|KDO78479.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
 gb|KDO78480.1| hypothetical protein CISIN_1g027438mg [Citrus sinensis]
Length=223

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFKVV+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKVVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYK  166
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AF+ V+ +IY  +SRK++ S   K
Sbjct  133  DAREVTTAEGKALAEAQGLFFMETSALDSSNVTAAFQTVVTEIYNILSRKVMISQELK  190



>ref|XP_004958435.1| PREDICTED: ras-related protein RABA5a-like [Setaria italica]
Length=222

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYK-A  163
              R+VS  EG+ LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+  S   K +
Sbjct  133  HAREVSTAEGQALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYSILSRKVFQSQEQKRS  192

Query  162  ELSVNRVSLANG  127
            EL     SL+NG
Sbjct  193  ELQ----SLSNG  200



>ref|XP_006443137.1| hypothetical protein CICLE_v10022137mg [Citrus clementina]
 gb|ESR56377.1| hypothetical protein CICLE_v10022137mg [Citrus clementina]
Length=165

 Score =   237 bits (604),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = -2

Query  570  VEVDGKEVKAQVWDTAGQERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTH  391
            +E+DGKEVKAQ+WDTAGQERFRAVTSAYYRGAVGALIVYDITR+TTF++I RWL+EL TH
Sbjct  1    MEIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDITRRTTFDSISRWLDELKTH  60

Query  390  CDTTVARMLVGNKCDLESIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDI  211
             DTTVARMLVGNKCDLESIR+VS EEGK LAE EGLFF+ETSALDSTNV +AFEIVIR+I
Sbjct  61   SDTTVARMLVGNKCDLESIRNVSTEEGKSLAEAEGLFFMETSALDSTNVKSAFEIVIREI  120

Query  210  YKNVSRKLLNSDSYKAELSVNRVSLANG-ADMSKQ  109
            Y NVSRK+LNSDSYKAELS+NRV+L     D SKQ
Sbjct  121  YSNVSRKVLNSDSYKAELSLNRVTLVKSETDGSKQ  155



>ref|XP_003536164.1| PREDICTED: ras-related protein RABA5a-like isoform X1 [Glycine 
max]
 ref|XP_006589228.1| PREDICTED: ras-related protein RABA5a-like isoform X2 [Glycine 
max]
 gb|KHN14769.1| Ras-related protein RABA5a [Glycine soja]
Length=223

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK++ S
Sbjct  133  DAREVATAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMIS  186



>emb|CAA98186.1| RAB11J [Lotus japonicus]
Length=223

 Score =   239 bits (609),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKIDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALVVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S
Sbjct  133  DAREVTTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMMS  186



>ref|XP_010094689.1| Ras-related protein RABA5a [Morus notabilis]
 gb|EXB56661.1| Ras-related protein RABA5a [Morus notabilis]
Length=224

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QER RAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERVRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV TAF+ V+++IY  +SRK++ S     E
Sbjct  133  DAREVSTAEGKALAEAQGLFFMETSALDSSNVATAFQTVVKEIYNILSRKVMISQ----E  188

Query  159  LSVNRVSLANG  127
            L  +   + NG
Sbjct  189  LKKDPTWMGNG  199



>dbj|BAJ99159.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 157/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLLGDSSVGKSNLLARFARNEFFPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDITR+ TF+++ RWL EL+ H D  V  +L+GNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDITRRQTFDSVGRWLNELHAHSDMNVVTILIGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS-DSYKA  163
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+  S +  K+
Sbjct  133  HAREVSPAEGKALAEAQGLFFMETSALDSSNVTAAFQTVVKEIYSILSRKVFQSQEQKKS  192

Query  162  ELSVNRVSLANG  127
            EL     SL+NG
Sbjct  193  ELQ----SLSNG  200



>ref|XP_002461085.1| hypothetical protein SORBIDRAFT_02g040430 [Sorghum bicolor]
 gb|EER97606.1| hypothetical protein SORBIDRAFT_02g040430 [Sorghum bicolor]
Length=222

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 158/192 (82%), Gaps = 5/192 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS-DSYKA  163
              R+VS  EG+ LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+  S +  K+
Sbjct  133  HAREVSTAEGQALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYSILSRKVFQSLEQKKS  192

Query  162  ELSVNRVSLANG  127
            EL     SL+NG
Sbjct  193  ELQ----SLSNG  200



>ref|XP_007211991.1| hypothetical protein PRUPE_ppa011035mg [Prunus persica]
 gb|EMJ13190.1| hypothetical protein PRUPE_ppa011035mg [Prunus persica]
Length=226

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +L+GNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILIGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+V   EGK LAE +GLFF+ETSALDS+NV  AF++V+++IY  +SRK++ S   K +
Sbjct  133  DAREVPTSEGKALAEAQGLFFMETSALDSSNVVAAFQMVVKEIYNILSRKVMISQELKKQ  192



>gb|EPS57442.1| hypothetical protein M569_17375 [Genlisea aurea]
Length=229

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 162/205 (79%), Gaps = 7/205 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ V + GKEVKAQ+WDTAG
Sbjct  11   YLFKIVLIGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKVMIKGKEVKAQIWDTAG  70

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYD+TR+ TF+++ RWL+EL+TH D  V  +LVGNK DL+
Sbjct  71   QERFRAVTSAYYRGAVGALLVYDVTRRKTFDSVARWLDELHTHSDMNVVTILVGNKSDLK  130

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLL-------N  181
              R+V+  EGK LAE+ GLFFIETSALDS+NV  AF+ V+R+IY+ +SRK++       N
Sbjct  131  GSREVATSEGKSLAEDRGLFFIETSALDSSNVGAAFQTVVREIYEILSRKVIQSRELVNN  190

