BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013C02

Length=782
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAA87043.1|  N-hydroxycinnamoyl/benzoyltransferase                  444   1e-152   Ipomoea batatas [batate]
emb|CAT00081.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    369   5e-123   Coffea arabica [arabica coffee]
gb|ABO77956.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    369   7e-123   Coffea canephora [robusta coffee]
gb|AFP49814.1|  caffeoyl-CoA quinic acid caffeoyl transferase 4         369   8e-123   Coffea arabica [arabica coffee]
gb|ABO77957.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    369   1e-122   Coffea canephora [robusta coffee]
emb|CDP02827.1|  unnamed protein product                                369   5e-122   Coffea canephora [robusta coffee]
ref|XP_009800587.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    367   6e-122   Nicotiana sylvestris
ref|XP_009624297.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    363   2e-120   Nicotiana tomentosiformis
emb|CAE46932.1|  hydroxycinnamoyl CoA quinate transferase               363   2e-120   Nicotiana tabacum [American tobacco]
ref|XP_009614241.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    358   1e-118   Nicotiana tomentosiformis
ref|NP_001234850.1|  hydroxycinnamoyl CoA quinate transferase           355   1e-117   
ref|XP_009798536.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    355   2e-117   Nicotiana sylvestris
ref|XP_006343633.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    353   9e-117   Solanum tuberosum [potatoes]
ref|NP_001275483.1|  HQT                                                347   2e-114   Solanum tuberosum [potatoes]
gb|ABA46756.1|  hydroxycinnamoyl-CoA quinate-like protein               343   7e-113   Solanum tuberosum [potatoes]
gb|AGE10614.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    326   4e-109   Lonicera macranthoides
gb|ACJ23164.1|  hydroxycinnamoyl CoA quinate transferase 2              329   4e-107   Cynara cardunculus var. scolymus [artichoke]
gb|ACZ52698.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyltran...    329   5e-107   Lonicera japonica [Japanese honeysuckle]
gb|AEK80405.1|  HQT                                                     329   5e-107   Lonicera japonica [Japanese honeysuckle]
gb|ABK79689.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    327   1e-106   Cynara cardunculus var. scolymus [artichoke]
emb|CAR92145.1|  hydroxycinnamoyl CoA quinate transferase 2             328   1e-106   Cynara cardunculus var. scolymus [artichoke]
gb|ADL62854.1|  hydroxycinnamoyl-CoA transferase 1                      327   3e-106   Cynara cardunculus var. scolymus [artichoke]
gb|AEM63676.1|  hydroxycinnamoyl CoA quinate hydroxycinnamoyl tra...    326   7e-106   Platycodon grandiflorus [balloon-flower]
gb|AFL93687.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-tra...    325   7e-106   Cynara cardunculus var. scolymus [artichoke]
gb|ACF37072.1|  hydroxycinnamoyl CoA quinate transferase 1              325   1e-105   Cynara cardunculus var. scolymus [artichoke]
gb|AGE10604.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    318   5e-105   Lonicera hypoglauca
gb|ABK79690.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    323   1e-104   Cynara cardunculus var. altilis [cultivated cardoon]
gb|ADL62855.1|  hydroxycinnamoyl-CoA transferase 2                      322   2e-104   Cynara cardunculus var. scolymus [artichoke]
gb|AGE10615.1|  hydroxycinnamoyl-CoA quinate hydroxycinnamoyl tra...    317   2e-104   Lonicera macranthoides
ref|XP_002512739.1|  Anthranilate N-benzoyltransferase protein, p...    286   2e-90    Ricinus communis
gb|AFN85668.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    285   3e-90    Hibiscus cannabinus [bimli-jute]
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    285   4e-90    Nelumbo nucifera [Indian lotus]
gb|AID69225.1|  hydroxycinnamoyl coenzyme A shikimate hydroxycinn...    283   5e-90    Garcinia mangostana [mangosteen]
ref|XP_002303858.2|  hypothetical protein POPTR_0003s18210g             281   6e-90    
ref|XP_011018045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    285   6e-90    Populus euphratica
ref|XP_002324534.1|  hypothetical protein POPTR_0018s11450g             285   6e-90    
ref|XP_011018044.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    285   6e-90    Populus euphratica
gb|AEN02914.1|  HCT1                                                    279   1e-89    Populus nigra [black poplar]
ref|XP_011020577.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    283   2e-89    Populus euphratica
gb|AFR67331.1|  hydroxycinnamoyl CoA shikimate hydroxycinnamoyl t...    278   3e-89    Leucaena leucocephala [cassie]
gb|ACC63882.1|  quinate O-hydroxycinnamoyltransferase/shikimate O...    281   9e-89    Populus trichocarpa [western balsam poplar]
dbj|BAJ14794.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    280   3e-88    Ipomoea batatas [batate]
ref|XP_006493385.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    280   5e-88    Citrus sinensis [apfelsine]
gb|AHA14500.1|  hydroxycinnamoyl-coenzyme A quinate transperase         280   5e-88    Fagopyrum tataricum [Kangra buckwheat]
pdb|4G22|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    279   1e-87    Coffea canephora [robusta coffee]
pdb|4G2M|A  Chain A, Structure Of A Lys-Hct Mutant From Coffea Ca...    279   1e-87    Coffea canephora [robusta coffee]
gb|AFZ78609.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    278   2e-87    Populus tomentosa [Chinese white poplar]
gb|ABO77955.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    278   2e-87    Coffea canephora [robusta coffee]
emb|CDO98242.1|  unnamed protein product                                278   2e-87    Coffea canephora [robusta coffee]
pdb|4G0B|A  Chain A, Structure Of Native Hct From Coffea Canephora      278   2e-87    Coffea canephora [robusta coffee]
gb|ABO47805.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    278   2e-87    Coffea canephora [robusta coffee]
gb|KJB56501.1|  hypothetical protein B456_009G122600                    278   2e-87    Gossypium raimondii
gb|AGA20364.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    278   3e-87    Leucaena leucocephala [cassie]
gb|AEM63675.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxycin...    278   4e-87    Platycodon grandiflorus [balloon-flower]
ref|XP_007023475.1|  Hydroxycinnamoyl-CoA shikimate/quinate hydro...    277   4e-87    Theobroma cacao [chocolate]
ref|XP_010063596.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    278   5e-87    Eucalyptus grandis [rose gum]
ref|XP_006368492.1|  transferase family protein                         276   8e-87    Populus trichocarpa [western balsam poplar]
gb|ACA64049.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    276   1e-86    Salvia miltiorrhiza [Chinese salvia]
gb|ADG46003.1|  hydroxycinnamoyl transferase                            276   1e-86    Salvia miltiorrhiza [Chinese salvia]
gb|ACI16630.1|  shikimate O-hydroxycinnamoyltransferase                 276   1e-86    Trifolium pratense [peavine clover]
gb|KHN38057.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    271   2e-86    Glycine soja [wild soybean]
emb|CAJ40778.1|  hydroxycinnamoyl transferase                           276   2e-86    Coffea arabica [arabica coffee]
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...    278   2e-86    Gossypium hirsutum [American cotton]
ref|XP_007215401.1|  hypothetical protein PRUPE_ppa005910mg             275   3e-86    Prunus persica
ref|XP_011034568.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    275   3e-86    Populus euphratica
emb|CDG56248.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    275   4e-86    Glechoma hederacea [gill-over-the-ground]
ref|XP_009615699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    275   5e-86    Nicotiana tomentosiformis
ref|XP_011467012.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    275   5e-86    Fragaria vesca subsp. vesca
gb|ACI28534.1|  shikimate O-hydroxycinnamoyl transferase                275   5e-86    Trifolium pratense [peavine clover]
ref|XP_010094061.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    275   6e-86    
gb|ABO40491.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    275   6e-86    Coffea arabica [arabica coffee]
gb|KDP41953.1|  hypothetical protein JCGZ_26971                         274   8e-86    Jatropha curcas
ref|NP_001289240.1|  shikimate O-hydroxycinnamoyltransferase-like       274   8e-86    Pyrus x bretschneideri [bai li]
ref|XP_011082506.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    274   9e-86    Sesamum indicum [beniseed]
ref|XP_011073311.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    274   1e-85    Sesamum indicum [beniseed]
ref|XP_008342823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    274   1e-85    
gb|KEH28560.1|  shikimate/quinate hydroxycinnamoyltransferase           273   2e-85    Medicago truncatula
ref|XP_009789449.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    273   2e-85    Nicotiana sylvestris
ref|NP_001280198.1|  shikimate O-hydroxycinnamoyltransferase-like       273   3e-85    Prunus mume [ume]
gb|AAZ80046.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    272   4e-85    Cynara cardunculus [cardoon]
ref|XP_004235891.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    272   4e-85    Solanum lycopersicum
gb|AEO00530.1|  hydroxycinnamoyl transferase                            270   5e-85    Nicotiana benthamiana
gb|KHN04193.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    272   5e-85    Glycine soja [wild soybean]
ref|XP_004507046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    272   7e-85    Cicer arietinum [garbanzo]
ref|XP_004507045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    272   7e-85    
ref|XP_009760608.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    271   9e-85    Nicotiana sylvestris
ref|XP_010034043.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    273   1e-84    
ref|XP_003531748.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    271   1e-84    Glycine max [soybeans]
gb|KCW53914.1|  hypothetical protein EUGRSUZ_J03126                     273   1e-84    Eucalyptus grandis [rose gum]
gb|AFS68800.1|  hydroxycinnamoyl transferase                            271   2e-84    Lonicera japonica [Japanese honeysuckle]
ref|XP_010527105.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    270   2e-84    Tarenaya hassleriana [spider flower]
dbj|BAF49306.1|  putative acyltransferase                               271   2e-84    Clitoria ternatea
ref|XP_009375480.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    270   4e-84    Pyrus x bretschneideri [bai li]
emb|CDG56249.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoylt...    270   4e-84    Glechoma hederacea [gill-over-the-ground]
emb|CBI83579.1|  hydroxycinnamoyl transferase                           270   4e-84    Plectranthus scutellarioides
ref|XP_010063586.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    270   5e-84    
ref|XP_006341413.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    270   5e-84    Solanum tuberosum [potatoes]
ref|XP_003530223.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    269   6e-84    Glycine max [soybeans]
ref|XP_009626781.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    269   7e-84    Nicotiana tomentosiformis
ref|XP_009626780.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    269   1e-83    Nicotiana tomentosiformis
gb|KDP38692.1|  hypothetical protein JCGZ_04045                         268   1e-83    Jatropha curcas
gb|ABR17170.1|  unknown                                                 268   2e-83    Picea sitchensis
ref|XP_006583083.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    269   2e-83    Glycine max [soybeans]
ref|XP_006583082.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    268   3e-83    Glycine max [soybeans]
ref|XP_008381122.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    267   4e-83    Malus domestica [apple tree]
gb|ACF17657.1|  putative hydroxycinnamoyl transferase                   267   4e-83    Capsicum annuum
gb|AIG20957.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    266   8e-83    Lonicera japonica [Japanese honeysuckle]
gb|AFL93686.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    266   1e-82    Cynara cardunculus var. scolymus [artichoke]
dbj|BAH57209.1|  AT5G48930                                              260   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466864.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    260   2e-82    Cucumis melo [Oriental melon]
ref|XP_010500344.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    265   3e-82    Camelina sativa [gold-of-pleasure]
emb|CAN82918.1|  hypothetical protein VITISV_023290                     264   5e-82    Vitis vinifera
emb|CBI25231.3|  unnamed protein product                                263   6e-82    Vitis vinifera
ref|XP_002268988.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    264   7e-82    Vitis vinifera
ref|XP_006840118.1|  hypothetical protein AMTR_s00727p00010990          258   1e-81    
dbj|BAF49305.1|  putative acyltransferase                               263   1e-81    Clitoria ternatea
ref|XP_010063590.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    263   2e-81    Eucalyptus grandis [rose gum]
gb|AHA44839.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltr...    262   3e-81    Larix kaempferi [karamatsu]
ref|XP_010063583.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    262   5e-81    Eucalyptus grandis [rose gum]
emb|CCC55431.1|  hydroxycinnamoyl CoA shikimate/quinate hydroxyci...    262   5e-81    Pinus pinaster [cluster pine]
ref|XP_002894568.1|  transferase family protein                         261   9e-81    Arabidopsis lyrata subsp. lyrata
gb|KHN31873.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    261   9e-81    Glycine soja [wild soybean]
ref|XP_010500346.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    262   9e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009354208.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    261   1e-80    Pyrus x bretschneideri [bai li]
ref|XP_006307576.1|  hypothetical protein CARUB_v10009198mg             261   1e-80    Capsella rubella
gb|AAM61215.1|  anthranilate N-benzoyltransferase                       261   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_199704.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyc...    260   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007011895.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    261   2e-80    
gb|ABO52899.1|  hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltr...    260   2e-80    Pinus radiata
ref|XP_007135841.1|  hypothetical protein PHAVU_010G162700g             260   2e-80    Phaseolus vulgaris [French bean]
gb|AGV54440.1|  shikimate O-hydroxycinnamoyltransferase                 260   2e-80    Phaseolus vulgaris [French bean]
emb|CDY31956.1|  BnaA07g00390D                                          259   3e-80    Brassica napus [oilseed rape]
ref|XP_010101376.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    260   3e-80    Morus notabilis
ref|XP_010479239.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010479240.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010462493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   4e-80    Camelina sativa [gold-of-pleasure]
ref|XP_006392548.1|  hypothetical protein EUTSA_v10011497mg             259   5e-80    Eutrema salsugineum [saltwater cress]
ref|XP_010480194.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   5e-80    Camelina sativa [gold-of-pleasure]
ref|XP_009102018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    259   8e-80    Brassica rapa
emb|CDY05770.1|  BnaC07g00330D                                          258   8e-80    
ref|XP_007150819.1|  hypothetical protein PHAVU_005G183200g             259   1e-79    Phaseolus vulgaris [French bean]
ref|XP_010501253.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   2e-79    Camelina sativa [gold-of-pleasure]
ref|XP_003543709.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    258   2e-79    Glycine max [soybeans]
ref|XP_006303737.1|  hypothetical protein CARUB_v10011876mg             257   2e-79    Capsella rubella
gb|AFF57839.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    256   6e-79    Pyrus x bretschneideri [bai li]
emb|CDY22880.1|  BnaA01g18180D                                          256   7e-79    Brassica napus [oilseed rape]
emb|CDY44162.1|  BnaC01g22120D                                          256   7e-79    Brassica napus [oilseed rape]
ref|XP_009146509.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   8e-79    Brassica rapa
ref|XP_010479238.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    256   1e-78    Camelina sativa [gold-of-pleasure]
gb|KHN22398.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    259   1e-78    Glycine soja [wild soybean]
ref|XP_010244683.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    255   2e-78    Nelumbo nucifera [Indian lotus]
ref|XP_010113235.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    255   2e-78    Morus notabilis
gb|AFR40245.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    247   2e-78    Populus fremontii
gb|AFR40214.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    247   2e-78    Populus trichocarpa [western balsam poplar]
gb|AFR40216.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    247   2e-78    Populus trichocarpa [western balsam poplar]
gb|AFR40219.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    247   2e-78    Populus trichocarpa [western balsam poplar]
gb|AFR40243.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    247   2e-78    Populus fremontii
gb|KEH38242.1|  shikimate/quinate hydroxycinnamoyltransferase           254   3e-78    Medicago truncatula
ref|XP_010094062.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    254   3e-78    
gb|KFK35521.1|  hypothetical protein AALP_AA4G001700                    254   3e-78    Arabis alpina [alpine rockcress]
ref|XP_003637275.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    254   3e-78    
ref|XP_002979061.1|  probable hydroxycinnamoyltransferase               255   3e-78    Selaginella moellendorffii
ref|XP_002991534.1|  probable hydroxycinnamoyl transferase              254   4e-78    Selaginella moellendorffii
gb|AEJ88365.1|  hydroxycinnamoyltransferase                             254   4e-78    Cucumis sativus [cucumbers]
gb|AFR40239.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    246   4e-78    Populus fremontii
ref|XP_004135880.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    254   4e-78    
gb|AFR40251.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    246   5e-78    Populus nigra [black poplar]
gb|KEH39662.1|  shikimate/quinate hydroxycinnamoyltransferase           254   5e-78    Medicago truncatula
gb|AFK40022.1|  unknown                                                 245   6e-78    Medicago truncatula
gb|AFR40264.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    246   7e-78    Populus nigra [black poplar]
gb|AFR40240.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   7e-78    Populus fremontii
gb|AFR40246.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   7e-78    Populus fremontii
gb|AFR40241.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   1e-77    Populus fremontii
gb|AFR40250.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   1e-77    Populus fremontii
gb|AFR40238.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   1e-77    Populus fremontii
ref|XP_004158793.1|  PREDICTED: LOW QUALITY PROTEIN: shikimate O-...    253   1e-77    
gb|AFR40248.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   1e-77    Populus fremontii
gb|AFR40231.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    245   1e-77    Populus alba [abele]
gb|AFR40229.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    244   2e-77    Populus alba [abele]
gb|AFR40230.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    244   2e-77    Populus alba [abele]
ref|XP_008353756.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    253   2e-77    
gb|AFR40223.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    244   2e-77    Populus trichocarpa [western balsam poplar]
gb|AFF19203.1|  hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltran...    252   2e-77    Erythroxylum coca [coca]
ref|XP_006303767.1|  hypothetical protein CARUB_v10011977mg             252   4e-77    Capsella rubella
gb|AFR40242.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    243   5e-77    Populus fremontii
gb|AFR40233.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    243   7e-77    Populus alba [abele]
emb|CAR40185.1|  hydroxycinnamoyl-CoA shikimate hydroxycinnamoylt...    244   1e-76    Populus x canadensis [Canadian poplar]
gb|AFR40236.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    242   1e-76    Populus fremontii
gb|AFR40382.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    241   2e-76    Populus fremontii
ref|XP_007215395.1|  hypothetical protein PRUPE_ppa005872mg             249   3e-76    
gb|AFR40372.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    241   3e-76    Populus fremontii
ref|XP_007149790.1|  hypothetical protein PHAVU_005G0989001g            243   3e-76    Phaseolus vulgaris [French bean]
gb|AFR40350.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    240   4e-76    Populus trichocarpa [western balsam poplar]
gb|AFR40387.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    240   5e-76    Populus nigra [black poplar]
ref|XP_002277474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    249   5e-76    Vitis vinifera
ref|XP_007215396.1|  hypothetical protein PRUPE_ppa005873mg             248   1e-75    Prunus persica
ref|XP_008228811.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    248   1e-75    Prunus mume [ume]
gb|EPS67512.1|  hypothetical protein M569_07262                         248   2e-75    Genlisea aurea
ref|XP_008228810.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    247   2e-75    Prunus mume [ume]
ref|XP_007149788.1|  hypothetical protein PHAVU_005G0988001g            239   3e-75    Phaseolus vulgaris [French bean]
gb|AFR40375.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    237   1e-74    Populus fremontii
ref|XP_011036967.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    246   1e-74    Populus euphratica
gb|KJB54947.1|  hypothetical protein B456_009G055900                    245   1e-74    Gossypium raimondii
gb|AFR40386.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    236   1e-74    Populus fremontii
gb|ACF85468.1|  unknown                                                 239   1e-74    Zea mays [maize]
ref|XP_006382509.1|  hypothetical protein POPTR_0005s02820g             245   2e-74    
ref|XP_007156887.1|  hypothetical protein PHAVU_002G025600g             244   2e-74    Phaseolus vulgaris [French bean]
gb|KJB54946.1|  hypothetical protein B456_009G055900                    245   2e-74    Gossypium raimondii
gb|ADB44897.1|  hydroxycinnamoyl transferase                            245   2e-74    Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_008228885.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   2e-74    
ref|XP_002452435.1|  hypothetical protein SORBIDRAFT_04g025760          244   4e-74    Sorghum bicolor [broomcorn]
ref|XP_010244666.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   4e-74    Nelumbo nucifera [Indian lotus]
gb|AFR40374.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    235   5e-74    Populus fremontii
gb|AGM90558.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    244   6e-74    Panicum virgatum
ref|XP_008228828.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    244   6e-74    
ref|XP_007215406.1|  hypothetical protein PRUPE_ppa005955mg             243   1e-73    Prunus persica
gb|ACF81845.1|  unknown                                                 239   1e-73    Zea mays [maize]
ref|XP_009380783.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    243   1e-73    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011018051.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-73    Populus euphratica
ref|XP_008790160.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-73    Phoenix dactylifera
ref|XP_010942061.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    242   2e-73    Elaeis guineensis
ref|XP_011036823.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   4e-73    Populus euphratica
ref|XP_006382508.1|  hypothetical protein POPTR_0005s02810g             241   5e-73    Populus trichocarpa [western balsam poplar]
ref|XP_003575337.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    241   6e-73    Brachypodium distachyon [annual false brome]
ref|XP_007216677.1|  hypothetical protein PRUPE_ppa1027182mg            241   9e-73    Prunus persica
ref|XP_001756433.1|  predicted protein                                  239   2e-72    