Query  180  SDSYKAELSVNRVSLANGADMSKQN  106
             D ++  +   + ++    D+ K+N
Sbjct  191  KDHHQRWIGEGKTTVIFKGDVDKRN  215



>ref|NP_001242668.1| uncharacterized protein LOC100789187 [Glycine max]
 gb|ACU21000.1| unknown [Glycine max]
Length=226

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 149/174 (86%), Gaps = 0/174 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNS  178
              R V+  EGK LAE +GLFF+ETSALDS+NV  AFE V+++IY  +SRK++ S
Sbjct  133  DARKVATAEGKALAEAQGLFFMETSALDSSNVAAAFETVVKEIYNILSRKVMMS  186



>gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossypium hirsutum]
 gb|KHG02326.1| Ras-related protein RABA5a [Gossypium arboreum]
 gb|KHG02327.1| Ras-related protein RABA5a [Gossypium arboreum]
Length=224

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDSAVGKSNLL+RFAR+EF  NSK+TIGVEFQTQ ++++GKEVKAQ+WDTAG
Sbjct  13   YLFKIVLVGDSAVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLDINGKEVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL TH D  V  +LVGNK DL 
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELQTHSDMNVVTILVGNKSDLR  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  133  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMMSHELKKQ  192



>ref|XP_007026286.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 ref|XP_007026288.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 gb|EOY28908.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
 gb|EOY28910.1| RAB GTPase A5A isoform 2 [Theobroma cacao]
Length=245

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGDSAVGKSNLL+RFARDEF  NSK+TIGVEFQTQ ++++GKE+KAQ+WDTAG
Sbjct  34   YLFKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAG  93

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF++I RWL EL+TH D  V  +LVGNK DL 
Sbjct  94   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSIGRWLNELHTHSDMNVVTILVGNKSDLR  153

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK++ S   K +
Sbjct  154  DAREVSTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKVMISHELKKQ  213

Query  159  -LSVNRVSLANGADMSKQN  106
              S+N  ++    D ++Q+
Sbjct  214  DASLNGKTVVLHGDETQQS  232



>ref|XP_006658004.1| PREDICTED: ras-related protein RABA5a-like [Oryza brachyantha]
Length=221

 Score =   238 bits (606),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 158/198 (80%), Gaps = 4/198 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+  S   K  
Sbjct  133  HAREVSTAEGKALAEAQGLFFMETSALDSSNVTEAFQTVVKEIYSILSRKVFQSQEQKR-  191

Query  159  LSVNRVSLANGADMSKQN  106
               +  SL+NG  +  Q+
Sbjct  192  ---SEQSLSNGKPVMLQS  206



>ref|XP_008785540.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785548.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785557.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785563.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785572.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785580.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
 ref|XP_008785589.1| PREDICTED: ras-related protein RABA5a-like [Phoenix dactylifera]
Length=223

 Score =   237 bits (604),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 156/192 (81%), Gaps = 5/192 (3%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V+IGD+AVGKSNLL+R+AR+EF  NSK+TIGVEFQTQ +++DGK VKAQ+WDTAG
Sbjct  13   YLFKIVLIGDAAVGKSNLLARYARNEFYPNSKSTIGVEFQTQKMDIDGKAVKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELQTHSDMNVVTILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKL-LNSDSYKA  163
              R+V+  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+ L+ D  K 
Sbjct  133  DAREVTTAEGKALAEAQGLFFMETSALDSSNVAAAFQTVVKEIYNILSRKMHLSQDQKKP  192

Query  162  ELSVNRVSLANG  127
             +S    SL NG
Sbjct  193  NMS----SLGNG  200



>ref|NP_001060379.1| Os07g0634200 [Oryza sativa Japonica Group]
 dbj|BAC07118.1| putative Rab GTP-binding protein Rab11a [Oryza sativa Japonica 
Group]
 dbj|BAF22293.1| Os07g0634200 [Oryza sativa Japonica Group]
 dbj|BAG95580.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82512.1| hypothetical protein OsI_26999 [Oryza sativa Indica Group]
Length=220

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 155/191 (81%), Gaps = 4/191 (2%)
 Frame = -2

Query  699  YLFKVVVIGDSAVGKSNLLSRFARDEFDHNSKATIGVEFQTQVVEVDGKEVKAQVWDTAG  520
            YLFK+V++GDS+VGKSNLL+RFAR+EF  NSK+TIGVEFQTQ + +DGKE+KAQ+WDTAG
Sbjct  13   YLFKIVLLGDSSVGKSNLLARFARNEFYPNSKSTIGVEFQTQKLVIDGKEIKAQIWDTAG  72

Query  519  QERFRAVTSAYYRGAVGALIVYDITRKTTFENIKRWLEELNTHCDTTVARMLVGNKCDLE  340
            QERFRAVTSAYYRGAVGAL+VYDI+R+ TF+++ RWL EL+TH D  V  +LVGNK DL+
Sbjct  73   QERFRAVTSAYYRGAVGALLVYDISRRQTFDSVGRWLNELHTHSDMNVVTILVGNKTDLK  132

Query  339  SIRDVSVeegkllaeeegLFFIETSALDSTNVNTAFEIVIRDIYKNVSRKLLNSDSYKAE  160
              R+VS  EGK LAE +GLFF+ETSALDS+NV  AF+ V+++IY  +SRK+  S   K  
Sbjct  133  HAREVSTAEGKALAESQGLFFMETSALDSSNVAEAFQTVVKEIYGILSRKVFQSQEQKR-  191

Query  159  LSVNRVSLANG  127
               +  SL+NG
Sbjct  192  ---SEQSLSNG  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630