gb|ACG29714.1|  anthranilate N-benzoyltransferase protein 1             239   3e-72    Zea mays [maize]
ref|NP_001132890.1|  LOC100194386                                       239   3e-72    Zea mays [maize]
ref|NP_001053225.1|  Os04g0500700                                       239   5e-72    
emb|CAE01635.3|  OSJNBa0029H02.19                                       239   7e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004953073.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    240   1e-71    Setaria italica
ref|XP_006652479.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   1e-71    Oryza brachyantha
ref|XP_009365251.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    238   1e-71    
gb|KJB56505.1|  hypothetical protein B456_009G122600                    236   1e-71    Gossypium raimondii
ref|XP_002324530.2|  hypothetical protein POPTR_0018s11370g             236   5e-71    
ref|XP_004976123.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    235   1e-70    Setaria italica
dbj|BAC78635.1|  hydroxyanthranilate hydroxycinnamoyltransferase 3      235   1e-70    Avena sativa [cultivated oat]
gb|EPS67739.1|  hypothetical protein M569_07035                         234   2e-70    Genlisea aurea
dbj|BAC78634.1|  hydroxyanthranilate hydroxycinnamoyltransferase 2      234   2e-70    Avena sativa [cultivated oat]
gb|EPS73563.1|  hypothetical protein M569_01193                         230   3e-70    Genlisea aurea
ref|XP_007011894.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    236   4e-70    
gb|KJB71577.1|  hypothetical protein B456_011G130700                    233   4e-70    Gossypium raimondii
ref|XP_009394928.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    233   5e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047408.1|  Os02g0611800                                       233   5e-70    
dbj|BAJ95750.1|  predicted protein                                      233   7e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ23787.1|  hypothetical protein OsJ_07497                          233   9e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007216058.1|  hypothetical protein PRUPE_ppa017691mg             233   9e-70    Prunus persica
gb|KJB54981.1|  hypothetical protein B456_009G057200                    233   1e-69    Gossypium raimondii
dbj|BAC78633.1|  hydroxyanthranilate hydroxycinnamoyltransferase 1      233   1e-69    Avena sativa [cultivated oat]
ref|XP_002324532.1|  hypothetical protein POPTR_0018s11380g             233   1e-69    Populus trichocarpa [western balsam poplar]
gb|KJB68257.1|  hypothetical protein B456_010G234800                    231   2e-69    Gossypium raimondii
dbj|BAJ93247.1|  predicted protein                                      232   2e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAO20883.1|  hydroxycinnamoyl CoA: shikimate hydroxycinnamoyl...    232   2e-69    Panicum virgatum
gb|KHG20214.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    232   2e-69    Gossypium arboreum [tree cotton]
ref|XP_008228829.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    232   2e-69    Prunus mume [ume]
gb|KJB68256.1|  hypothetical protein B456_010G234800                    232   3e-69    Gossypium raimondii
ref|XP_003580078.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    231   3e-69    Brachypodium distachyon [annual false brome]
ref|NP_001145871.1|  uncharacterized protein LOC100279386               231   3e-69    
gb|EYU21749.1|  hypothetical protein MIMGU_mgv1a006630mg                231   4e-69    Erythranthe guttata [common monkey flower]
ref|XP_007027321.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    231   5e-69    
gb|KJB71596.1|  hypothetical protein B456_011G132100                    231   6e-69    Gossypium raimondii
gb|KJB68255.1|  hypothetical protein B456_010G234700                    231   7e-69    Gossypium raimondii
gb|ACG47161.1|  anthranilate N-benzoyltransferase protein 2             230   1e-68    Zea mays [maize]
ref|XP_002446745.1|  hypothetical protein SORBIDRAFT_06g021640          230   1e-68    Sorghum bicolor [broomcorn]
gb|KHG19404.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    229   2e-68    Gossypium arboreum [tree cotton]
gb|KJB54948.1|  hypothetical protein B456_009G055900                    229   2e-68    Gossypium raimondii
gb|KJB68253.1|  hypothetical protein B456_010G234500                    229   2e-68    Gossypium raimondii
ref|XP_007027324.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    229   2e-68    
dbj|BAJ87836.1|  predicted protein                                      229   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK06288.1|  predicted protein                                      229   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007033668.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    226   2e-67    
gb|AFK10218.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    226   3e-67    Pyrus x bretschneideri [bai li]
gb|KJB68227.1|  hypothetical protein B456_010G233600                    226   3e-67    Gossypium raimondii
ref|XP_007033659.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    226   3e-67    
gb|KJB68229.1|  hypothetical protein B456_010G233600                    226   4e-67    Gossypium raimondii
ref|XP_009399564.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    226   5e-67    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS64908.1|  Anthranilate N-benzoyltransferase protein 1             223   9e-67    Triticum urartu
gb|AFR40365.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    216   9e-67    Populus alba [abele]
gb|KJB68219.1|  hypothetical protein B456_010G233000                    218   1e-66    Gossypium raimondii
ref|XP_009366046.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    224   2e-66    
ref|XP_007214866.1|  hypothetical protein PRUPE_ppa019948mg             224   3e-66    
gb|AFR40367.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    214   3e-66    
ref|XP_002529412.1|  Anthranilate N-benzoyltransferase protein, p...    222   4e-66    
gb|KHG08871.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    223   4e-66    
ref|XP_003629304.1|  Hydroxycinnamoyl-CoA quinate hydroxycinnamoy...    222   6e-66    
ref|XP_004507047.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    223   7e-66    
ref|XP_007217854.1|  hypothetical protein PRUPE_ppa024073mg             222   9e-66    
ref|XP_006826688.1|  hypothetical protein AMTR_s00137p00072760          222   1e-65    
ref|XP_008381165.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    222   1e-65    
gb|AFZ93419.1|  hydroxycinnamoyl-CoA:shikimate/quinate hydroxycin...    216   2e-65    
gb|EMT08585.1|  Anthranilate N-benzoyltransferase protein 1             221   3e-65    
gb|EYU24607.1|  hypothetical protein MIMGU_mgv1a006502mg                221   3e-65    
ref|XP_009366067.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    219   3e-65    
gb|EYU24606.1|  hypothetical protein MIMGU_mgv1a005249mg                222   3e-65    
ref|XP_009366045.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    221   4e-65    
gb|ACZ52699.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxycin...    213   7e-65    
ref|XP_007027320.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    225   1e-64    
sp|G0LD36.1|RAS_MELOI  RecName: Full=Rosmarinate synthase; Short=...    218   5e-64    
gb|AFR40371.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    208   8e-64    
gb|AFR40370.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    207   1e-63    
gb|AEV93472.1|  hydroxycinnamoyl transferase                            211   1e-63    
ref|XP_007027325.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    215   1e-63    
gb|EYU21745.1|  hypothetical protein MIMGU_mgv1a006579mg                216   2e-63    
ref|XP_006464645.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    216   2e-63    
ref|XP_006453163.1|  hypothetical protein CICLE_v10010833mg             214   9e-63    
gb|AFR40217.1|  hydroxcinnamoyl-CoA quinate/shikimate hydroxycinn...    207   1e-62    
ref|XP_006465544.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    214   1e-62    
ref|XP_006465262.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    214   1e-62    
ref|XP_002529413.1|  Anthranilate N-benzoyltransferase protein, p...    214   1e-62    
ref|XP_007149783.1|  hypothetical protein PHAVU_005G0986001g            205   3e-62    
ref|XP_008237042.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    212   9e-62    
ref|XP_004293648.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    212   1e-61    
ref|XP_004295153.2|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    212   2e-61    
emb|CAD88491.1|  hydroxycinnamoyl-CoA hydroxycinnamoyltransferase       207   3e-61    
ref|XP_007216540.1|  hypothetical protein PRUPE_ppa027223mg             209   7e-61    
ref|XP_006471699.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    209   9e-61    
ref|XP_006471700.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    209   1e-60    
gb|ADA60182.1|  rosmarinic acid synthase                                208   2e-60    
gb|AJA31666.1|  rosmarinic acid synthase                                208   2e-60    
ref|XP_007149777.1|  hypothetical protein PHAVU_005G098300g             206   5e-60    
ref|XP_010672790.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    207   6e-60    
ref|XP_006478316.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    207   8e-60    
ref|XP_010672788.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    207   9e-60    
ref|XP_006474019.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   2e-59    
ref|XP_006474020.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   2e-59    
ref|XP_004294955.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    206   3e-59    
gb|AEA36976.1|  rosmarinic acid synthase                                206   3e-59    
ref|XP_004293649.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    204   8e-59    
ref|XP_004291518.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    204   1e-58    
ref|XP_008370591.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   1e-58    
ref|XP_006471643.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    204   2e-58    
ref|XP_007216286.1|  hypothetical protein PRUPE_ppa020471mg             199   2e-58    
ref|XP_011084630.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    202   4e-58    
ref|XP_010682402.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    195   5e-58    
gb|ABI48360.1|  putative alcohol acyltransferase 1                      202   1e-57    
ref|XP_010667050.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    201   2e-57    
dbj|BAC78636.1|  hydroxyanthranilate hydroxycinnamoyltransferase 4      197   2e-57    
gb|EMT09803.1|  Anthranilate N-benzoyltransferase protein 1             202   2e-57    
ref|XP_010672789.1|  PREDICTED: anthranilate N-benzoyltransferase...    201   2e-57    
gb|KDP38698.1|  hypothetical protein JCGZ_04051                         199   3e-57    
ref|XP_010667049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    200   4e-57    
ref|XP_006486096.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   5e-57    
ref|XP_011011266.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   7e-57    
gb|AGH61997.1|  rosmarinic acid synthase                                199   8e-57    
ref|XP_010545859.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    199   9e-57    
ref|XP_010093468.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    198   9e-57    
sp|A0PDV5.1|RAS_PLESU  RecName: Full=Rosmarinate synthase; Short=...    198   1e-56    
emb|CDG56250.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    198   1e-56    
ref|XP_010093469.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    198   1e-56    
gb|EYU24588.1|  hypothetical protein MIMGU_mgv1a0237892mg               194   2e-56    
ref|XP_010911018.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   2e-56    
ref|XP_008223321.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    198   2e-56    
ref|XP_008779303.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    195   3e-56    
gb|AGW27209.1|  rosmarinic acid synthase 4                              197   4e-56    
ref|XP_006474075.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    196   1e-55    
gb|KJB68258.1|  hypothetical protein B456_010G234900                    195   3e-55    
ref|XP_008777439.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   4e-55    
ref|XP_006474074.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   4e-55    
ref|XP_010942060.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    194   6e-55    
gb|AFF19202.1|  BAHD acyltransferase                                    189   3e-53    
gb|KDP38697.1|  hypothetical protein JCGZ_04050                         189   4e-53    
gb|EMS60258.1|  Anthranilate N-benzoyltransferase protein 1             189   8e-53    
ref|XP_010538049.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    188   1e-52    
ref|XP_009403962.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    187   3e-52    
gb|AGW27211.1|  rosmarinic acid synthase 6                              186   4e-52    
gb|AGW27208.1|  rosmarinic acid synthase 3                              184   2e-51    
ref|NP_001169127.1|  hypothetical protein                               184   3e-51    
gb|EYU24587.1|  hypothetical protein MIMGU_mgv1a006602mg                184   4e-51    
ref|XP_002454696.1|  hypothetical protein SORBIDRAFT_04g035780          182   3e-50    
sp|O23917.1|HCBT2_DIACA  RecName: Full=Anthranilate N-benzoyltran...    181   4e-50    
dbj|BAJ89730.1|  predicted protein                                      181   6e-50    
sp|O23918.1|HCBT3_DIACA  RecName: Full=Anthranilate N-benzoyltran...    181   7e-50    
ref|XP_010265516.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    181   7e-50    
dbj|BAJ91746.1|  predicted protein                                      181   9e-50    
gb|KJB71583.1|  hypothetical protein B456_011G130900                    179   1e-49    
ref|XP_010533496.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   2e-49    
ref|XP_010273689.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    179   3e-49    
gb|EPS61292.1|  hydroxycinnamoyl transferase                            173   4e-49    
emb|CDG56253.1|  hydroxycinnamoyltransferase 2                          178   7e-49    
ref|XP_003604491.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    177   7e-49    
ref|XP_002269790.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    178   8e-49    
gb|KDO61846.1|  hypothetical protein CISIN_1g036315mg                   177   1e-48    
ref|XP_010273688.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    177   2e-48    
ref|XP_006381775.1|  hypothetical protein POPTR_0006s17880g             177   3e-48    
gb|KHN35439.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    175   4e-48    
ref|XP_003555244.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    176   8e-48    
ref|XP_009409799.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    174   1e-47    
gb|ACU23734.1|  unknown                                                 174   2e-47    
ref|XP_006605610.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    174   2e-47    
ref|XP_009409797.1|  PREDICTED: uncharacterized protein LOC103991972    179   3e-47    
ref|XP_006453312.1|  hypothetical protein CICLE_v10008265mg             174   4e-47    
emb|CDG56252.1|  hydroxycinnamoyltransferase 1                          173   5e-47    
sp|O24645.1|HCBT1_DIACA  RecName: Full=Anthranilate N-benzoyltran...    172   9e-47    
ref|XP_009403058.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    172   9e-47    
ref|XP_008223800.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    172   2e-46    
gb|AGW27207.1|  rosmarinic acid synthase 2                              169   2e-46    
ref|XP_007011893.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    169   4e-46    
emb|CAN72449.1|  hypothetical protein VITISV_011069                     171   5e-46    
gb|KHN17616.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    169   5e-46    
ref|XP_008223799.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    171   5e-46    
ref|XP_008777438.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    170   9e-46    
ref|XP_007211620.1|  hypothetical protein PRUPE_ppa005563mg             170   9e-46    
ref|XP_002325143.2|  transferase family protein                         169   2e-45    
ref|XP_011018001.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    169   2e-45    
ref|XP_010911178.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    169   2e-45    
ref|XP_003550655.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    169   3e-45    
emb|CAB06428.1|  anthranilate N-hydroxycinnamoyl/benzoyltransferase     168   5e-45    
gb|KHN17617.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    167   6e-45    
ref|XP_003550654.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    167   1e-44    
ref|XP_004301782.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    166   4e-44    
ref|XP_002276550.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    165   4e-44    
ref|XP_010050943.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    165   7e-44    
gb|KCW80900.1|  hypothetical protein EUGRSUZ_C02269                     165   8e-44    
ref|XP_002274695.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    164   8e-44    
gb|AGW27210.1|  rosmarinic acid synthase 5                              164   1e-43    
ref|XP_009358743.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    164   2e-43    
gb|EPS61293.1|  hypothetical protein M569_13504                         162   2e-43    
ref|XP_007206604.1|  hypothetical protein PRUPE_ppa020718mg             161   2e-43    
ref|XP_010050942.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    163   3e-43    
ref|XP_010667594.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    160   3e-43    
ref|XP_008372277.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    163   3e-43    
ref|XP_010034869.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    163   3e-43    
ref|XP_002529384.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    162   4e-43    
ref|XP_010656623.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    162   6e-43    
ref|XP_004964653.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    162   7e-43    
emb|CBI36554.3|  unnamed protein product                                162   7e-43    
gb|AFF57840.1|  hydroxycinnamoyl-coenzyme A shikimate/quinate hyd...    162   9e-43    
ref|XP_008790158.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    161   9e-43    
emb|CDG56251.1|  hydroxycinnamoyl-CoA:hydroxyphenyllactate hydrox...    160   1e-42    
ref|XP_003532115.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    161   2e-42    
ref|XP_002521543.1|  Anthranilate N-benzoyltransferase protein, p...    161   2e-42    
ref|XP_004243059.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    160   2e-42    
emb|CAM84303.1|  putative hydroxycinnamoyl CoA quinate transferase      151   3e-42    
ref|XP_002866234.1|  transferase family protein                         160   3e-42    
ref|XP_006409088.1|  hypothetical protein EUTSA_v10022690mg             160   3e-42    
ref|XP_007146248.1|  hypothetical protein PHAVU_006G024700g             160   3e-42    
gb|AFD64619.1|  putative hydroxycinnamoyl-CoA:shikimate/quinate h...    160   3e-42    
ref|XP_009628063.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    160   3e-42    
ref|XP_011083883.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    160   3e-42    
ref|XP_006280407.1|  hypothetical protein CARUB_v10026341mg             157   4e-42    
ref|XP_010547371.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    159   5e-42    
ref|XP_007161968.1|  hypothetical protein PHAVU_001G112900g             159   9e-42    
ref|XP_006359722.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    159   1e-41    
ref|XP_004149125.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    159   1e-41    
ref|XP_009787025.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    158   2e-41    
gb|ADD71921.1|  BAHD-type hydroxycinnamoyltransferase                   158   2e-41    
ref|XP_010548604.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    158   2e-41    
emb|CDY11845.1|  BnaC03g12710D                                          162   3e-41    
gb|KFK27325.1|  hypothetical protein AALP_AA8G368300                    157   3e-41    
ref|XP_006280408.1|  hypothetical protein CARUB_v10026341mg             158   4e-41    
ref|XP_003551937.2|  PREDICTED: spermidine hydroxycinnamoyl trans...    157   4e-41    
gb|KHN29832.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    157   4e-41    
ref|XP_002437976.1|  hypothetical protein SORBIDRAFT_10g005760          157   4e-41    
ref|XP_002436612.1|  hypothetical protein SORBIDRAFT_10g005770          157   5e-41    
dbj|BAH66890.1|  alcohol acyl-transferase                               148   5e-41    
ref|XP_010545447.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    157   6e-41    
ref|XP_010443493.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    154   1e-40    
ref|XP_010093470.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    149   1e-40    
ref|XP_006296658.1|  hypothetical protein CARUB_v10015907mg             156   1e-40    
gb|KCW82842.1|  hypothetical protein EUGRSUZ_C04213                     155   3e-40    
gb|EAY99938.1|  hypothetical protein OsI_21941                          154   4e-40    
ref|XP_010051711.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   5e-40    
ref|XP_008231492.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   5e-40    
gb|KHN13395.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    154   6e-40    
ref|XP_010489453.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   6e-40    
ref|XP_008441993.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    154   7e-40    
ref|XP_006401163.1|  hypothetical protein EUTSA_v10013552mg             154   7e-40    
ref|XP_002884178.1|  transferase family protein                         154   9e-40    
gb|ACC68164.1|  unknown                                                 154   9e-40    
ref|XP_007161967.1|  hypothetical protein PHAVU_001G112800g             154   1e-39    
gb|EPS69670.1|  hypothetical protein M569_05094                         153   1e-39    
gb|KFK40283.1|  hypothetical protein AALP_AA3G354800                    153   1e-39    
ref|XP_010443492.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    153   1e-39    
ref|XP_010110725.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinat...    153   2e-39    
ref|NP_179497.1|  spermidine hydroxycinnamoyl transferase               153   2e-39    
ref|XP_003610074.1|  Hydroxycinnamoyl CoA shikimate/quinate hydro...    152   2e-39    
ref|NP_200592.1|  anthranilate N-hydroxycinnamoyl/benzoyltransfer...    152   3e-39    
ref|NP_001056998.1|  Os06g0184900                                       152   4e-39    
gb|EEE65224.1|  hypothetical protein OsJ_20373                          151   4e-39    
ref|XP_003560989.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   6e-39    
emb|CDY62143.1|  BnaCnng39330D                                          150   6e-39    
ref|XP_003548918.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    151   6e-39    
gb|KHM99609.1|  Hydroxycinnamoyl-Coenzyme A shikimate/quinate hyd...    151   6e-39    
emb|CDY56515.1|  BnaCnng30570D                                          150   7e-39    
ref|XP_009132104.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    151   7e-39    
ref|XP_007214780.1|  hypothetical protein PRUPE_ppa023555mg             150   8e-39    
ref|XP_010467740.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    151   1e-38    
emb|CDY66506.1|  BnaAnng22360D                                          150   1e-38    
ref|XP_006656713.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    147   1e-38    
ref|XP_010672786.1|  PREDICTED: anthranilate N-benzoyltransferase...    149   1e-38    
ref|XP_003532110.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   1e-38    
ref|XP_009112574.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   2e-38    
ref|XP_007154735.1|  hypothetical protein PHAVU_003G143100g             150   2e-38    
ref|XP_010673351.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    150   2e-38    
ref|XP_011069658.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    149   3e-38    
gb|EYU25632.1|  hypothetical protein MIMGU_mgv1a006215mg                149   3e-38    
gb|AFK47698.1|  unknown                                                 146   3e-38    
emb|CDX88644.1|  BnaA03g10050D                                          149   4e-38    
ref|XP_009150708.1|  PREDICTED: spermidine hydroxycinnamoyl trans...    149   5e-38    
ref|XP_004166135.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...    144   7e-38    



>dbj|BAA87043.1| N-hydroxycinnamoyl/benzoyltransferase [Ipomoea batatas]
 dbj|BAJ14795.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Ipomoea 
batatas]
Length=431

 Score =   444 bits (1143),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/218 (98%), Positives = 215/218 (99%), Gaps = 0/218 (0%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQ  601
            LKSVPESKRGSSAST MLKITPEQL +LKTKSKHEGSTYEILAAHIWRCACKARGLTDDQ
Sbjct  214  LKSVPESKRGSSASTTMLKITPEQLALLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQ  273

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
            +TKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAES ELQSEPLTNSAKRIHSALSRMDD
Sbjct  274  ATKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESGELQSEPLTNSAKRIHSALSRMDD  333

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL
Sbjct  334  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  393

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF
Sbjct  394  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  431



>emb|CAT00081.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Coffea arabica]
Length=430

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQST  595
            + E K G  AST A+LKITPEQL  LK K+ +EGSTYEILAAHIWR ACKARGLT+DQST
Sbjct  215  IQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQST  274

Query  594  KLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEY  415
            KLYVATDGRSRL PPLPPGYLGNVVFTATP+AES +LQSEPLTNSAKRIH+AL+RMD++Y
Sbjct  275  KLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSDLQSEPLTNSAKRIHNALARMDNDY  334

Query  414  LRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYE  235
            LRSALD+LE QPDLS L+RG  +FASPNLNINSWTRLP H++DFGWGRPIH+GPA ILYE
Sbjct  335  LRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYE  394

Query  234  GTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            GTVY+LPSP KDRTLSLAVCLDA+HMPLF++FLYDF
Sbjct  395  GTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|ABO77956.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   369 bits (947),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQST  595
            + E K G  AST A+LKITPEQL  LK K+ +EGSTYEILAAHIWR ACKARGLT+DQST
Sbjct  215  IQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQST  274

Query  594  KLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEY  415
            KLYVATDGRSRL PPLPPGYLGNVVFTATP+AES  LQSEPLTNSAKRIH+AL+RMD++Y
Sbjct  275  KLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDY  334

Query  414  LRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYE  235
            LRSALD+LE QPDLS L+RG  +FASPNLNINSWTRLP H++DFGWGRPIH+GPA ILYE
Sbjct  335  LRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYE  394

Query  234  GTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            GTVY+LPSP KDRTLSLAVCLDA+HMPLF++FLYDF
Sbjct  395  GTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|AFP49814.1| caffeoyl-CoA quinic acid caffeoyl transferase 4 [Coffea arabica]
Length=430

 Score =   369 bits (946),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQST  595
            + E K G  AST A+LKITPEQL  LK K+ +EGSTYEILAAHIWR ACKARGLT+DQST
Sbjct  215  IQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQST  274

Query  594  KLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEY  415
            KLYVATDGRSRL PPLPPGYLGNVVFTATP+AES  LQSEPLTNSAKRIH+AL+RMD++Y
Sbjct  275  KLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDY  334

Query  414  LRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYE  235
            LRSALD+LE QPDLS L+RG  +FASPNLNINSWTRLP H++DFGWGRPIH+GPA ILYE
Sbjct  335  LRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYE  394

Query  234  GTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            GTVY+LPSP KDRTLSLAVCLDA+HMPLF++FLYDF
Sbjct  395  GTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  430



>gb|ABO77957.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Coffea 
canephora]
Length=430

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQST  595
            + E K G  AST A+LKITPEQL  LK K+ +EGSTYEILAAHIWR ACKARGLT+DQST
Sbjct  215  IQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQST  274

Query  594  KLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEY  415
            KLYVATDGRSRL PPLPPGYLGNVVFTATP+AES  LQSEPLTNSAKRIH+AL+RMD++Y
Sbjct  275  KLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDY  334

Query  414  LRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYE  235
            LRSALD+LE QPDLS L+RG  +FASPNLNINSWTRLP H++DFGWGRPIH+GPA ILYE
Sbjct  335  LRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYE  394

Query  234  GTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            GTVY+LPSP KDRTLSLAVCLDA+HMPLF+ FLYDF
Sbjct  395  GTVYVLPSPGKDRTLSLAVCLDADHMPLFQRFLYDF  430



>emb|CDP02827.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   369 bits (946),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQST  595
            + E K G  AST A+LKITPEQL  LK K+ +EGSTYEILAAHIWR ACKARGLT+DQST
Sbjct  269  IQELKTGPRASTTAVLKITPEQLSQLKAKANNEGSTYEILAAHIWRTACKARGLTNDQST  328

Query  594  KLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEY  415
            KLYVATDGRSRL PPLPPGYLGNVVFTATP+AES  LQSEPLTNSAKRIH+AL+RMD++Y
Sbjct  329  KLYVATDGRSRLIPPLPPGYLGNVVFTATPIAESSNLQSEPLTNSAKRIHNALARMDNDY  388

Query  414  LRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYE  235
            LRSALD+LE QPDLS L+RG  +FASPNLNINSWTRLP H++DFGWGRPIH+GPA ILYE
Sbjct  389  LRSALDYLEIQPDLSALVRGPRHFASPNLNINSWTRLPFHDADFGWGRPIHIGPAIILYE  448

Query  234  GTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            GTVY+LPSP KDRTLSLAVCLDA+HMPLF++FLYDF
Sbjct  449  GTVYVLPSPGKDRTLSLAVCLDADHMPLFQKFLYDF  484



>ref|XP_009800587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   367 bits (941),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 173/214 (81%), Positives = 190/214 (89%), Gaps = 1/214 (0%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLY  586
            ES     + T MLK + +QLG+LK+KSKHEGSTYEILAAHIWRC CKAR L DDQ TKL+
Sbjct  223  ESTSPKPSMTTMLKFSSDQLGLLKSKSKHEGSTYEILAAHIWRCTCKARALADDQLTKLH  282

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            VATDGRSRLCPPLPPGYLGNVVFTATPMA+S EL  EPLTNSAKRIH++LS+MDD YLRS
Sbjct  283  VATDGRSRLCPPLPPGYLGNVVFTATPMAKSSELLQEPLTNSAKRIHTSLSKMDDNYLRS  342

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDLS LIRG  YFASPNLNINSWTRLPVH+SDFGWGRPIHMGPACILYEGTV
Sbjct  343  ALDYLELQPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTV  402

Query  225  YILPSPN-KDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YILPSPN KDR L LAVCLDA+HMPLF+++LY+F
Sbjct  403  YILPSPNSKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009624297.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=436

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLYVATDGRS  565
            ++T MLK + +QLG+LK+KSKH+GSTYEILAAHIWRC CKAR L+DDQ TKL+VATDGRS
Sbjct  230  STTTMLKFSSDQLGLLKSKSKHDGSTYEILAAHIWRCTCKARALSDDQLTKLHVATDGRS  289

Query  564  RLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLEC  385
            RLCPPLPPGYLGNVVFT TPMA+S EL  EPLTNSAKRIHSALS+MDD YLRSALD+LE 
Sbjct  290  RLCPPLPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALDYLEL  349

Query  384  QPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPN  205
             PDLS LIRG  YFASPNLNINSWTRLPVH+SDFGWGRPIHMGPACILYEGTVYILPSPN
Sbjct  350  LPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTVYILPSPN  409

Query  204  -KDRTLSLAVCLDAEHMPLFKEFLYDF  127
             KDR L LAVCLDA+HMPLF+++LY+F
Sbjct  410  SKDRNLRLAVCLDADHMPLFEKYLYEF  436



>emb|CAE46932.1| hydroxycinnamoyl CoA quinate transferase [Nicotiana tabacum]
Length=436

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLYVATDGRS  565
            ++T MLK + +QLG+LK+KSKH+GSTYEILAAHIWRC CKAR L+DDQ TKL+VATDGRS
Sbjct  230  STTTMLKFSSDQLGLLKSKSKHDGSTYEILAAHIWRCTCKARALSDDQLTKLHVATDGRS  289

Query  564  RLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLEC  385
            RLCPPLPPGYLGNVVFT TPMA+S EL  EPLTNSAKRIHSALS+MDD YLRSALD+LE 
Sbjct  290  RLCPPLPPGYLGNVVFTGTPMAKSSELLQEPLTNSAKRIHSALSKMDDNYLRSALDYLEL  349

Query  384  QPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPN  205
             PDLS LIRG  YFASPNLNINSWTRLPVH+SDFGWGRPIHMGPACILYEGTVYILPSPN
Sbjct  350  LPDLSALIRGPTYFASPNLNINSWTRLPVHDSDFGWGRPIHMGPACILYEGTVYILPSPN  409

Query  204  -KDRTLSLAVCLDAEHMPLFKEFLYDF  127
             KDR L LAVCLDA+HMPLF+++LY+F
Sbjct  410  SKDRNLRLAVCLDADHMPLFEKYLYEF  436



>ref|XP_009614241.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
tomentosiformis]
Length=434

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 193/218 (89%), Gaps = 1/218 (0%)
 Frame = -3

Query  777  KSVPESKRG-SSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQ  601
            K+V +   G  S++T M KIT +QL +LKTKSKHEGSTYEILAAHIWRC CKAR L DDQ
Sbjct  217  KNVHDQVNGPKSSTTTMFKITSDQLTLLKTKSKHEGSTYEILAAHIWRCTCKARILDDDQ  276

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKL+VATDGRSRL PPLPPGYLGNVVFTATP+A+S E+ SEPL N+A+RIHSAL+RMDD
Sbjct  277  LTKLHVATDGRSRLFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDD  336

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSA+D+LE Q DLSKLIRG  YFASPNLNINSWTRLPVH+SDFGWG+PIHMGPACIL
Sbjct  337  EYLRSAIDYLELQTDLSKLIRGPTYFASPNLNINSWTRLPVHDSDFGWGKPIHMGPACIL  396

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEGTVYILPSP+ D+ L LAVCLDA+HMPLF+++LY+F
Sbjct  397  YEGTVYILPSPSNDKNLRLAVCLDADHMPLFEKYLYEF  434



>ref|NP_001234850.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
 emb|CAE46933.1| hydroxycinnamoyl CoA quinate transferase [Solanum lycopersicum]
Length=430

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 188/213 (88%), Gaps = 1/213 (0%)
 Frame = -3

Query  762  SKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLYV  583
            SK   S++T MLK + EQLG+LK+KSK+EGSTYEILAAHIWRC CKARGL +DQ TKL+V
Sbjct  218  SKNRESSTTTMLKFSSEQLGLLKSKSKNEGSTYEILAAHIWRCTCKARGLPEDQLTKLHV  277

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRLCPPLPPGYLGNVVFTATP+A+S ELQSEPLTNS KRIH+ L +MDD YLRSA
Sbjct  278  ATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLTNSVKRIHNELIKMDDNYLRSA  337

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS LIRG  YFASPNLNINSWTRLPVHE DFGWGRPIHMGPACILYEGT+Y
Sbjct  338  LDYLELQPDLSTLIRGPAYFASPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTIY  397

Query  222  ILPSPN-KDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I+PSPN KDR L LAVCLDA HM LF+++LY+ 
Sbjct  398  IIPSPNSKDRNLRLAVCLDAGHMSLFEKYLYEL  430



>ref|XP_009798536.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=436

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            S+ TAM KIT +QL +LKTKSK EGSTYE+LAAHIWRC CKAR L +DQ TKL+VATDGR
Sbjct  230  SSITAMFKITSDQLTLLKTKSKKEGSTYEVLAAHIWRCTCKARALDNDQLTKLHVATDGR  289

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
            SRL PPLPPGYLGNVVFTATP+A+S E+ SEPL N+A+RIHSAL+RMDDEYLRSA+D+LE
Sbjct  290  SRLFPPLPPGYLGNVVFTATPIAKSGEILSEPLMNTAQRIHSALARMDDEYLRSAIDYLE  349

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             Q DLSKLIRG  YFASPNLNINSWTRLPVH+SDFGWG+PIHMGPACILYEGTVYILPSP
Sbjct  350  LQTDLSKLIRGPTYFASPNLNINSWTRLPVHDSDFGWGKPIHMGPACILYEGTVYILPSP  409

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + D+ L LAVCLDA+HMPLF+++LYDF
Sbjct  410  SNDKNLRLAVCLDADHMPLFEKYLYDF  436



>ref|XP_006343633.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum tuberosum]
Length=435

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 188/214 (88%), Gaps = 1/214 (0%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLY  586
            ES    S++TAMLK + EQ+G+LK+KS++EGSTYEILAAHIWRC  KARGL DDQ TKL+
Sbjct  222  ESTGPKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLH  281

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            VATDGRSRLCPPLPPGYLGNVVFTATP+A+S ELQSEPL NS KRIH+ L +MDD YLRS
Sbjct  282  VATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRS  341

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDLS LIRG  YF SPNLNINSWTRLPVHE DFGWGRPIHMGPACILYEGT+
Sbjct  342  ALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTI  401

Query  225  YILPSPN-KDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YI+PSPN KDR L LAVCLD +HMPLF+++LY+F
Sbjct  402  YIIPSPNTKDRNLRLAVCLDPDHMPLFEKYLYEF  435



>ref|NP_001275483.1| HQT [Solanum tuberosum]
 gb|ADF50082.1| HQT [Solanum tuberosum]
Length=433

 Score =   347 bits (891),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 185/211 (88%), Gaps = 1/211 (0%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLY  586
            ES    S++TAMLK + EQ+G+LK+KS++EGSTYEILAAHIWRC  KARGL DDQ TKL+
Sbjct  222  ESTGPKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLH  281

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            VATDGRSRLCPPLPPGYLGNVVFTATP+A+S ELQSEPL NS KRIH+ L +MDD YLRS
Sbjct  282  VATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIHNELIKMDDNYLRS  341

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDLS LIRG  YF SPNLNINSWTRLPVHE DFGWGRPIHMGPACILYEGT+
Sbjct  342  ALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTI  401

Query  225  YILPSPN-KDRTLSLAVCLDAEHMPLFKEFL  136
            YI+PSPN KDR L LAVCLD +HMPLF+++L
Sbjct  402  YIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|ABA46756.1| hydroxycinnamoyl-CoA quinate-like protein [Solanum tuberosum]
Length=433

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 184/211 (87%), Gaps = 1/211 (0%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQSTKLY  586
            ES    S++TAMLK + EQ+G+LK+KS++EGSTYEILAAHIWRC  KARGL DDQ TKL+
Sbjct  222  ESTGPKSSTTAMLKFSSEQVGLLKSKSENEGSTYEILAAHIWRCTSKARGLADDQLTKLH  281

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            VATDGRSRLCPPLPPGYLGNVVFTATP+A+S ELQSEPL NS KRI + L +MDD YLRS
Sbjct  282  VATDGRSRLCPPLPPGYLGNVVFTATPIAKSCELQSEPLRNSVKRIPNELIKMDDNYLRS  341

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDLS LIRG  YF SPNLNINSWTRLPVHE DFGWGRPIHMGPACILYEGT+
Sbjct  342  ALDYLELQPDLSTLIRGPTYFTSPNLNINSWTRLPVHECDFGWGRPIHMGPACILYEGTI  401

Query  225  YILPSPN-KDRTLSLAVCLDAEHMPLFKEFL  136
            YI+PSPN KDR L LAVCLD +HMPLF+++L
Sbjct  402  YIIPSPNTKDRNLRLAVCLDPDHMPLFEKYL  432



>gb|AGE10614.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=214

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 182/210 (87%), Gaps = 5/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
             STA+LK++ +QL  LK K+K+EG     STYEILAAH+WRCACKAR L+ +Q++KLY+A
Sbjct  5    VSTAILKLSLDQLTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSPNQTSKLYIA  64

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGRSRLCPPLPPGYLGNVVFTATPMAES +LQ EP+T++AKRIH++L+RMD+EYLRSAL
Sbjct  65   TDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQVEPVTSTAKRIHNSLTRMDNEYLRSAL  124

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            DFLE  PDL  L+RG NYFASPNLNINSWTRLPVH++DFGWGRPI MGPA ILYEGT+YI
Sbjct  125  DFLETTPDLKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYI  184

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +PS   DR+LSLAVCLDA HM  F++ LY+
Sbjct  185  IPSTTNDRSLSLAVCLDAGHMARFEKCLYE  214



>gb|ACJ23164.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 185/218 (85%), Gaps = 4/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEG----STYEILAAHIWRCACKARGLTDDQ  601
            P S   S +ST MLK+T +QL  LK K+K E     STYEILAAHIWRCACKARGL DDQ
Sbjct  226  PGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDDQ  285

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             +KLYVATDGRSRL P LPPGYLGNVVFTATP+A+S +L S+ L+N+AK IH+ L++MDD
Sbjct  286  LSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMDD  345

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSA+D+LE QPDLS LIRG +YFASPNLNIN+WTRLPV+++DFGWGRPI MGPACIL
Sbjct  346  DYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADFGWGRPIFMGPACIL  405

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEGT+Y+LPSPN DR++SLAVCLDA   PLF++FLY+F
Sbjct  406  YEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|ACZ52698.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyltransferase [Lonicera 
japonica]
Length=439

 Score =   329 bits (843),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/211 (73%), Positives = 183/211 (87%), Gaps = 5/211 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
             STA+LK++ +QL  LK K+K+EG     STYEILAAH+WRCACKAR L+ +Q++KLY+A
Sbjct  229  VSTAILKLSLDQLTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSPNQTSKLYIA  288

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGRSRLCPPLPPGYLGNVVFTATPMAES +LQ EP+T++AKRIH++L+RMD+EYLRSAL
Sbjct  289  TDGRSRLCPPLPPGYLGNVVFTATPMAESGDLQVEPVTSTAKRIHNSLTRMDNEYLRSAL  348

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            DFLE  PDL  L+RG NYFASPNLNINSWTRLPVH++DFGWGRPI MGPA ILYEGT+YI
Sbjct  349  DFLETTPDLKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYI  408

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +PS   DR+LSLAVCLDA HM  F++ LY+F
Sbjct  409  IPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|AEK80405.1| HQT [Lonicera japonica]
Length=439

 Score =   329 bits (843),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 184/211 (87%), Gaps = 5/211 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
             STA+LK++ +QL  LK K+K+EG     STYEILAAH+WRCACKAR L+ +Q++KLY+A
Sbjct  229  VSTAILKLSLDQLTTLKAKAKNEGNGKDHSTYEILAAHLWRCACKARDLSANQTSKLYIA  288

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGRSRLCPPLPPGYLGNVVFTATPMA+S +LQ+EP+T++AKRIH++L+RMD+EYLRSAL
Sbjct  289  TDGRSRLCPPLPPGYLGNVVFTATPMADSGDLQAEPVTSTAKRIHNSLTRMDNEYLRSAL  348

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            DFLE  PDL  L+RG NYFASPNLNINSWTRLPVH++DFGWGRPI MGPA ILYEGT+YI
Sbjct  349  DFLETTPDLKTLVRGPNYFASPNLNINSWTRLPVHDADFGWGRPIFMGPASILYEGTIYI  408

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +PS   DR+LSLAVCLDA HM  F++ LY+F
Sbjct  409  IPSTTNDRSLSLAVCLDAGHMARFEKCLYEF  439



>gb|ABK79689.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 185/210 (88%), Gaps = 4/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGS----TYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            ASTAML++T +Q+  LK+K+K +GS    TYEILAAH+WRCAC+ARGL+DDQ TKLYVAT
Sbjct  225  ASTAMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACEARGLSDDQPTKLYVAT  284

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLPPGYLGNVVFTATP+A+S E +SE L ++A+RIHS L++MDD+YLRSA+D
Sbjct  285  DGRSRLNPPLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHSELAKMDDQYLRSAID  344

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RG  YFASPNLNINSWTRLP++ESDFGWGRPI MGPA ILYEGT+YI+
Sbjct  345  YLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYII  404

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PSP+ DR++SLAVCLD +HM LF++ LYDF
Sbjct  405  PSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>emb|CAR92145.1| hydroxycinnamoyl CoA quinate transferase 2 [Cynara cardunculus 
var. scolymus]
Length=443

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 185/218 (85%), Gaps = 4/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEG----STYEILAAHIWRCACKARGLTDDQ  601
            P S   S +ST MLK+T +QL  LK K+K E     STYEILAAHIWRCACKARGL DDQ
Sbjct  226  PGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDDQ  285

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             +KLYVATDGRSRL P LPPGY+GNVVFTATP+A+S +L S+ L+N+AK IH+ L++MDD
Sbjct  286  LSKLYVATDGRSRLSPRLPPGYVGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMDD  345

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSA+D+LE QPDLS LIRG +YFASPNLNIN+WTRLPV+++DFGWGRPI MGPACIL
Sbjct  346  DYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADFGWGRPIFMGPACIL  405

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEGT+Y+LPSPN DR++SLAVCLDA   PLF++FLY+F
Sbjct  406  YEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|ADL62854.1| hydroxycinnamoyl-CoA transferase 1 [Cynara cardunculus var. scolymus]
Length=443

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 4/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEG----STYEILAAHIWRCACKARGLTDDQ  601
            P S   S +ST MLK+T +QL  LK K+K E     STYEILAAHIWRCACKARGL DDQ
Sbjct  226  PGSGSLSKSSTTMLKLTLDQLNSLKAKAKSESGSTHSTYEILAAHIWRCACKARGLPDDQ  285

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             +KLYVATDGRSRL P LPPGYLGNVVFTATP+A+S +L S+ L+N+AK IH+ L++MDD
Sbjct  286  LSKLYVATDGRSRLSPRLPPGYLGNVVFTATPVAKSGDLTSKSLSNTAKLIHTTLTKMDD  345

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSA+D+LE QPDLS LIRG +YFASPNLNIN+WTRLPV+++D GWGRPI MGPACIL
Sbjct  346  DYLRSAIDYLESQPDLSALIRGPSYFASPNLNINAWTRLPVYDADLGWGRPIFMGPACIL  405

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEGT+Y+LPSPN DR++SLAVCLDA   PLF++FLY+F
Sbjct  406  YEGTIYVLPSPNNDRSVSLAVCLDANEQPLFEKFLYEF  443



>gb|AEM63676.1| hydroxycinnamoyl CoA quinate hydroxycinnamoyl transferase [Platycodon 
grandiflorus]
Length=443

 Score =   326 bits (835),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 185/212 (87%), Gaps = 6/212 (3%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGST------YEILAAHIWRCACKARGLTDDQSTKLYV  583
             STA+LK+T +QL  LK K+K++G+T      Y ILAAH+WRCACKARGL DDQ TKLYV
Sbjct  232  VSTAILKLTLDQLNELKAKTKNDGNTREQYSSYVILAAHLWRCACKARGLPDDQLTKLYV  291

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGR RL P LPPGYLGNVVFTATP+AES E+ S+PL+NSAK+IH+AL++MDDEYLRSA
Sbjct  292  ATDGRFRLSPTLPPGYLGNVVFTATPVAESGEIVSQPLSNSAKKIHNALAKMDDEYLRSA  351

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDL  LIRG NYFA PNLNINSWTRLP++++DFGWGRPI MGPA ILYEGT+Y
Sbjct  352  LDYLESQPDLGALIRGPNYFACPNLNINSWTRLPIYDADFGWGRPIFMGPASILYEGTIY  411

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            ++PSP+ +R++SLA+CL+A+HMPLF+++LY+F
Sbjct  412  VIPSPDNNRSVSLALCLEADHMPLFEKYLYEF  443



>gb|AFL93687.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl-transferase [Cynara 
cardunculus var. scolymus]
Length=434

 Score =   325 bits (834),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGS----TYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            AST ML++T +Q+  LK+K+K +GS    TYEILAAH+WRCACKARGL+DDQ TKLYVAT
Sbjct  225  ASTTMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACKARGLSDDQPTKLYVAT  284

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLPPGYLGNVVFTATP+A+S E +SE L ++A+RIH  L++MDD+YLRSA+D
Sbjct  285  DGRSRLSPPLPPGYLGNVVFTATPIAKSGEFKSESLADTARRIHIELAKMDDQYLRSAID  344

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RG  YFASPNLNINSWTRLP++ESDFGWGRPI MGPA ILYEGT+YI+
Sbjct  345  YLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYII  404

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PSP+ DR++SLAVCLD +HM LF++ LYDF
Sbjct  405  PSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ACF37072.1| hydroxycinnamoyl CoA quinate transferase 1 [Cynara cardunculus 
var. scolymus]
 emb|CAM84302.2| hydroxycinnamoyl CoA quinate transferase [Cynara cardunculus 
var. scolymus]
Length=449

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 184/219 (84%), Gaps = 7/219 (3%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGS-----TYEILAAHIWRCACKARGLTDD  604
            PES R    ST +LK+T +QL VLK  +K++GS     TYEILAAH+WRCACKARGL DD
Sbjct  233  PESSR--KPSTTVLKLTLDQLNVLKASAKNDGSNTTYSTYEILAAHLWRCACKARGLPDD  290

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLYVATDGRSRL P LPPGYLGNVVFT TP+A+S +L ++ L+N+A  I + L++MD
Sbjct  291  QLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMD  350

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            + YLRSA+D+LE QPDLS LIRG +YFASPNLNIN+WTRLPVH++DFGWGRP+ MGPACI
Sbjct  351  NNYLRSAIDYLEVQPDLSALIRGPSYFASPNLNINTWTRLPVHDADFGWGRPVFMGPACI  410

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            LYEGT+Y+LPSPN DR++SLAVCLDA+  PLF++FLYDF
Sbjct  411  LYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  449



>gb|AGE10604.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera hypoglauca]
Length=296

 Score =   318 bits (816),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/223 (66%), Positives = 184/223 (83%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            + + P      + STA+LK+T +QL  LK+ +K++G     STYE+LAAH+WRCACKARG
Sbjct  74   MNTAPAQSSPKAVSTAILKLTLDQLNNLKSTAKNDGTTKDYSTYEVLAAHLWRCACKARG  133

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L  DQ +KLY+ATDGR+RLC PLP GYLGNVVFTATPMA S +L +EP+ +S++RIHSAL
Sbjct  134  LAKDQMSKLYIATDGRARLCSPLPFGYLGNVVFTATPMAVSGDLVAEPIIDSSRRIHSAL  193

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            ++MD+ YLRSALD+LE  PDL  L+RG +YFASPNLNINSW+RLPV+++DFGWGRPI MG
Sbjct  194  TQMDNGYLRSALDYLELLPDLKALVRGPHYFASPNLNINSWSRLPVYDADFGWGRPIFMG  253

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PA ILYEGT+YI+PSP  DR+LSLAVCLD  HMPLFK++LY+F
Sbjct  254  PASILYEGTIYIIPSPTNDRSLSLAVCLDVGHMPLFKKYLYEF  296



>gb|ABK79690.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus var. altilis]
Length=434

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 183/210 (87%), Gaps = 4/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEGS----TYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            ASTAML++T +Q+  LK+K+K +GS    TYEILAAH+WRCAC+ARGL+DDQ TKLYVAT
Sbjct  225  ASTAMLRLTLDQINGLKSKAKGDGSVYHSTYEILAAHLWRCACEARGLSDDQPTKLYVAT  284

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLPPGYLGNVVF ATP+A+S E +SE L ++A+RIHS L++M D+YLRSA+D
Sbjct  285  DGRSRLNPPLPPGYLGNVVFKATPIAKSGEFKSESLADTARRIHSELAKMGDQYLRSAID  344

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RG  YFASPNLNINSWTRLP++ESDFGWGRPI MGPA ILYEGT+YI+
Sbjct  345  YLELQPDLTALVRGPTYFASPNLNINSWTRLPIYESDFGWGRPIFMGPASILYEGTIYII  404

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PSP+ DR++SLAVCLD +HM LF++ LYDF
Sbjct  405  PSPSGDRSVSLAVCLDPDHMSLFRKCLYDF  434



>gb|ADL62855.1| hydroxycinnamoyl-CoA transferase 2 [Cynara cardunculus var. scolymus]
Length=432

 Score =   322 bits (825),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 183/219 (84%), Gaps = 7/219 (3%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGS-----TYEILAAHIWRCACKARGLTDD  604
            PES R    ST +LK+T +QL VLK  +K++GS     TYEILAAH+WRCACKARGL DD
Sbjct  216  PESSR--KPSTTVLKLTLDQLNVLKASTKNDGSNTTYSTYEILAAHLWRCACKARGLPDD  273

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLYVATDGRSRL P LPPGYLGNVVFT TP+A+S +L ++ L+N+A  I + L++MD
Sbjct  274  QLTKLYVATDGRSRLSPQLPPGYLGNVVFTTTPVAKSGDLTTQSLSNAASLIRTTLTKMD  333

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            + YLRSA+D+ E QPDLS LIRG +YFASPNLNIN+WTRLPVH++DFGWGRP+ MGPACI
Sbjct  334  NNYLRSAIDYPEVQPDLSALIRGPSYFASPNLNINTWTRLPVHDADFGWGRPVFMGPACI  393

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            LYEGT+Y+LPSPN DR++SLAVCLDA+  PLF++FLYDF
Sbjct  394  LYEGTIYVLPSPNNDRSMSLAVCLDADEQPLFEKFLYDF  432



>gb|AGE10615.1| hydroxycinnamoyl-CoA quinate hydroxycinnamoyl transferase, partial 
[Lonicera macranthoides]
Length=276

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 180/211 (85%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            + STA+LK+T +QL  LK+ +K++G     STYE+LAAH+WRCACKARGL  DQ +KLY+
Sbjct  66   AVSTAILKLTLDQLNNLKSTAKNDGTTKDYSTYEVLAAHLWRCACKARGLAKDQMSKLYI  125

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGR+RLCPPLP GYLGNVVFTATPMA S +L +EP+ +S++RIHSAL++MDD YLRSA
Sbjct  126  ATDGRARLCPPLPFGYLGNVVFTATPMAVSGDLVAEPIIDSSRRIHSALTQMDDGYLRSA  185

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE  PDL  L+RG +YFASPNLNINSW+RLPV+++DFGWGRPI MGPA ILYEGT+Y
Sbjct  186  LDYLELLPDLKALVRGPHYFASPNLNINSWSRLPVYDADFGWGRPIFMGPASILYEGTIY  245

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            I+PSP  DR+L LAVCLD  HMPLFK++LY+
Sbjct  246  IIPSPTNDRSLLLAVCLDVGHMPLFKKYLYE  276



>ref|XP_002512739.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF49242.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=431

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 172/223 (77%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            LK+  E+ +  S + ++ K++ +QL +LK K+K +G+T     Y +LA H+WR ACKARG
Sbjct  209  LKASAETLKPDSTTVSIFKLSRDQLNILKAKAKEDGNTINYSSYAMLAGHVWRSACKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            LTDDQ TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +L+S+P   +A +IH AL
Sbjct  269  LTDDQETKLYIATDGRSRLNPPLPPGYFGNVIFTATPIAVAGDLESKPTWYAAGKIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMD++YLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  ARMDNDYLRSALDFLELQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +ILPSP  D +LS+A+ L +EHM LF++F+Y+ 
Sbjct  389  PGGIAYEGLSFILPSPTNDGSLSVAIALQSEHMKLFEKFIYEL  431



>gb|AFN85668.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Hibiscus cannabinus]
Length=431

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            L + P+S    S + ++ K+T EQL  LK KSK +G     S+YE+L+ H+WR  CKARG
Sbjct  209  LNTPPQSTGPESTAVSIFKLTREQLNALKAKSKEDGNSVNYSSYEMLSGHVWRSVCKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            LTDDQ TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +L  +P   +A RIH AL
Sbjct  269  LTDDQGTKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLMLKPTWYAASRIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMDDEYLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDDEYLRSALDFLELQPDLSALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  ++LPSPN D +LS+A+ L  EHM +F++  YD
Sbjct  389  PGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMKVFEKLFYD  430



>ref|XP_010265527.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=435

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 166/220 (75%), Gaps = 6/220 (3%)
 Frame = -3

Query  768  PESKRGSSASTA-MLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTD  607
            P S+ G  ++T  M KI+ +QL +LK KSK        S+YE+LA H+WRC CKARGL D
Sbjct  216  PNSQSGPESTTVTMFKISRDQLNILKAKSKDGANSVNYSSYEMLAGHVWRCVCKARGLPD  275

Query  606  DQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRM  427
            DQ TKLY+ATDGRSRL PPLPPGY GN +FTATP+A S +L S+PLT +A RIH AL RM
Sbjct  276  DQDTKLYIATDGRSRLRPPLPPGYFGNGIFTATPIAVSGDLLSKPLTYAAGRIHDALVRM  335

Query  426  DDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPAC  247
            DDEYLRSALD+LE QPDL+ L+RG++ F  PN+ I SW RLP+H++DFGWGRPI MGP  
Sbjct  336  DDEYLRSALDYLELQPDLTVLVRGAHTFRCPNIGITSWVRLPIHDADFGWGRPIFMGPGG  395

Query  246  ILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I YEG  ++LPSP  D  LSLA+ L ++HM +F++ LYDF
Sbjct  396  IAYEGLAFLLPSPVNDGNLSLAISLQSDHMKVFQKILYDF  435



>gb|AID69225.1| hydroxycinnamoyl coenzyme A shikimate hydroxycinnamoyl transferase, 
partial [Garcinia mangostana]
Length=367

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 165/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            LKS  ++ +  S   A+ K +  Q+  LK K+K  G+T     YE+LA H+WRC CKARG
Sbjct  145  LKSPSQTLKPDSTKVAIFKFSKGQISALKAKAKEAGNTVSYSSYEMLAGHVWRCTCKARG  204

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A RIH AL
Sbjct  205  LADDQETKLYIATDGRSRLRPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASRIHGAL  264

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            SRMD+EYLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  265  SRMDNEYLRSALDYLELQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMG  324

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +ILPS   D ++S+A+ L +EHM LF++ LYD 
Sbjct  325  PGGIAYEGLSFILPSATIDGSMSVAIALQSEHMKLFEKLLYDI  367



>ref|XP_002303858.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
 gb|EEE78837.2| hypothetical protein POPTR_0003s18210g [Populus trichocarpa]
Length=315

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 168/223 (75%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARG
Sbjct  91   MKTVLETSKPESTAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARG  150

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L
Sbjct  151  LPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSL  210

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  211  VRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  270

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +I+PS   D +LS+A+ L AEHM LF++F+YD 
Sbjct  271  PGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIYDI  313



>ref|XP_011018045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
 ref|XP_011018047.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Populus euphratica]
Length=430

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLT  610
            + P   +  +  T +LKITPEQLG LK K + E      STYE + AHIWR  CKARGL+
Sbjct  210  NTPPRSQPKTTCTKILKITPEQLGSLKAKVRTEDGAARHSTYETITAHIWRSMCKARGLS  269

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ++KLY++TDGRSRL P LPPGYLGNV+FT T M  S E+QS+PL  + +RIH AL R
Sbjct  270  DDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGR  329

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSALD++E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWGRP+ MGPA
Sbjct  330  MDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPA  389

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             +  EG  YIL SP  D +LSL +CL+A+HMPLF++ LYDF
Sbjct  390  RVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>ref|XP_002324534.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
 gb|EEF03099.1| hypothetical protein POPTR_0018s11450g [Populus trichocarpa]
Length=430

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLT  610
            + P   +  +  T +LKITPEQLG LK K + E      STYE + AHIWR  CKARGL+
Sbjct  210  NTPPQSQPKTTCTKILKITPEQLGSLKAKVRTEDGAVRHSTYETITAHIWRSMCKARGLS  269

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ++KLY++TDGRSRL P LPPGYLGNV+FT T M  S E+QS+PL  + +RIH AL R
Sbjct  270  DDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLARTMERIHEALVR  329

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSALD++E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWGRP+ MGPA
Sbjct  330  MDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPA  389

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             +  EG  YIL SP  D +LSL +CL+A+HMPLF++ LYDF
Sbjct  390  RVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  430



>ref|XP_011018044.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Populus euphratica]
Length=438

 Score =   285 bits (728),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLT  610
            + P   +  +  T +LKITPEQLG LK K + E      STYE + AHIWR  CKARGL+
Sbjct  218  NTPPRSQPKTTCTKILKITPEQLGSLKAKVRTEDGAARHSTYETITAHIWRSMCKARGLS  277

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ++KLY++TDGRSRL P LPPGYLGNV+FT T M  S E+QS+PL  + +RIH AL R
Sbjct  278  DDQASKLYISTDGRSRLNPQLPPGYLGNVLFTTTVMGLSGEIQSKPLVRTMERIHEALGR  337

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSALD++E QPDL+ L RG + +ASPNLNI SW RLPVH++DFGWGRP+ MGPA
Sbjct  338  MDDEYLRSALDYIEAQPDLNALKRGPHTYASPNLNIVSWIRLPVHDADFGWGRPVFMGPA  397

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             +  EG  YIL SP  D +LSL +CL+A+HMPLF++ LYDF
Sbjct  398  RVFCEGNAYILRSPVNDGSLSLFICLEAQHMPLFEKCLYDF  438



>gb|AEN02914.1| HCT1 [Populus nigra]
Length=297

 Score =   279 bits (714),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 168/223 (75%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARG
Sbjct  73   MKTVLETSKPESTAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARG  132

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L
Sbjct  133  LPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWCAAGKIHDSL  192

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  193  VRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  252

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +I+PS   D ++S+A+ L AEHM LF++F+YD 
Sbjct  253  PGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFIYDI  295



>ref|XP_011020577.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 169/222 (76%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+VPE+ +  S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR AC+ARG
Sbjct  209  MKAVPETSKPESTAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACQARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L
Sbjct  269  LPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +I+PS   D ++S+A+ L AEHM LF++F+YD
Sbjct  389  PGGIAYEGLSFIIPSSTNDGSMSVAISLQAEHMKLFEKFMYD  430



>gb|AFR67331.1| hydroxycinnamoyl CoA shikimate hydroxycinnamoyl transferase, 
partial [Leucaena leucocephala]
Length=274

 Score =   278 bits (710),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 159/213 (75%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            ++A+ ++ K+T  QL  LK KSK  G+T     YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  62   NTATVSIFKMTRAQLNALKAKSKEAGNTVNYSSYEMLAGHVWRSTCKARALPDDQETKLY  121

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL PPLPPGY GNV+FTATPMA + +L S+P   +A RIH+ALSRMD+EYLRS
Sbjct  122  IATDGRSRLQPPLPPGYFGNVIFTATPMAVAGDLMSKPTWFAASRIHNALSRMDNEYLRS  181

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALDFLE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  182  ALDFLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  241

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +ILPS   D +LS+A+ L  EHM +FKE LY+ 
Sbjct  242  FILPSSGNDGSLSVAIALQPEHMKVFKEVLYEI  274



>gb|ACC63882.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|AFZ78608.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=433

 Score =   281 bits (720),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 168/222 (76%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARG
Sbjct  209  MKTVLETSKPESTAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L
Sbjct  269  LPDDQETKLYIATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLRSALDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +I+PS   D +LS+A+ L AEHM LF++F+YD
Sbjct  389  PGGIAYEGLSFIIPSSTNDGSLSVAISLQAEHMKLFEKFIYD  430



>dbj|BAJ14794.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Ipomoea batatas]
Length=431

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 163/213 (77%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            S  + ++ K++ +Q+  LK KSK +G+T     YE+LA H+WRCAC+ARGLT+DQ TKLY
Sbjct  219  SDTAVSIFKLSRDQISALKAKSKEDGNTVAYSSYEMLAGHVWRCACRARGLTEDQETKLY  278

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL P LP GY GNV+FTATP+A + +LQS+P+  +A +IH AL RMD++YLRS
Sbjct  279  IATDGRSRLRPSLPTGYFGNVIFTATPIAVAGDLQSKPVWFAASKIHGALGRMDNDYLRS  338

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  339  ALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  398

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            ++LPSP  D +LS+A+ L  EHM LFKEFLYD 
Sbjct  399  FMLPSPENDGSLSIAISLQEEHMKLFKEFLYDI  431



>ref|XP_006493385.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Citrus 
sinensis]
Length=430

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 163/212 (77%), Gaps = 5/212 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K+T +QL +LK K+K +G+T     YE+LA H+WR AC ARGLT DQ TKLY+
Sbjct  219  TTAVSIFKLTRDQLNILKAKAKEDGNTINYSSYEMLAGHVWRSACIARGLTADQETKLYI  278

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGR+RL PPLPPGY GNV+FTATPMA + +LQS+P+  +A RIH AL RMD++YLRSA
Sbjct  279  ATDGRARLRPPLPPGYFGNVIFTATPMAVTGDLQSKPIWYAASRIHDALVRMDNDYLRSA  338

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  339  LDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  398

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I+PSP  D +LS+A+ L  EHM LF++ +YD 
Sbjct  399  IIPSPTNDGSLSVAISLQTEHMKLFEKLIYDI  430



>gb|AHA14500.1| hydroxycinnamoyl-coenzyme A quinate transperase [Fagopyrum tataricum]
Length=435

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 166/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            LK+  E      A+ A+ KI+ EQ+  LK KSK +G+T     YE+L+ H+WRC C+ARG
Sbjct  213  LKNPTEPSTPEEATVAIFKISREQISTLKAKSKEDGNTIPYSSYEMLSGHVWRCVCQARG  272

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L +DQ TKLY+ATDGRSRL P LPPGY GNV+FT TP+A++ +L S+P   +A RIH AL
Sbjct  273  LENDQGTKLYIATDGRSRLNPTLPPGYFGNVIFTTTPVAQAGDLASKPTWYAASRIHDAL  332

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMD+EYLRSALD+LE QPDL+ L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MG
Sbjct  333  ARMDNEYLRSALDYLELQPDLTALVRGAHTFRCPNLGITSWTRLPIHDADFGWGRPIFMG  392

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  Y+LPSP  D +LSLA+ L  EHM LF ++LY+ 
Sbjct  393  PGGIPYEGLAYMLPSPVNDGSLSLAIALQPEHMKLFSKYLYEI  435



>pdb|4G22|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
 pdb|4G22|B Chain B, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 1)
Length=439

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 11/220 (5%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            SVPE+      + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACKARGL 
Sbjct  225  SVPET------AVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLE  278

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
             DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH AL+R
Sbjct  279  VDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALAR  338

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  339  MDNDYLRSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPG  398

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  399  GIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  438



>pdb|4G2M|A Chain A, Structure Of A Lys-Hct Mutant From Coffea Canephora 
(Crystal Form 2)
Length=439

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 165/220 (75%), Gaps = 11/220 (5%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            SVPE+      + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACKARGL 
Sbjct  225  SVPET------AVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACKARGLE  278

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
             DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH AL+R
Sbjct  279  VDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIHDALAR  338

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  339  MDNDYLRSALDYLELQPDLKALVRGAHTFKXPNLGITSWVRLPIHDADFGWGRPIFMGPG  398

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  399  GIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  438



>gb|AFZ78609.1| hydroxycinnamoyl-CoA:shikimate/quinate hydroxycinnamoyl transferase 
[Populus tomentosa]
Length=431

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 169/222 (76%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K++ +QL  LK K+K +G     S+YE+LAAH+WR  CKAR 
Sbjct  209  MKTVLETSKPESTAVSIFKLSRDQLSTLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARE  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH AL
Sbjct  269  LPDDQETKLYIATDGRSRLRPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  389  PGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  430



>gb|ABO77955.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACK
Sbjct  209  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACK  268

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH
Sbjct  269  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIH  328

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  329  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  388

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  389  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  433



>emb|CDO98242.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACK
Sbjct  209  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACK  268

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH
Sbjct  269  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIH  328

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  329  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  388

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  389  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  433



>pdb|4G0B|A Chain A, Structure Of Native Hct From Coffea Canephora
 pdb|4G0B|B Chain B, Structure Of Native Hct From Coffea Canephora
Length=436

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACK
Sbjct  211  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACK  270

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH
Sbjct  271  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIH  330

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  331  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  390

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  391  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  435



>gb|ABO47805.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea canephora]
Length=434

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 167/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACK
Sbjct  209  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACK  268

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH
Sbjct  269  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIH  328

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  329  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  388

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  389  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  433



>gb|KJB56501.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56503.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
 gb|KJB56504.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=431

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K  P+S    S + ++ K+T +QL  LK K K +G     S+YE+L+ H+WR  CKARG
Sbjct  209  MKIPPQSTGPESTAISIFKLTRDQLNALKAKCKEDGNDVNYSSYEMLSGHVWRSVCKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGR+RL PPLPPGY GNV+FTATP+A + +L S+P   +A RIH AL
Sbjct  269  LEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMDDEYLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDDEYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPSPN D +LS+A+ L  EHM +F++  YD 
Sbjct  389  PGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFYDI  431



>gb|AGA20364.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Leucaena leucocephala]
Length=439

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 159/212 (75%), Gaps = 5/212 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            ++A+ ++ K+T  QL  LK KSK  G+T     YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  227  NTATVSIFKMTRAQLNALKAKSKEAGNTVNYSSYEMLAGHVWRSTCKARALPDDQETKLY  286

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL PPLPPGY GNV+FTATPMA + +L S+P   +A RIH+ALSRMD+EYLRS
Sbjct  287  IATDGRSRLQPPLPPGYFGNVIFTATPMAVAGDLMSKPTWFAASRIHNALSRMDNEYLRS  346

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALDFLE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  347  ALDFLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLS  406

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +ILPS   D +LS+A+ L  EHM +FKE LY+
Sbjct  407  FILPSSGNDGSLSVAIALQPEHMKVFKEVLYE  438



>gb|AEM63675.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl transferase 
[Platycodon grandiflorus]
Length=434

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 162/222 (73%), Gaps = 11/222 (5%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            +SVPE++       ++ K+T EQL  LK KSK +G+T     YE+L+ H+WRC CKARGL
Sbjct  219  QSVPETE------ISIFKLTREQLNALKAKSKEDGNTVSYSSYEMLSGHVWRCVCKARGL  272

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
             DDQ TKLY+ATDGRSRL P LPPGY GNV+FT TP A + +L S+P   +A RIH AL 
Sbjct  273  PDDQDTKLYIATDGRSRLQPVLPPGYFGNVIFTTTPTAVAGDLTSKPTWYAASRIHDALG  332

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
            RMD+EYLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP
Sbjct  333  RMDNEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGP  392

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  ++LPS   D +LS+A+ L AEHM LF +FLYD 
Sbjct  393  GGIAYEGLSFVLPSTTNDGSLSIAISLQAEHMKLFSKFLYDI  434



>ref|XP_007023475.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 ref|XP_007023476.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26097.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
 gb|EOY26098.1| Hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
isoform 1 [Theobroma cacao]
Length=431

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 165/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            + + P+S    S + ++ K+T EQL  LK KSK +G+T     YE+L+ H+WR  CKARG
Sbjct  209  MNTPPQSTGPESTAVSIFKLTREQLNALKAKSKEDGNTVNYSSYEMLSGHVWRSVCKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L  DQ TKLY+ATDGR+RL PPLPPGY GNV+FTATP+A + +L S+P   +A  IH AL
Sbjct  269  LAGDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAAGTIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMDD+YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  ARMDDDYLRSALDYLELQPDLSALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPSP  D +LS+A+ L AEHM LF++ +YD 
Sbjct  389  PGGIPYEGLSFVLPSPTNDGSLSVAISLQAEHMKLFEKLIYDI  431



>ref|XP_010063596.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063597.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70836.1| hypothetical protein EUGRSUZ_F03978 [Eucalyptus grandis]
Length=454

 Score =   278 bits (710),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 171/226 (76%), Gaps = 8/226 (4%)
 Frame = -3

Query  780  LKSVPESKRGS--SASTAMLKITPEQLGVLKTKSKHEG------STYEILAAHIWRCACK  625
            L+  PE+   +  S + ++ K+T EQL  LKT+++ E       S+YEILA H+WRCAC+
Sbjct  216  LRVSPETTNSAPYSTTVSIFKVTREQLDTLKTQAELENGNITSYSSYEILAGHVWRCACR  275

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL+DDQ +KLY+ATDGR RL PPLP GY GNV+FTATP+A + +L S+P++ +A++I 
Sbjct  276  ARGLSDDQDSKLYIATDGRMRLSPPLPRGYFGNVIFTATPIAVAGDLISKPVSYAAQKIR  335

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             +L+RMDD+YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  336  ESLARMDDDYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPI  395

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             MGP  I YEG  +ILPS   D +LS+A+ L  EHM LF++FLYDF
Sbjct  396  FMGPGGIAYEGLSFILPSSTSDGSLSVAISLQTEHMKLFEKFLYDF  441



>ref|XP_006368492.1| transferase family protein [Populus trichocarpa]
 gb|ACC63883.1| quinate O-hydroxycinnamoyltransferase/shikimate O-hydroxycinnamoyltransferase 
[Populus trichocarpa]
 gb|ERP65061.1| transferase family protein [Populus trichocarpa]
Length=431

 Score =   276 bits (707),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 168/222 (76%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K++ +QL  LK K+K +G     S+YE+LAAH+WR  CKAR 
Sbjct  209  MKTVLETSKPESTAVSIFKLSRDQLSTLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARE  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   +A +IH AL
Sbjct  269  LPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGKIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  389  PGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  430



>gb|ACA64049.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Salvia miltiorrhiza]
Length=427

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 160/208 (77%), Gaps = 5/208 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T EQL  LK KSK +G+T     YE+LA HIWRCAC ARGL +DQSTKLY+ATD
Sbjct  219  VSIFKLTREQLTTLKAKSKDDGNTVTHSSYEMLAGHIWRCACLARGLPEDQSTKLYIATD  278

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GR RL PPLPPGY GNV+FTATPMA + +L+S+P    A +IH AL+RMD+EYLRSALD+
Sbjct  279  GRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRSALDY  338

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  339  LELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  398

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            SP  D +LS+A+ L A+HM +F++ LY+
Sbjct  399  SPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ADG46003.1| hydroxycinnamoyl transferase [Salvia miltiorrhiza]
Length=427

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 160/208 (77%), Gaps = 5/208 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T EQL  LK KSK +G+T     YE+LA HIWRCAC ARGL +DQSTKLY+ATD
Sbjct  219  VSIFKLTREQLTTLKAKSKDDGNTVTYSSYEMLAGHIWRCACLARGLPEDQSTKLYIATD  278

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GR RL PPLPPGY GNV+FTATPMA + +L+S+P    A +IH AL+RMD+EYLRSALD+
Sbjct  279  GRFRLQPPLPPGYFGNVIFTATPMAVAGDLESKPAWYGASKIHDALARMDNEYLRSALDY  338

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  339  LELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  398

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            SP  D +LS+A+ L A+HM +F++ LY+
Sbjct  399  SPANDGSLSVAISLQADHMKVFEKLLYE  426



>gb|ACI16630.1| shikimate O-hydroxycinnamoyltransferase [Trifolium pratense]
Length=434

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 164/225 (73%), Gaps = 7/225 (3%)
 Frame = -3

Query  780  LKSVPESKRGSS--ASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            +K+  +S +  S  A+ ++ K+T EQL  LK KSK  G+T     YE+LA H+WR  CKA
Sbjct  210  MKTTQQSTKPGSDGAAVSIFKLTREQLSTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKA  269

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L DDQ TKLY+ATDGR+RL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+
Sbjct  270  RSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHN  329

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            ALSRMD+EYLRSALDFLE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI 
Sbjct  330  ALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIF  389

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  I YEG  +I+PS   D +LS+A+ L  EHM +FKEFLYD 
Sbjct  390  MGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLYDI  434



>gb|KHN38057.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=279

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 5/218 (2%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +    +SA+ ++ ++T +QL  LK KSK +G+T     YE+LA H+WR   KAR L DDQ
Sbjct  62   QQATNASAAVSIFRLTRDQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVSKARALPDDQ  121

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD+
Sbjct  122  ETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDN  181

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I 
Sbjct  182  DYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIA  241

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEG  +I+PS   D +LS+A+ L  +HM LFK+FLYD 
Sbjct  242  YEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLYDI  279



>emb|CAJ40778.1| hydroxycinnamoyl transferase [Coffea arabica]
Length=434

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 166/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK K K +G+T     YE+LA H+WRCACK
Sbjct  209  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKPKEDGNTISYSSYEMLAGHVWRCACK  268

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +L+ +P+  +A +IH
Sbjct  269  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATPIAIAGDLEFKPVWYAASKIH  328

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  329  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  388

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  389  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  433



>gb|AHG97388.1| putative hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyl 
transferase [Gossypium hirsutum]
 gb|KJB56502.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=499

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K  P+S    S + ++ K+T +QL  LK K K +G     S+YE+L+ H+WR  CKARG
Sbjct  277  MKIPPQSTGPESTAISIFKLTRDQLNALKAKCKEDGNDVNYSSYEMLSGHVWRSVCKARG  336

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGR+RL PPLPPGY GNV+FTATP+A + +L S+P   +A RIH AL
Sbjct  337  LEDDQGTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDAL  396

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMDDEYLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  397  VRMDDEYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  456

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  ++LPSPN D +LS+A+ L  EHM +F++  YD
Sbjct  457  PGGIPYEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFYD  498



>ref|XP_007215401.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
 gb|EMJ16600.1| hypothetical protein PRUPE_ppa005910mg [Prunus persica]
Length=438

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 165/225 (73%), Gaps = 7/225 (3%)
 Frame = -3

Query  780  LKSVPESKR--GSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            +K+ P+S +    S + ++ ++T EQL +LK KSK  G+T     YE++A HIWRC CKA
Sbjct  214  MKTPPQSTKPGADSTTVSIFRLTREQLNILKAKSKEAGNTVSYSSYEMMAGHIWRCVCKA  273

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L +DQ TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A RIH 
Sbjct  274  RELPNDQDTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAAAGDLQSKPTWFAASRIHD  333

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            +L RMDD YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI 
Sbjct  334  SLVRMDDNYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIF  393

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  I +EG  +++PS   D +LS+A+ L +EHM  F + LYD 
Sbjct  394  MGPGGIAFEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLYDI  438



>ref|XP_011034568.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=431

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 167/222 (75%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K++ +QL  LK K+  +G     S+YE+LAAH+WR  CKAR 
Sbjct  209  MKTVLETSKPESTAVSIFKLSRDQLSTLKAKANEDGNNISYSSYEMLAAHVWRSTCKARE  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   +A +IH AL
Sbjct  269  LPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTCYAAGKIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  389  PGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  430



>emb|CDG56248.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 1 
[Glechoma hederacea]
Length=434

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            +K+       +    ++ K+T EQL  LK KSK +G+T     YE+LA H+WRCAC AR 
Sbjct  212  MKTYGAGHYATETVVSIFKLTREQLTTLKAKSKEDGNTVTYSSYEMLAGHVWRCACLARS  271

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L +DQ TKLY+ATDGR+RL PPLP GY GNV+FTATP+A + +L+S+P+  +A +IH AL
Sbjct  272  LPEDQDTKLYIATDGRARLQPPLPQGYFGNVIFTATPLAVAGDLESKPVWYAASKIHDAL  331

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMD+EYLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  332  ARMDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  391

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPSP  D +LS+A+ L AEHM LF++ LYD 
Sbjct  392  PGGIAYEGLSFVLPSPANDGSLSVAISLQAEHMKLFEKLLYDI  434



>ref|XP_009615699.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
tomentosiformis]
 sp|Q8GSM7.1|HST_TOBAC RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Nicotiana tabacum]
 emb|CAD47830.1| hydroxycinnamoyl transferase [Nicotiana tabacum]
Length=435

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 167/227 (74%), Gaps = 9/227 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA----STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCAC  628
            LK  PE+   S A    S ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C
Sbjct  209  LKVTPENTPISEAVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTC  268

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             ARGL  DQ TKLY+ATDGRSRL P LPPGY GNV+FT TP+A + ++QS+P+  +A ++
Sbjct  269  MARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKL  328

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
            H AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRP
Sbjct  329  HDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRP  388

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I MGP  I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYDF
Sbjct  389  IFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|XP_011467012.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 164/218 (75%), Gaps = 6/218 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +K G+  +T ++ K+T EQL  LK KSK +G+T     YE+LA H+WRC CKAR L DDQ
Sbjct  220  TKPGAEETTISIFKLTREQLNTLKAKSKEDGNTVNYSSYEMLAGHVWRCVCKARDLPDDQ  279

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A +IH+AL RMD+
Sbjct  280  DTKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWYAASKIHNALVRMDN  339

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I 
Sbjct  340  DYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIG  399

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEG  +++PS   D +LS+A+ L +EHM  F + LYD 
Sbjct  400  YEGLAFVIPSATNDGSLSVAISLQSEHMKSFSKLLYDI  437



>gb|ACI28534.1| shikimate O-hydroxycinnamoyl transferase [Trifolium pratense]
Length=434

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 164/225 (73%), Gaps = 7/225 (3%)
 Frame = -3

Query  780  LKSVPESKRGSS--ASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            +K+  +S +  S  A+ ++ K+T EQL  LK KSK  G+T     YE+LA H+WR  CKA
Sbjct  210  MKTTQQSTKPGSDGAAVSIFKLTREQLSTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKA  269

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L DDQ TKLY+ATDGR+RL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+
Sbjct  270  RSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHN  329

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            ALSRMD++YLRSALDFLE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI 
Sbjct  330  ALSRMDNDYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIF  389

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  I YEG  +I+PS   D +LS+A+ L  EHM +FKEFLYD 
Sbjct  390  MGPGGIAYEGLSFIIPSSTNDGSLSVAIALQHEHMKVFKEFLYDI  434



>ref|XP_010094061.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55151.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=447

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 5/218 (2%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +S+     +  M K+T EQL  LKTKSK  G+T     Y +L+ H+WRCACKAR L +DQ
Sbjct  230  DSQSSPETAVGMFKMTREQLNTLKTKSKENGNTINYSSYAMLSGHVWRCACKARELPEDQ  289

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL PPLPPGY GNV+FTATPMA + ++QS+P   +A RIH  L+RMD+
Sbjct  290  ETKLYIATDGRSRLQPPLPPGYFGNVIFTATPMAMAGDIQSKPTWYAASRIHDTLARMDN  349

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QP LS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I+
Sbjct  350  DYLRSALDYLELQPSLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIM  409

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +EG  ++LPSP  D +LS+A+ L  +HM  F++ LYD 
Sbjct  410  FEGLAFMLPSPANDGSLSVAIGLQPQHMKAFEKLLYDI  447



>gb|ABO40491.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Coffea arabica]
Length=434

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 166/225 (74%), Gaps = 8/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA---STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACK  625
            LK  P++ +  S    + ++ K+T EQ+  LK KSK +G+T     YE+LA H+WRCACK
Sbjct  209  LKVSPQTAKSDSVPETAVSIFKLTREQISALKAKSKEDGNTISYSSYEMLAGHVWRCACK  268

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL  DQ TKLY+ATDGR+RL P LPPGY GNV+FTAT +A + +L+ +P+  +A +IH
Sbjct  269  ARGLEVDQGTKLYIATDGRARLRPSLPPGYFGNVIFTATLIAIAGDLEFKPVWYAASKIH  328

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  329  DALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPI  388

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             MGP  I YEG  +ILPSP  D ++S+A+ L  EHM LF+ FLYD
Sbjct  389  FMGPGGIAYEGLSFILPSPTNDGSMSVAISLQGEHMKLFQSFLYD  433



>gb|KDP41953.1| hypothetical protein JCGZ_26971 [Jatropha curcas]
Length=431

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 168/223 (75%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            +K+  ++ +  S + ++ K+T +QL +LKTK+K +G+T     YE+LA H+WR A KARG
Sbjct  209  MKTPVDNSKPDSTTVSIFKLTRDQLNILKTKAKEDGNTVSYSSYEMLAGHVWRSASKARG  268

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L  DQ TKLY+ATDGRSRL PPLPPGY GNV+FTATP+A++ E+QS+P   +A++IH AL
Sbjct  269  LVGDQETKLYIATDGRSRLQPPLPPGYFGNVIFTATPIAQAGEMQSKPTWFAARKIHDAL  328

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPD S L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  329  VRMDNDYLRSALDYLELQPDPSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  388

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +ILPS   D +LS+A+ L  EHM LF++ +Y+ 
Sbjct  389  PGGIPYEGLSFILPSATNDGSLSVAIALQTEHMKLFEKLIYEI  431



>ref|NP_001289240.1| shikimate O-hydroxycinnamoyltransferase-like [Pyrus x bretschneideri]
 gb|AFF57841.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
3 [Pyrus x bretschneideri]
Length=438

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 163/218 (75%), Gaps = 7/218 (3%)
 Frame = -3

Query  762  SKRGSSAST--AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            +K G++ ST  ++ ++T +QL +LK+KSK  G+T     YE+L+ H+WRCACKAR L DD
Sbjct  220  AKPGAADSTTVSIFRLTRDQLNILKSKSKEAGNTVSYSSYEMLSGHVWRCACKARELPDD  279

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL PPLPPGY GNV+FT TP+A + ++QS+P   +A RIH  L RMD
Sbjct  280  QDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDIQSKPTWYAASRIHDGLVRMD  339

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I
Sbjct  340  DSYLRSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGI  399

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             +EG  +I+PS   D +LS+A+CL  EHM  F + LYD
Sbjct  400  AFEGLSFIIPSATNDGSLSVAICLQTEHMKSFSKLLYD  437



>ref|XP_011082506.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=432

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 159/210 (76%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K+T +QL  LK KSK  G+T     YE+LA H+WR  C ARGL +DQ TKLY+AT
Sbjct  223  AVSIFKLTRDQLNALKAKSKEGGNTVTYSSYEMLAGHVWRSVCMARGLPEDQDTKLYIAT  282

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLPPGY GNV+FTATP+A S +L S+P+  +A +IH AL+RMD++YLRSALD
Sbjct  283  DGRSRLQPPLPPGYFGNVIFTATPIAVSGDLTSKPVWYAASKIHDALARMDNDYLRSALD  342

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++L
Sbjct  343  YLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVL  402

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PSP  D +LS+A+ L AEHM LF++ LYD 
Sbjct  403  PSPTNDGSLSVAISLQAEHMKLFEKLLYDI  432



>ref|XP_011073311.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Sesamum indicum]
Length=433

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 156/209 (75%), Gaps = 5/209 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             A+LK+T  QL  LK KSK +G+T     YEILAAHIW CAC+ARGL D+Q TKL++AT+
Sbjct  225  VAILKLTRGQLNTLKAKSKEDGNTVTYSSYEILAAHIWVCACRARGLVDEQKTKLFIATN  284

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PPLPPGY GNV+FT TP+  S ELQS+P++ +A +IH  L RMDDEYLRSALD+
Sbjct  285  GRSRLRPPLPPGYFGNVIFTTTPVGVSGELQSKPISYTAGKIHDVLVRMDDEYLRSALDY  344

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG+N F  PNL I SW  LP+H++DFGWGRP+ MGP  ILYEG   +LP
Sbjct  345  LEVQPDLMALVRGANTFNCPNLAITSWVGLPIHDADFGWGRPVFMGPGSILYEGLCVVLP  404

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP  D +LS+AV L  E M +F++  YD 
Sbjct  405  SPTNDGSLSVAVSLQEEPMKVFEKLFYDI  433



>ref|XP_008342823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 163/218 (75%), Gaps = 7/218 (3%)
 Frame = -3

Query  762  SKRGSSAST--AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            +K G++ ST  ++ ++T +QL +LK KSK  G+T     YE+L+ H+WRCACKAR L DD
Sbjct  220  AKPGAADSTTVSIFRLTRDQLNILKYKSKEAGNTVSYSSYEMLSGHVWRCACKARELPDD  279

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKL++ATDGRSRL PPLPPGY GNV+FTATP+A + ++QS+P   +A RIH AL RMD
Sbjct  280  QDTKLFIATDGRSRLQPPLPPGYFGNVIFTATPIAXAGDIQSKPTWYAASRIHDALVRMD  339

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I
Sbjct  340  DSYLRSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGI  399

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             +EG  +I+PS   D +LSLA+ L  EHM  F + LYD
Sbjct  400  AFEGLAFIIPSATNDGSLSLAISLQTEHMKSFSKLLYD  437



>gb|KEH28560.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=433

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 161/218 (74%), Gaps = 6/218 (3%)
 Frame = -3

Query  762  SKRGS-SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +K GS  A+ ++ K+T EQL  LK KSK  G+T     YE+LA H+WR  CKAR L DDQ
Sbjct  216  TKPGSDGAAVSIFKLTREQLNTLKAKSKEAGNTIHYSSYEMLAGHVWRSVCKARSLPDDQ  275

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGR+RL PP PPGY GNV+FT TP+A + +L ++P   +A RIH+ALSRMD+
Sbjct  276  ETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMTKPTWYAASRIHNALSRMDN  335

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSALDFLE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I 
Sbjct  336  EYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIA  395

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEG  +I+PS   D +LS+A+ L  EHM +FK+FLYD 
Sbjct  396  YEGLSFIIPSSANDGSLSVAIALQHEHMKVFKDFLYDI  433



>ref|XP_009789449.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
 ref|XP_009783860.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Nicotiana 
sylvestris]
Length=435

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 165/227 (73%), Gaps = 9/227 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA----STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCAC  628
            LK  PE+          S ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C
Sbjct  209  LKVTPENTTNPEVVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTC  268

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             ARGL  DQ TKLY+ATDGRSRL P LPPGY GNV+FT TP+A + ++QS+P+  +A ++
Sbjct  269  MARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKL  328

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
            H AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRP
Sbjct  329  HDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRP  388

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I MGP  I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYDF
Sbjct  389  IFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDF  435



>ref|NP_001280198.1| shikimate O-hydroxycinnamoyltransferase-like [Prunus mume]
 dbj|BAE48668.1| Alcohol acyl-transferase [Prunus mume]
Length=438

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 158/212 (75%), Gaps = 5/212 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ ++T EQL +LK KSK  G+T     YE++A HIWRC CKAR L +DQ TKLY+
Sbjct  227  STTVSIFRLTREQLNILKAKSKEAGNTISYSSYEMMAGHIWRCVCKARELPNDQDTKLYI  286

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A RIH +L RMDD YLRSA
Sbjct  287  ATDGRSRLQPPLPPGYFGNVIFTATPIAVAGDLQSKPTWFAASRIHDSLVRMDDNYLRSA  346

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I +EG  +
Sbjct  347  LDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAFEGLAF  406

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            ++PS   D +LS+A+ L +EHM  F + LYD 
Sbjct  407  VIPSATNDGSLSVAISLQSEHMKSFSKLLYDI  438



>gb|AAZ80046.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Cynara 
cardunculus]
Length=436

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 164/222 (74%), Gaps = 11/222 (5%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            +SVPE+      + ++ K+T +Q+  LK KSK +G+T     YE+L+ H+WRC CKARGL
Sbjct  221  ESVPET------TVSIFKLTRDQVNALKGKSKEDGNTVNYSSYEMLSGHVWRCVCKARGL  274

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
             DDQ TKLY+ATDGR+RL P LP GY GNV+FT TP+A + +LQS+P   +A +IH AL+
Sbjct  275  PDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALA  334

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
            RMDD+YL+SALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP
Sbjct  335  RMDDDYLKSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGP  394

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  ++LPSP  D +LS+ + L AEHM LF +FLYD 
Sbjct  395  GGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLYDI  436



>ref|XP_004235891.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Solanum lycopersicum]
Length=435

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            ++VP ++     S ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C ARGL
Sbjct  214  ENVPNAETVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGL  273

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
            T DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +LQS+P+  +A +IH  L+
Sbjct  274  TQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLA  333

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
             MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRPI MGP
Sbjct  334  IMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGP  393

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYD 
Sbjct  394  GGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLYDI  435



>gb|AEO00530.1| hydroxycinnamoyl transferase [Nicotiana benthamiana]
Length=369

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 164/227 (72%), Gaps = 9/227 (4%)
 Frame = -3

Query  780  LKSVPESKRGSS----ASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCAC  628
            LK  PE+          S ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C
Sbjct  143  LKVTPENTTNPEIVPETSVSIFKLTRDQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTC  202

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             ARGL  DQ TKLY+ATDGRSRL P LPPGY GNV+FT TP+A + ++QS+P+  +A ++
Sbjct  203  MARGLAHDQETKLYIATDGRSRLRPSLPPGYFGNVIFTTTPIAVAGDIQSKPIWYAASKL  262

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
            H AL+RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRP
Sbjct  263  HDALARMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRP  322

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I MGP  I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYD 
Sbjct  323  IFMGPGGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDI  369



>gb|KHN04193.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=436

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 160/213 (75%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            ++A+ ++ ++T EQL  LK KSK +G+T     YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  224  AAAAVSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLY  283

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD++YLRS
Sbjct  284  IATDGRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRS  343

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I YEG  
Sbjct  344  ALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLS  403

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +I+PS   D +LS+A+ L  +HM +FK+FLYD 
Sbjct  404  FIIPSSTNDGSLSVAIALQPDHMKVFKDFLYDI  436



>ref|XP_004507046.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Cicer arietinum]
Length=436

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            ++A+ ++ K+T EQL  LK KSK  G+T     YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  224  ATAAVSIFKLTREQLVTLKAKSKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQETKLY  283

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGR+RL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+ALSRMD+EYLRS
Sbjct  284  IATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRS  343

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  344  ALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  403

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +I+PS   D +LS+A+ L  EHM +FKE LYD 
Sbjct  404  FIIPSSTNDGSLSVAIALQHEHMKVFKELLYDI  436



>ref|XP_004507045.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Cicer arietinum]
Length=449

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 158/213 (74%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
            ++A+ ++ K+T EQL  LK KSK  G+T     YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  237  ATAAVSIFKLTREQLVTLKAKSKEAGNTINYSSYEMLAGHVWRSVCKARSLPDDQETKLY  296

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGR+RL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+ALSRMD+EYLRS
Sbjct  297  IATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLMSKPTWYAASRIHNALSRMDNEYLRS  356

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  357  ALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  416

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +I+PS   D +LS+A+ L  EHM +FKE LYD 
Sbjct  417  FIIPSSTNDGSLSVAIALQHEHMKVFKELLYDI  449



>ref|XP_009760608.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009760609.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nicotiana 
sylvestris]
Length=432

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/223 (55%), Positives = 168/223 (75%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            LK++ +++     + ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C ARG
Sbjct  210  LKNIAKTEAVPETAVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARG  269

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L +DQ +KLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L+S+P+  +A +IH AL
Sbjct  270  LEEDQGSKLYIATDGRSRLRPILPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDAL  329

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            ++MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  330  AQMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  389

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  +ILPSP  D +LS+A+ L A+HM LF+++LYD 
Sbjct  390  PGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLYDI  432



>ref|XP_010034043.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
Length=492

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGS-SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +K G+ S + ++ K+T EQL  LK KSK +G+T     YE+LA H+WR ACKAR L  DQ
Sbjct  275  TKSGAESTAVSIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQ  334

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             +K+Y+ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A RIH AL RMD+
Sbjct  335  ESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDN  394

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I 
Sbjct  395  DYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIA  454

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  +ILPSP  D ++S+A+ L  EHM +F++ LY+
Sbjct  455  YEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  491



>ref|XP_003531748.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
1 [Glycine max]
 ref|XP_003531749.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
2 [Glycine max]
Length=429

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 5/218 (2%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +    +SA+ ++ ++T +QL  LK KSK +G+T     YE+LA H+WR   KAR L DDQ
Sbjct  212  QQATNASAAVSIFRLTRDQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVSKARALPDDQ  271

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD+
Sbjct  272  ETKLYIATDGRSRLQPPTPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDN  331

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I 
Sbjct  332  DYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIA  391

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEG  +I+PS   D +LS+A+ L  +HM LFK+FLYD 
Sbjct  392  YEGLSFIIPSSTNDGSLSVAIALQPDHMKLFKDFLYDI  429



>gb|KCW53914.1| hypothetical protein EUGRSUZ_J03126 [Eucalyptus grandis]
Length=497

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 164/217 (76%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGS-SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            +K G+ S + ++ K+T EQL  LK KSK +G+T     YE+LA H+WR ACKAR L  DQ
Sbjct  280  TKSGAESTAVSIFKMTREQLNKLKGKSKEDGNTVNYSSYEMLAGHVWRSACKARDLAVDQ  339

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             +K+Y+ATDGRSRL PPLPPGY GNV+FTATP+A + +LQS+P   +A RIH AL RMD+
Sbjct  340  ESKMYIATDGRSRLSPPLPPGYFGNVIFTATPLAVAGDLQSKPTWYAASRIHDALVRMDN  399

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            +YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I 
Sbjct  400  DYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIA  459

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  +ILPSP  D ++S+A+ L  EHM +F++ LY+
Sbjct  460  YEGLSFILPSPTNDGSMSVAISLQTEHMKVFEKLLYE  496



>gb|AFS68800.1| hydroxycinnamoyl transferase [Lonicera japonica]
Length=430

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 159/209 (76%), Gaps = 5/209 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T +Q+  LK KSK +G     S+YE++A H+WRC CKARGL +DQ TKLY+ATD
Sbjct  222  VSIFKLTRDQINSLKAKSKDDGNAIGYSSYEMMAGHLWRCVCKARGLPEDQETKLYIATD  281

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GR+RL P LPPGY GNV+FT TP+A + +LQS+P   +A RIH AL+RMD++YLRSALD+
Sbjct  282  GRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRSALDY  341

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  342  LELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  401

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP  D +LS+A+ L AEHM LF ++LY+ 
Sbjct  402  SPTNDGSLSVAISLQAEHMKLFAKYLYEI  430



>ref|XP_010527105.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Tarenaya 
hassleriana]
Length=399

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 164/220 (75%), Gaps = 6/220 (3%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            V  SK G   +T ++ K++ +QL  LK KSK EG+T     YE+L+ H+WR  CKARGL 
Sbjct  178  VDPSKAGPDNTTVSIFKLSRDQLNALKAKSKEEGNTINYSSYEMLSGHVWRSVCKARGLA  237

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ +KLY+ATDGRSRL PPLPPGY GNV+FTATP+A + +L S+P   +A +IH+AL R
Sbjct  238  DDQESKLYIATDGRSRLRPPLPPGYFGNVIFTATPVAVAGDLHSKPTWYAAGQIHNALVR  297

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD+EYLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  298  MDNEYLRSALDYLEMQPDLSALVRGAHTFKCPNLGITSWVRLPIHDADFGWGRPIFMGPG  357

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  ++LPS   D +LS+A+ L  EHM LF++ L+D
Sbjct  358  GIPYEGLSFVLPSSANDGSLSVAIALQTEHMKLFEKILHD  397



>dbj|BAF49306.1| putative acyltransferase [Clitoria ternatea]
Length=436

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 163/219 (74%), Gaps = 7/219 (3%)
 Frame = -3

Query  762  SKRGS--SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            +K GS  +A+ ++ K+T +QL  LK KSK +G+T     YE+LA H+WR  CKAR L +D
Sbjct  218  TKPGSDPTAAVSIFKLTRDQLTTLKAKSKEDGNTVNYSSYEMLAGHVWRSVCKARSLPED  277

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGR+RL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD
Sbjct  278  QETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMD  337

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            +EYLRSALDFLE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I
Sbjct  338  NEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGI  397

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             YEG  +I+PS   D +LS+A+ L  +HM +FK+FLYD 
Sbjct  398  AYEGLSFIIPSSTNDGSLSVAIALQPDHMKVFKDFLYDI  436



>ref|XP_009375480.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
 ref|XP_009375481.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=438

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 161/219 (74%), Gaps = 7/219 (3%)
 Frame = -3

Query  762  SKRGSSAST--AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            +K G++ +T  ++ ++T +QL +LK+KSK  G+T     YE+ + H+WRC CKAR L DD
Sbjct  220  AKPGAADTTTVSIFRLTRDQLNILKSKSKEAGNTVSYSSYEMFSGHVWRCVCKARELPDD  279

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL PPLPPGY GNV+FT TP+A + +LQS+P   +A RIH AL RMD
Sbjct  280  QDTKLYIATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSKPTWYAASRIHDALVRMD  339

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWG+PI MGP  I
Sbjct  340  DNYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGQPIFMGPGGI  399

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             +EG  ++LPS   D +LSLA+ L +EHM  F   LYD 
Sbjct  400  AFEGLAFVLPSATNDGSLSLAISLQSEHMKSFSRLLYDL  438



>emb|CDG56249.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase 2 
[Glechoma hederacea]
Length=430

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 157/209 (75%), Gaps = 5/209 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T EQL  LK KSK +G+T     YE+LA H+WRCAC AR L +DQ TKLY+ATD
Sbjct  222  VSIFKLTREQLTTLKAKSKEDGNTVTYSSYEMLAGHVWRCACLARSLPEDQDTKLYIATD  281

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GR+RL PPLP GY GNV+FT TP A + +L S+P+  +A +IH AL++MD+EYLRSALD+
Sbjct  282  GRARLQPPLPQGYFGNVIFTTTPQAVAGDLDSKPVWYAASKIHDALAQMDNEYLRSALDY  341

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  342  LELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  401

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP  D +LS+A+ L AEHM LF++ LYD 
Sbjct  402  SPANDGSLSVAISLQAEHMKLFEKLLYDI  430



>emb|CBI83579.1| hydroxycinnamoyl transferase [Solenostemon scutellarioides]
Length=427

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 158/207 (76%), Gaps = 5/207 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T +QL  LK KSK +G+T     YE+L+ H+WRC C ARGL ++Q TKLY+ATD
Sbjct  219  VSIFKLTKDQLTTLKAKSKEDGNTTTYSSYEMLSGHVWRCTCLARGLPEEQETKLYIATD  278

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL P LPPGY GNV+FTATP+A + +L S+P+  +A +IH AL+RMD++YLRSALDF
Sbjct  279  GRSRLQPQLPPGYFGNVIFTATPLAVAGDLGSKPVWYAASKIHDALARMDNDYLRSALDF  338

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  339  LELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  398

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLY  133
            SP  D +LS+A+ L AEHM LF++ LY
Sbjct  399  SPTNDGSLSVAISLQAEHMKLFEKLLY  425



>ref|XP_010063586.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063587.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063588.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063589.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70830.1| hypothetical protein EUGRSUZ_F03974 [Eucalyptus grandis]
Length=445

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 168/226 (74%), Gaps = 8/226 (4%)
 Frame = -3

Query  780  LKSVPESKRGS--SASTAMLKITPEQLGVLKTKSKHEG------STYEILAAHIWRCACK  625
            L+  PE+   +  S++ ++LK+T EQL  LKT++  E       ++YEILA H+WRCAC+
Sbjct  215  LRVSPETTNSAPDSSTVSILKVTREQLDALKTQAVLENGNTTRYTSYEILAGHVWRCACR  274

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL+DDQ TKL++ATDGR RL PPLP GY GN +FT TP+A + +L S+P++ +A++IH
Sbjct  275  ARGLSDDQDTKLFIATDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLISKPVSYAAQKIH  334

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             +L+R +D+YLRSALD+LE QPDLS L RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  335  ESLARTNDDYLRSALDYLELQPDLSALARGAHTFRCPNLGITSWVRLPIHDTDFGWGRPI  394

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +MGP  I YEG  YILPSP  D +LS+A+ L  EHM  F++F YD 
Sbjct  395  YMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEKFFYDL  440



>ref|XP_006341413.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 162/222 (73%), Gaps = 5/222 (2%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            ++ P +      S ++ K+T  Q+  LK KSK +G+T     YE+LA H+WR  C ARGL
Sbjct  214  ENAPNADTVPETSVSIFKLTRNQINTLKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGL  273

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
            T DQ TKLY+ATDGR+RL P LPPGY GNV+FTATP+A + +LQS+P+  +A +IH  L+
Sbjct  274  TQDQETKLYIATDGRARLRPSLPPGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLA  333

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
             MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRPI MGP
Sbjct  334  IMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGP  393

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYD 
Sbjct  394  GGIAYEGLSFILPSPINDGSQSVAISLQAEHMKLFEKFLYDI  435



>ref|XP_003530223.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006583084.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X4 [Glycine max]
Length=438

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 156/209 (75%), Gaps = 5/209 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ ++T EQL  LK KSK +G+T     YE+LA H+WR  CKAR L DDQ TKLY+ATD
Sbjct  230  VSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATD  289

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD++YLRSALD+
Sbjct  290  GRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALDY  349

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I YEG  +I+P
Sbjct  350  LELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIP  409

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            S   D +LS+A+ L  +HM +FK+FLYD 
Sbjct  410  SSTNDGSLSVAIALQPDHMKVFKDFLYDI  438



>ref|XP_009626781.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=432

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            L ++ +++       ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C ARG
Sbjct  210  LNNIAKTEAVPETDVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARG  269

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L +DQ +KLY+ATDGR RL P LPPGY GNV+FTATP+A + +L+S+P+  +A +IH AL
Sbjct  270  LEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDAL  329

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  330  ARMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  389

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +ILPSP  D +LS+A+ L A+HM LF+++LYD
Sbjct  390  PGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLYD  431



>ref|XP_009626780.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARG  616
            L ++ +++       ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C ARG
Sbjct  217  LNNIAKTEAVPETDVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARG  276

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L +DQ +KLY+ATDGR RL P LPPGY GNV+FTATP+A + +L+S+P+  +A +IH AL
Sbjct  277  LEEDQGSKLYIATDGRFRLRPTLPPGYFGNVIFTATPIAVAGDLKSKPIWYAASKIHDAL  336

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
            +RMD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  337  ARMDNDYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMG  396

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P  I YEG  +ILPSP  D +LS+A+ L A+HM LF+++LYD
Sbjct  397  PGGIAYEGLSFILPSPTNDGSLSVAISLQADHMKLFEKYLYD  438



>gb|KDP38692.1| hypothetical protein JCGZ_04045 [Jatropha curcas]
Length=437

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHE------GSTYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            ST +L+ITP+QL  LK+K K         STYE LAAHIWRC CKARGL++DQ+TKLY+A
Sbjct  228  STKILRITPDQLTTLKSKFKKNENGMVRHSTYETLAAHIWRCMCKARGLSNDQATKLYIA  287

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGR RL PPLP GY GNV+FTAT    S E+QS PL    ++IHSAL  MDDEYLRSAL
Sbjct  288  TDGRFRLRPPLPRGYFGNVLFTATVKTSSEEVQSNPL-KIVEKIHSALKGMDDEYLRSAL  346

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            DFL+ QPDL+ L RG++ F SPNLNI SW +LP+HE+DFGW RPI MGPA +++EG  Y+
Sbjct  347  DFLQMQPDLTALKRGASTFRSPNLNIVSWMKLPIHEADFGWSRPIFMGPASVVFEGMGYV  406

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            LPSP  D +L L +CL+ +H+ LF+ + Y+ 
Sbjct  407  LPSPRNDGSLRLIICLETDHIQLFQAYFYEL  437



>gb|ABR17170.1| unknown [Picea sitchensis]
Length=433

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 158/210 (75%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            S A+ K+T EQL +LK K++  G     S+YE+L+ HIWRCACKAR LT+DQ TKLY+AT
Sbjct  224  SVAIFKLTKEQLDILKGKARENGNKVSYSSYEMLSGHIWRCACKARNLTEDQGTKLYIAT  283

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL P LPPGY GNV+FT TPMA + ++ S+P   +A  IH AL RMDDEYLRSALD
Sbjct  284  DGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHEALGRMDDEYLRSALD  343

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RG++ F  PN+ I SW+RLP+H++DFGWGRPI MGP  I YEG  +IL
Sbjct  344  YLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFIL  403

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS  KD +LS+A+ L  +HM  F++ LY+ 
Sbjct  404  PSSAKDGSLSVALGLQPDHMVRFEKMLYEL  433



>ref|XP_006583083.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X3 [Glycine max]
Length=462

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 5/208 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ ++T EQL  LK KSK +G+T     YE+LA H+WR  CKAR L DDQ TKLY+ATD
Sbjct  254  VSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATD  313

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD++YLRSALD+
Sbjct  314  GRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALDY  373

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I YEG  +I+P
Sbjct  374  LELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIP  433

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            S   D +LS+A+ L  +HM +FK+FLYD
Sbjct  434  SSTNDGSLSVAIALQPDHMKVFKDFLYD  461



>ref|XP_006583082.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like isoform 
X2 [Glycine max]
Length=465

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 156/208 (75%), Gaps = 5/208 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ ++T EQL  LK KSK +G+T     YE+LA H+WR  CKAR L DDQ TKLY+ATD
Sbjct  257  VSIFRLTREQLNTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATD  316

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PP PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD++YLRSALD+
Sbjct  317  GRSRLQPPPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMDNDYLRSALDY  376

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRPI MGP  I YEG  +I+P
Sbjct  377  LELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPIFMGPGGIAYEGLSFIIP  436

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            S   D +LS+A+ L  +HM +FK+FLYD
Sbjct  437  SSTNDGSLSVAIALQPDHMKVFKDFLYD  464



>ref|XP_008381122.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=438

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 154/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ ++T +QL +LK+KSK  G+T     YE+ + H+WRC CKA    DDQ TKLY+
Sbjct  227  TTTVSIFRLTRDQLNILKSKSKKAGNTVSYSSYEMFSGHVWRCVCKASEFPDDQDTKLYI  286

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL PPLPPGY GNV+FT TP+A + +LQS+P   +A RIH AL RMDD YLRSA
Sbjct  287  ATDGRSRLQPPLPPGYFGNVIFTTTPIAVAGDLQSKPTWYAASRIHDALVRMDDNYLRSA  346

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWG+PI MGP  I +EG  +
Sbjct  347  LDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGQPIFMGPGGIAFEGLAF  406

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPS     +LSLA+CL +EHM  F   LYD
Sbjct  407  VLPSATNGGSLSLAICLQSEHMKSFSRLLYD  437



>gb|ACF17657.1| putative hydroxycinnamoyl transferase [Capsicum annuum]
Length=435

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 162/222 (73%), Gaps = 5/222 (2%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            ++ P S+     S ++ K+T +Q+  LK KSK +G+T     YE+LA H+WR  C ARGL
Sbjct  214  ENAPNSEPVPETSVSIFKLTRDQINALKAKSKEDGNTVNYSSYEMLAGHVWRSTCMARGL  273

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
              DQ TKLY+ATDGR+RL P LP GY GNV+FTATP+A + +LQS+P+  +A +IH  L+
Sbjct  274  AQDQETKLYIATDGRARLRPSLPSGYFGNVIFTATPVAVAGDLQSKPIWYAASKIHDQLA  333

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
             MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW+RLP+H++DFGWGRPI MGP
Sbjct  334  IMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWSRLPIHDADFGWGRPIFMGP  393

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  +ILPSP  D + S+A+ L AEHM LF++FLYD 
Sbjct  394  GGIAYEGLSFILPSPTNDGSQSVAISLQAEHMKLFEKFLYDI  435



>gb|AIG20957.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
[Lonicera japonica]
Length=424

 Score =   266 bits (680),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 154/202 (76%), Gaps = 5/202 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             ++ K+T +Q+  LK KSK +G     S+YEI+A H+WRC CKARGL +DQ TKLY+ATD
Sbjct  222  VSIFKLTRDQINSLKAKSKDDGNAIGYSSYEIMAGHLWRCVCKARGLPEDQETKLYIATD  281

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GR+RL P LPPGY GNV+FT TP+A + +LQS+P   +A RIH AL+RMD++YLRSALD+
Sbjct  282  GRARLKPSLPPGYFGNVIFTTTPIAVAGDLQSKPAWYAASRIHDALTRMDNDYLRSALDY  341

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  ++LP
Sbjct  342  LELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFVLP  401

Query  213  SPNKDRTLSLAVCLDAEHMPLF  148
            SP  D +LS+A+ L AEHM LF
Sbjct  402  SPTNDGSLSVAISLQAEHMKLF  423



>gb|AFL93686.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl-transferase 
[Cynara cardunculus var. scolymus]
Length=436

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 162/222 (73%), Gaps = 11/222 (5%)
 Frame = -3

Query  777  KSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGL  613
            +SVPE+      + ++ ++T +Q+  LK KSK +G+T     YE+L+ H+WRC  KARGL
Sbjct  221  ESVPET------TVSIFRLTRDQVNALKGKSKEDGNTINYSSYEMLSGHVWRCVRKARGL  274

Query  612  TDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALS  433
             DDQ TKLY+ATDGR+RL P LP GY GNV+FT TP+A + +LQS+P   +A +IH AL+
Sbjct  275  PDDQDTKLYIATDGRARLRPSLPRGYFGNVIFTTTPIAVAGDLQSKPTWYAASKIHDALA  334

Query  432  RMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGP  253
            RMDD+YL+SALD+LE QPDL  L+RG + F  PNL I SW RLP+H++DFGWGRPI MGP
Sbjct  335  RMDDDYLKSALDYLELQPDLKALVRGVHTFKCPNLGITSWARLPIHDADFGWGRPIFMGP  394

Query  252  ACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I YEG  ++LPSP  D +LS+ + L AEHM LF +FLYD 
Sbjct  395  GGIAYEGLSFVLPSPINDGSLSIVISLQAEHMKLFSKFLYDI  436



>dbj|BAH57209.1| AT5G48930 [Arabidopsis thaliana]
Length=283

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 161/217 (74%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ K+T +QL  LK KSK +G+T     YE+LA H+WR   KARGL +DQ
Sbjct  66   SKSGPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQ  125

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A +IH  L RMDD
Sbjct  126  ETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLVRMDD  185

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
             YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I 
Sbjct  186  NYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIP  245

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSP  D +LS+A+ L +EHM LF++FL++
Sbjct  246  YEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  282



>ref|XP_008466864.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Cucumis melo]
Length=280

 Score =   260 bits (665),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 155/209 (74%), Gaps = 5/209 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K T EQL +LK KSK  G+T     YE+L+ H+WRC CKAR L DDQ TKLY+AT
Sbjct  71   TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRCTCKARELPDDQDTKLYIAT  130

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+RL PPLP GY GNV+FTATP+A + EL S P   +A +IH AL+RMD++YLRSALD
Sbjct  131  DGRARLRPPLPNGYFGNVIFTATPLAVAGELMSNPTWFAAGKIHDALTRMDNDYLRSALD  190

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QP++S L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +I+
Sbjct  191  YLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFII  250

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            PS + D +LS+A+ L   HM +F++  +D
Sbjct  251  PSASDDGSLSVAISLQNRHMKVFEKLFFD  279



>ref|XP_010500344.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            +P SK G   +T ++ KI+ + L  LK KSK +G+T     YE+LA H+WR  CKARGL 
Sbjct  211  IPSSKPGPDDNTVSIFKISRDLLLALKGKSKQDGNTVSYSSYEVLAGHVWRSVCKARGLP  270

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ TKLYVA DGRSRLCP LPPGY GNV+F+ATP+  + +L S+P   +A +IH  + R
Sbjct  271  DDQETKLYVAIDGRSRLCPQLPPGYFGNVIFSATPLTLAGDLLSKPTWYAAGKIHDVIVR  330

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDD YLRSALD+LE QPDLS L+R ++ +  PNL I SW RLP++++DFGWGRPI +GP 
Sbjct  331  MDDNYLRSALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPMYDADFGWGRPIFVGPG  390

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             I YEG  ++LPSP  D +LSLA+ L +EHM LF++FLYD 
Sbjct  391  AIAYEGLSFLLPSPTNDGSLSLAIALQSEHMKLFEKFLYDI  431



>emb|CAN82918.1| hypothetical protein VITISV_023290 [Vitis vinifera]
Length=429

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 159/213 (75%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
             + +  + +IT +QL  LK KSK +G+T     Y +LA H+WRCACKAR L  DQ +K+Y
Sbjct  217  QNTNVCIFRITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMY  276

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL P LPPGY GNV+FT TP+A + EL S+PL  +A +IH+AL+RMDDEYLRS
Sbjct  277  IATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRS  336

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL+ L+RG++ F  PN+ I SWTRLP++++DFGWGRPI MGP  I  EG  
Sbjct  337  ALDYLEIQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA  396

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + LPSP  D +LS+A+ L  +HM LF+++LY+ 
Sbjct  397  FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>emb|CBI25231.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   263 bits (673),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 157/206 (76%), Gaps = 5/206 (2%)
 Frame = -3

Query  729  LKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVATDGRS  565
            ++IT +QL  LK KSK +G+T     Y +LA H+WRCACKAR L  DQ +K+Y+ATDGRS
Sbjct  201  IEITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMYIATDGRS  260

Query  564  RLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLEC  385
            RL P LPPGY GNV+FT TP+A + EL S+PL  +A +IH+AL+RMDDEYLRSALD+LE 
Sbjct  261  RLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRSALDYLEL  320

Query  384  QPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPN  205
            QPDL+ L+RG++ F  PN+ I SWTRLP++++DFGWGRPI MGP  I  EG  + LPSP 
Sbjct  321  QPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLAFALPSPT  380

Query  204  KDRTLSLAVCLDAEHMPLFKEFLYDF  127
             D +LS+A+ L  +HM LF+++LY+ 
Sbjct  381  NDGSLSIAISLQEDHMKLFQKYLYEI  406



>ref|XP_002268988.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
Length=429

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 159/213 (75%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLY  586
             + +  + +IT +QL  LK KSK +G+T     Y +LA H+WRCACKAR L  DQ +K+Y
Sbjct  217  QNTNVCIFRITRDQLNTLKNKSKEDGNTISYSSYVMLAGHVWRCACKARSLPADQDSKMY  276

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGRSRL P LPPGY GNV+FT TP+A + EL S+PL  +A +IH+AL+RMDDEYLRS
Sbjct  277  IATDGRSRLRPALPPGYFGNVIFTTTPVAVAGELMSKPLWYAASKIHNALARMDDEYLRS  336

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL+ L+RG++ F  PN+ I SWTRLP++++DFGWGRPI MGP  I  EG  
Sbjct  337  ALDYLELQPDLTALVRGAHTFRCPNIGITSWTRLPIYDADFGWGRPIFMGPGGIALEGLA  396

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + LPSP  D +LS+A+ L  +HM LF+++LY+ 
Sbjct  397  FALPSPTNDGSLSIAISLQEDHMKLFQKYLYEI  429



>ref|XP_006840118.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
 gb|ERN01793.1| hypothetical protein AMTR_s00727p00010990 [Amborella trichopoda]
Length=281

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 154/209 (74%), Gaps = 5/209 (2%)
 Frame = -3

Query  738  TAMLKITPEQLGVLKTKSKHEGS-----TYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
             A+  +T  QL  LK++++  GS     +YE+LA H+WRC+CKAR L DDQ TK+Y+ATD
Sbjct  73   VAIFTLTRAQLDTLKSRARDSGSPSTYSSYEMLAGHVWRCSCKARNLPDDQLTKMYIATD  132

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL P LP GY GNV+FTATP+A + +L S P   +A  I  AL+RMDD+YLRSALD+
Sbjct  133  GRSRLRPLLPAGYFGNVIFTATPIAVAGDLMSRPAYVAAGCIRQALARMDDDYLRSALDY  192

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDL  L+RG++ F  PN+ I SW RLP+H++DFGWGRP+ MGP  I YEG  ++LP
Sbjct  193  LEIQPDLGALVRGAHTFRCPNIGITSWARLPIHDADFGWGRPVFMGPGGIAYEGLAFVLP  252

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP+ D +LSLA+ L A+HM LFK++ YD 
Sbjct  253  SPSGDGSLSLAISLQADHMVLFKKYFYDI  281



>dbj|BAF49305.1| putative acyltransferase [Clitoria ternatea]
Length=433

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 159/221 (72%), Gaps = 6/221 (3%)
 Frame = -3

Query  771  VPESKRGS-SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            +P +K GS   + ++ K+T +QL  LK KS+ +G+T     YE+LA H+WR  CKAR L 
Sbjct  213  LPPTKPGSEQVAVSIFKLTRDQLNTLKGKSREDGNTVNYSSYEMLAGHVWRSVCKARALP  272

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
             DQ TKLY+ATDGRSRL P LPPGY GNV+FT TP+A + +L S+P   +A RIH AL R
Sbjct  273  HDQETKLYIATDGRSRLQPSLPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHDALVR  332

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD+EYLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  333  MDNEYLRSALDYLELQPDLKALVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPG  392

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             I YEG  +I+PS   D +LS+A+ L ++ M LF+E LYD 
Sbjct  393  GIAYEGLSFIIPSSTNDASLSVAIALPSDQMKLFQELLYDI  433



>ref|XP_010063590.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70827.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70828.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
 gb|KCW70829.1| hypothetical protein EUGRSUZ_F03973 [Eucalyptus grandis]
Length=445

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 164/226 (73%), Gaps = 8/226 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSAST--AMLKITPEQLGVLKTKSKHEG------STYEILAAHIWRCACK  625
            L+  PE+   +S S+  ++LK+T EQL  LKT++  E       ++YEILA H+WRCAC+
Sbjct  215  LRVSPETTNSASDSSTVSILKVTREQLDALKTQAVLENGNTTRYTSYEILAGHVWRCACR  274

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL+DDQ TKL +A DGR RL PPLP GY GN +FT TP+A + +L S+P+  +A+ IH
Sbjct  275  ARGLSDDQDTKLSIAIDGRMRLSPPLPQGYFGNGIFTITPIAVAGDLISKPVLYAARTIH  334

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             +L+R +D+YLRSALD+LE QPDLS L RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  335  ESLARANDDYLRSALDYLELQPDLSALARGAHTFRCPNLGITSWVRLPIHDADFGWGRPI  394

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +MGP  I YEG  YILPSP  D +LS+A+ L  EHM  F++F YD 
Sbjct  395  YMGPGRIAYEGLSYILPSPTSDGSLSVAISLQTEHMKPFEKFFYDL  440



>gb|AHA44839.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Larix 
kaempferi]
Length=433

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 156/210 (74%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            S A+ ++T EQL +LK K++  G     S+YE+L+ HIWRCACKAR L +DQ TKLY+AT
Sbjct  224  SVAIFRLTKEQLDILKGKARENGNKVSYSSYEMLSGHIWRCACKARNLREDQETKLYIAT  283

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL P LPPGY GNV+FT TPMA + ++ S+P   +A  IH  L RMDD+YLRSALD
Sbjct  284  DGRSRLRPSLPPGYFGNVIFTTTPMAVAGDIVSKPTYYAASVIHDTLGRMDDDYLRSALD  343

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RG++ F  PN+ I SW+RLP+H++DFGWGRPI MGP  I YEG  +IL
Sbjct  344  YLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFIL  403

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS  KD +LS+A+ L  +HM  F++ LY+ 
Sbjct  404  PSSTKDGSLSVALGLQPDHMVRFEKMLYEI  433



>ref|XP_010063583.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010063585.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70825.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
 gb|KCW70826.1| hypothetical protein EUGRSUZ_F03972 [Eucalyptus grandis]
Length=445

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 166/226 (73%), Gaps = 8/226 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSAST--AMLKITPEQLGVLKTKSKHEG------STYEILAAHIWRCACK  625
            L+  PE+   +  ST  ++L++T E L  LKT+++ +       S+YEILA H+WRCAC+
Sbjct  215  LRVSPETTNSAPDSTTVSILRVTREWLDNLKTQAELDNGNTTRYSSYEILAGHVWRCACR  274

Query  624  ARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIH  445
            ARGL+DDQ TK+Y+ATD R RL PPLP GY GN + T TP+A + +L S+P++ +A++IH
Sbjct  275  ARGLSDDQDTKVYIATDARMRLSPPLPQGYFGNGILTTTPIAVAGDLISKPVSYAAQKIH  334

Query  444  SALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPI  265
             +L+RM+D YLRSALD+LE QPDLS L RG++ F  PNL I SW RLP+H++DFGWGRPI
Sbjct  335  ESLARMNDNYLRSALDYLELQPDLSALARGAHTFRCPNLGIVSWVRLPIHDADFGWGRPI  394

Query  264  HMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +MGP  I YEG  YILPSP  D +LS+A+ L  EH+  F++F YDF
Sbjct  395  YMGPGGIAYEGLSYILPSPTSDGSLSVAISLQTEHVKPFEKFFYDF  440



>emb|CCC55431.1| hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Pinus pinaster]
Length=433

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 155/210 (74%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            S A+ K+T EQL +LK K++  G     S+YE+L+ HIWRCACKAR L +DQ TKLY+AT
Sbjct  224  SVAIFKLTKEQLEILKGKARENGNNIAYSSYEMLSGHIWRCACKARNLAEDQETKLYIAT  283

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+RL P +PPGY GNV+FT TPMA + ++ S+P   +A  IH AL RMDDEYLRSALD
Sbjct  284  DGRNRLRPSIPPGYFGNVIFTTTPMAVAGDIISKPTYYAASVIHEALGRMDDEYLRSALD  343

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL+ L+RGS+ F  PN+ I SW+RLP+H++DFGWGRPI MGP  I YEG  ++L
Sbjct  344  YLELQPDLTALVRGSHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLAFVL  403

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS   D +LS+A+ L  +HM  F + LY+ 
Sbjct  404  PSSANDGSLSVALGLQPDHMARFAKMLYEI  433



>ref|XP_002894568.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70827.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score =   261 bits (667),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 160/217 (74%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ K++ +QL  LK KSK +G     S+YE+LA H+WR   KARGL DDQ
Sbjct  216  SKSGPDNTTVSIFKLSRDQLVALKAKSKEDGNIVSYSSYEMLAGHVWRSVGKARGLPDDQ  275

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  L RMDD
Sbjct  276  ETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLVRMDD  335

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
             YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I 
Sbjct  336  NYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIP  395

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSP  D +LS+A+ L +EHM LF++FLY+
Sbjct  396  YEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  432



>gb|KHN31873.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=439

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 155/220 (70%), Gaps = 5/220 (2%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            S P     ++ + +  K+T +QL  LK KS+ +G+T     YE+LA H+WR  CKAR L 
Sbjct  218  SKPLGSDSTAVAVSTFKLTRDQLSTLKGKSREDGNTISYSSYEMLAGHVWRSVCKARALP  277

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ TKLY+ATDGR+RL PPLP GY GNV+FT TP+A + +L S+P   +A RIH AL R
Sbjct  278  DDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHDALIR  337

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD+EYLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  338  MDNEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPG  397

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  +I+PS   D +LSLA+ L  E M +F+E  YD
Sbjct  398  GIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFYD  437



>ref|XP_010500346.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=472

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 160/220 (73%), Gaps = 6/220 (3%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            +P SK     +T ++ KI+ + L  LK KSK +G+T     YE+LA H+WR  CKARGL 
Sbjct  252  IPSSKPDPDDTTVSIFKISHDLLCALKAKSKQDGNTMSYSSYEVLAGHVWRSVCKARGLQ  311

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ TK Y+A DGRSRL P LPPGYLGNV+FTATP+  + +L S+P   +A  IH A+ R
Sbjct  312  DDQETKFYIAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLLSKPTWYAAGMIHDAIVR  371

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            M+D YL SALD+LE QPDLS L+RG++ +  PNL I SWT+LP++++DFGWGRPI+MGP 
Sbjct  372  MNDNYLWSALDYLELQPDLSSLVRGAHTYKCPNLGITSWTKLPIYDADFGWGRPIYMGPG  431

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  ++LPSP  D +LSLA+ L +EHM LF++F YD
Sbjct  432  AIAYEGLSFVLPSPTNDGSLSLAIALQSEHMKLFQKFFYD  471



>ref|XP_009354208.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 153/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S   ++ ++T EQL VLK KSK EG     STYE+LA H+WRCA KAR L DDQ TKL+V
Sbjct  230  STRVSIFRLTREQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCATKARNLPDDQVTKLHV  289

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL PPLPPG+ GNVVF   P A + +L+S+P   +A RIH  + RM+++YLRSA
Sbjct  290  AVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYLRSA  349

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  P L I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  350  LDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAF  409

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L ++HM  F + LYD
Sbjct  410  VLPSPTNDGSLSVAISLQSDHMKSFAKLLYD  440



>ref|XP_006307576.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
 gb|EOA40474.1| hypothetical protein CARUB_v10009198mg [Capsella rubella]
Length=431

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 7/218 (3%)
 Frame = -3

Query  762  SKRGS--SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            SK GS   A+ ++ K++ +QL  LK KSK +G+T     YE+LA H+WR   KARGL DD
Sbjct  213  SKPGSPDDATVSIFKLSRDQLVALKAKSKEDGNTISYSSYEMLAGHVWRSVGKARGLPDD  272

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLYVA DGRSRL P LPPGY GNV+FTATP+  + +L S+P   +A  IH  ++RMD
Sbjct  273  QETKLYVAVDGRSRLRPQLPPGYFGNVIFTATPLTVAGDLLSKPTWFAAGMIHDVIARMD  332

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I
Sbjct  333  DNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGI  392

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             YEG  ++LPSP  D +LS+A+ L +EHM LF++FLY+
Sbjct  393  PYEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>gb|AAM61215.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
Length=433

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 161/217 (74%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ K+T +QL  LK KSK +G+T     YE+LA H+WR   KARGL +DQ
Sbjct  216  SKSGPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQ  275

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A +IH  L RMDD
Sbjct  276  ETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLVRMDD  335

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
             YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I 
Sbjct  336  NYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIP  395

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSP  D +LS+A+ L +EHM LF++FL++
Sbjct  396  YEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>ref|NP_199704.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
 sp|Q9FI78.1|HST_ARATH RecName: Full=Shikimate O-hydroxycinnamoyltransferase; AltName: 
Full=Hydroxycinnamoyl transferase; AltName: Full=Hydroxycinnamoyl-Coenzyme 
A shikimate/quinate hydroxycinnamoyltransferase 
[Arabidopsis thaliana]
 dbj|BAB10316.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 dbj|BAE98378.1| anthranilate N-benzoyltransferase [Arabidopsis thaliana]
 gb|ABH04595.1| At5g48930 [Arabidopsis thaliana]
 gb|AED95744.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase 
[Arabidopsis thaliana]
Length=433

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 161/217 (74%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ K+T +QL  LK KSK +G+T     YE+LA H+WR   KARGL +DQ
Sbjct  216  SKSGPENTTVSIFKLTRDQLVALKAKSKEDGNTVSYSSYEMLAGHVWRSVGKARGLPNDQ  275

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A +IH  L RMDD
Sbjct  276  ETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGQIHDFLVRMDD  335

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
             YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I 
Sbjct  336  NYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIP  395

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSP  D +LS+A+ L +EHM LF++FL++
Sbjct  396  YEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  432



>ref|XP_007011895.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007011896.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29514.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
 gb|EOY29515.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative isoform 1 [Theobroma cacao]
Length=449

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 160/213 (75%), Gaps = 7/213 (3%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-------STYEILAAHIWRCACKARGLTDDQSTKLY  586
            +ST++ KIT +QL  LK+K+   G       +TY+IL AH+W C CKARGL+DDQ+TKLY
Sbjct  226  SSTSIFKITADQLKTLKSKATMNGNTTKTNRTTYDILTAHVWHCVCKARGLSDDQATKLY  285

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +  DGRS+L PPLPPGYLGNV+F A   A S +LQSEP  ++ +RI+  + RMDD+Y+RS
Sbjct  286  IPIDGRSKLHPPLPPGYLGNVIFIAATTALSGDLQSEPFADTIQRINRMVKRMDDKYMRS  345

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD++E  PD+  L+RG++ F SPNL+INSW RLP++ +DFGWGRP+H+G A +++EG +
Sbjct  346  ALDYIESVPDMKTLMRGAHTFQSPNLSINSWMRLPLYAADFGWGRPMHVGLANVIHEGKI  405

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             I+PSP  D +LSL VCL+  HM  F++ LYDF
Sbjct  406  CIVPSPVDDGSLSLVVCLETSHMKQFEKCLYDF  438



>gb|ABO52899.1| hydroxycinnamoyl-CoA:shikimate hydroxycinnamoyltransferase [Pinus 
radiata]
Length=433

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLY  586
            +  S A+ K+T EQL +LK K++  G     S+YE+L+ HIWRCACKAR L +DQ TKLY
Sbjct  221  TDISVAIFKLTKEQLEILKGKARENGNNIAYSSYEMLSGHIWRCACKARNLAEDQETKLY  280

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGR+RL P +PPGY GNV+FT TPMA + ++ S+P   +A  IH AL RMDDEYLRS
Sbjct  281  IATDGRNRLRPSIPPGYFGNVIFTTTPMAVTGDIISKPTYYAASVIHEALGRMDDEYLRS  340

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL+ L+RG++ F  PN+ I SW+RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  341  ALDYLELQPDLTALVRGAHTFRCPNIGITSWSRLPIHDADFGWGRPIFMGPGGIAYEGLA  400

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            ++LPS   D +LS+A+ L  +HM  F + LY+ 
Sbjct  401  FVLPSSVNDGSLSVALGLQPDHMVRFAKMLYEI  433



>ref|XP_007135841.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
 gb|ESW07835.1| hypothetical protein PHAVU_010G162700g [Phaseolus vulgaris]
Length=433

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 157/219 (72%), Gaps = 5/219 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P +     A  ++ K+T +QL  LK KSK +G+T     YE+LA H+WR  CKAR L  D
Sbjct  215  PTNSHTVPADVSIFKLTRDQLCTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPHD  274

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P  PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD
Sbjct  275  QETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMD  334

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            +EYLRSALD+LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRP+ MGP  I
Sbjct  335  NEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPVFMGPGGI  394

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             YEG  +I+P+   D ++S+A+ L  +HM +FK++LYD 
Sbjct  395  AYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLYDI  433



>gb|AGV54440.1| shikimate O-hydroxycinnamoyltransferase [Phaseolus vulgaris]
Length=433

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 157/219 (72%), Gaps = 5/219 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P +     A  ++ K+T +QL  LK KSK +G+T     YE+LA H+WR  CKAR L  D
Sbjct  215  PTNSHTVPADVSIFKLTRDQLCTLKAKSKEDGNTISYSSYEMLAGHVWRSVCKARALPHD  274

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P  PPGY GNV+FT TP+A + +L S+P   +A RIH+AL RMD
Sbjct  275  QETKLYIATDGRSRLQPSPPPGYFGNVIFTTTPIAVAGDLMSKPTWYAASRIHNALLRMD  334

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            +EYLRSALD+LE QPDL  L+RG++ F  PNL I SWTRLP+H++DFGWGRP+ MGP  I
Sbjct  335  NEYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWTRLPIHDADFGWGRPVFMGPGGI  394

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             YEG  +I+P+   D ++S+A+ L  +HM +FK++LYD 
Sbjct  395  AYEGLSFIIPNSTNDGSVSVAIALQPDHMKVFKDYLYDI  433



>emb|CDY31956.1| BnaA07g00390D [Brassica napus]
Length=433

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 158/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P      S + ++ K++ +QL  LK K+K +G+T     YE+LA H+WR   KARGL DD
Sbjct  215  PSKSSPDSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKARGLPDD  274

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  L+RMD
Sbjct  275  QETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMD  334

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I
Sbjct  335  DNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGI  394

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             YEG  ++LPSP  D +LS+A+ L  EHM LF+++LY+
Sbjct  395  PYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_010101376.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB88323.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=446

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 161/234 (69%), Gaps = 16/234 (7%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSK----HEGST------------YEILAA  649
            +K+   S    S +  + K+T EQL VLK KSK    ++G T            +EILA 
Sbjct  213  MKTTSTSAPQQSIAAGIFKMTKEQLQVLKAKSKEYLINDGDTSTSSTATINLTSFEILAG  272

Query  648  HIWRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPL  469
            HIWRC CKAR L DDQ T++Y+ATDGRSRL PPLPPGY GNVVFTA P+A + ++QS+P 
Sbjct  273  HIWRCVCKARALADDQETRVYIATDGRSRLQPPLPPGYFGNVVFTAAPLATAGDIQSKPT  332

Query  468  TNSAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHES  289
              +A RIH AL+RMD+ YLRSALD+LE QPDL  L RG++ F  PNL I SW RLP+H++
Sbjct  333  RYAASRIHDALARMDNNYLRSALDYLELQPDLMALARGAHTFRCPNLGITSWVRLPIHDA  392

Query  288  DFGWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            DFGWGRP+ MGP  + +EG V +L SP +D +LS+++ L  EH+  F++ +YD 
Sbjct  393  DFGWGRPVFMGPGKVSFEGFVIVLRSPIEDGSLSISINLQQEHLKAFEKLIYDI  446



>ref|XP_010479239.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 159/220 (72%), Gaps = 6/220 (3%)
 Frame = -3

Query  771  VPESK-RGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            +P SK      + ++ KI+ + L  LK KSK +G+T     YE+LA H+WR  CKARGL 
Sbjct  211  IPSSKPEPDDTTVSIFKISRDMLVSLKAKSKQDGNTLSYSSYEVLAGHVWRSVCKARGLP  270

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            +DQ TK Y+A DGRSRL P LPPGYLGNV+FTATP+  + +L S+P   +A  IH A+ R
Sbjct  271  EDQETKFYIAIDGRSRLRPQLPPGYLGNVIFTATPLTVAGDLVSKPTWYAAGMIHDAIVR  330

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDD YL SALD+LE QPDLS L+RG++ +  PNL I SWT+LP++++DFGWGRPI+MGP 
Sbjct  331  MDDNYLWSALDYLEMQPDLSALVRGAHTYKCPNLGITSWTKLPIYDADFGWGRPIYMGPG  390

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I +EG  ++LPSP  D +LSLA+ L +EHM LFK+F Y+
Sbjct  391  AIAFEGLSFVLPSPTNDGSLSLAINLQSEHMKLFKKFFYN  430



>ref|XP_010479240.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 161/221 (73%), Gaps = 6/221 (3%)
 Frame = -3

Query  771  VPESKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            +P S +G   +T ++ KI+ + L  LKTKSK +G+T     YE+LA H+WR  CKARGL 
Sbjct  211  IPSSTQGLDDTTVSIFKISRDMLVALKTKSKQDGNTVSYSSYEVLAGHVWRSVCKARGLP  270

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ TKLYVA DGRSRL P LPPGY GNV+F+ATP+  + +L S+P   +A  IH  + R
Sbjct  271  DDQETKLYVAIDGRSRLRPQLPPGYFGNVIFSATPLTFAGDLLSKPTWYAAVLIHDVIVR  330

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDD+YLRSALD+LE QPDLS L+R ++ +  PNL I SW RLP++++DFGWGRPI +GP 
Sbjct  331  MDDKYLRSALDYLEMQPDLSALVRCASTYKCPNLGITSWVRLPMYDADFGWGRPIFVGPG  390

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             I YEG  ++LPSP  D +LSLA+ L +EHM LF++FLY+ 
Sbjct  391  AIAYEGLSFLLPSPTNDGSLSLAISLQSEHMKLFEKFLYEI  431



>ref|XP_010462493.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K++ +QL  LK KSK +G+T     YE+LA H+WR   KARGL DDQ TKLYV
Sbjct  220  NTTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYV  279

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL P LPPGY GNV+FTATP+  + EL S+P   +A  IH  ++RMDD YLRSA
Sbjct  280  AIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRSA  339

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  340  LDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLSF  399

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L +EHM LF++FLY+
Sbjct  400  VLPSPTNDGSLSVAIALQSEHMKLFEKFLYE  430



>ref|XP_006392548.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
 gb|ESQ29834.1| hypothetical protein EUTSA_v10011497mg [Eutrema salsugineum]
Length=433

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 160/217 (74%), Gaps = 6/217 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ K++ +QL  LK KSK +G+T     YE+LA H+WR   KARGL DDQ
Sbjct  216  SKSGPDNTTVSIFKLSRDQLVALKAKSKDDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQ  275

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  L RMDD
Sbjct  276  ETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAIAGDLLSKPTWYAAGLIHDVLVRMDD  335

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
             YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I 
Sbjct  336  NYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIP  395

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSP  D +LS+A+ L +EHM LF+++LY+
Sbjct  396  YEGLSFVLPSPTNDGSLSVAIALQSEHMKLFEKYLYE  432



>ref|XP_010480194.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=431

 Score =   259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K++ +QL  LK KSK +G+T     YE+LA H+WR   KARGL DDQ TKLYV
Sbjct  220  STTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYV  279

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL P LPPGY GNV+FTATP+  + EL S+P   +A  IH  ++RMDD YLRSA
Sbjct  280  AIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRSA  339

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  340  LDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLSF  399

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L +EHM LF++FL++
Sbjct  400  VLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>ref|XP_009102018.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Brassica 
rapa]
Length=433

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 158/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P      S + ++ K++ +QL  LK K+K +G+T     YE+LA H+WR   KARGL DD
Sbjct  215  PSKSSPDSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKARGLPDD  274

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  L+RMD
Sbjct  275  QETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLARMD  334

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I
Sbjct  335  DNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGI  394

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             YEG  +++PSP  D +LS+A+ L  EHM LF+++LY+
Sbjct  395  PYEGLSFVVPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>emb|CDY05770.1| BnaC07g00330D [Brassica napus]
Length=433

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 158/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P      S + ++ K++ +QL  LK K+K +G+T     YE+LA H+WR   K+RGL DD
Sbjct  215  PSKSSPDSTTVSIFKLSRDQLVSLKAKAKEDGNTVSYSSYEMLAGHVWRSVGKSRGLPDD  274

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  L+RMD
Sbjct  275  QETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWFAAGLIHDVLARMD  334

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I
Sbjct  335  DNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGI  394

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             YEG  ++LPSP  D +LS+A+ L  EHM LF+++LY+
Sbjct  395  PYEGLSFVLPSPTNDGSLSVAIALQTEHMKLFEKYLYE  432



>ref|XP_007150819.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
 gb|ESW22813.1| hypothetical protein PHAVU_005G183200g [Phaseolus vulgaris]
Length=456

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 157/218 (72%), Gaps = 7/218 (3%)
 Frame = -3

Query  759  KRGSSASTAM--LKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQ  601
            K GS  + A+   K++ +QL  LK KS+ +G     S+YE+LA H+WR  C+AR L D+Q
Sbjct  239  KPGSDGAVAVSTFKLSRDQLNTLKGKSREDGNSISYSSYEMLAGHVWRSVCRARELPDEQ  298

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGRSRL PPLPPGY GNV+FT TP+A + +L S+P   +A RIH AL RMD+
Sbjct  299  ETKLYIATDGRSRLQPPLPPGYFGNVIFTTTPVAVAGDLISKPTWYAASRIHDALMRMDN  358

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSALD+LE QPDL  L+RGS+ F  PNL I SW RLP+H++DFGWGRP+ MGP  I 
Sbjct  359  EYLRSALDYLEVQPDLKALVRGSHTFRCPNLGITSWVRLPIHDADFGWGRPVFMGPGGIA  418

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            YEG  +I+PS   D T+S+A+ L  + M +F++  YDF
Sbjct  419  YEGLSFIIPSSTNDGTMSVAIALPPDRMKVFQDLFYDF  456



>ref|XP_010501253.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Camelina 
sativa]
Length=431

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K++ +QL  LK KSK +G+T     YE+LA H+WR   KARGL DDQ TKLYV
Sbjct  220  NTTVSIFKLSRDQLVALKAKSKQDGNTVSYSSYEMLAGHVWRSVGKARGLPDDQETKLYV  279

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL P LPPGY GNV+FTATP+  + EL S+P   +A  IH  ++RMDD YLRSA
Sbjct  280  AIDGRSRLRPQLPPGYFGNVIFTATPLTVAGELLSKPTWYAAGLIHDVIARMDDNYLRSA  339

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  340  LDYLEMQPDLSALVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGGIPYEGLSF  399

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L +EHM LF++FL++
Sbjct  400  VLPSPTNDGSLSVAIALQSEHMKLFEKFLFE  430



>ref|XP_003543709.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Glycine max]
Length=439

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 154/220 (70%), Gaps = 5/220 (2%)
 Frame = -3

Query  774  SVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLT  610
            S P     ++ + +  K+T +QL  LK KS+ +G+T     YE+LA H+WR  CKAR L 
Sbjct  218  SKPLGSDSTAVAVSTFKLTRDQLSTLKGKSREDGNTISYSSYEMLAGHVWRSVCKARALP  277

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            DDQ TKLY+ATDGR+RL PPLP GY GNV+FT T +A + +L S+P   +A RIH AL R
Sbjct  278  DDQETKLYIATDGRARLQPPLPHGYFGNVIFTTTRIAVAGDLMSKPTWYAASRIHDALIR  337

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MD+EYLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP 
Sbjct  338  MDNEYLRSALDYLELQPDLKSLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPG  397

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I YEG  +I+PS   D +LSLA+ L  E M +F+E  YD
Sbjct  398  GIAYEGLSFIIPSSTNDGSLSLAIALPPEQMKVFQELFYD  437



>ref|XP_006303737.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
 gb|EOA36635.1| hypothetical protein CARUB_v10011876mg [Capsella rubella]
Length=426

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 159/216 (74%), Gaps = 5/216 (2%)
 Frame = -3

Query  762  SKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQS  598
            + +    + ++ K++ + L  LK KSK +G+T     YE+LAAH+WR   KARGL DDQ 
Sbjct  210  NNKHDDTTVSIFKLSRDLLVALKAKSKQDGNTVSYSSYEVLAAHVWRSVGKARGLPDDQE  269

Query  597  TKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDE  418
            TKLYV  DGRSRL P LP GY GNV+FTATPM  + +L S+P + +A  IH A++RMDD+
Sbjct  270  TKLYVPIDGRSRLRPQLPLGYFGNVLFTATPMTVAGDLLSKPTSYAAGMIHDAIARMDDK  329

Query  417  YLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILY  238
            YLRSALD+LE QPDLS+L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I +
Sbjct  330  YLRSALDYLEMQPDLSELVRGAHTYKCPNLGITSWARLPIYDADFGWGRPIFMGPGAIAF  389

Query  237  EGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            EG  ++LPSP+ D +LSL + L +EHM LFK+FLY+
Sbjct  390  EGLSFVLPSPSNDGSLSLVISLQSEHMKLFKKFLYE  425



>gb|AFF57839.1| hydroxycinnamoyl-coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
1 [Pyrus x bretschneideri]
Length=441

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 152/211 (72%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S   ++ ++T +QL VLK KSK EG     STYE+LA H+WRCA KAR L DDQ TKL+V
Sbjct  230  STRVSIFRLTRKQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCATKARNLPDDQVTKLHV  289

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL PPLPPG+ GNVVF   P A + +L+S+P   +A RIH  + RM+++YLRSA
Sbjct  290  AVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAAGRIHDVVVRMNNDYLRSA  349

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  P L I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  350  LDFLEVQPDLSALVRGAHTFRCPRLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAF  409

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS A+ L ++HM  F + LYD
Sbjct  410  VLPSPTNDGSLSGAIPLQSDHMKSFAKLLYD  440



>emb|CDY22880.1| BnaA01g18180D [Brassica napus]
Length=428

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 155/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K++ + L  LK K+K +G+T     YE LAAH+WR   KAR   DDQ TKLY+
Sbjct  217  NTTVSIFKLSRDLLVALKAKAKEDGNTVSYSSYETLAAHVWRSVTKARAFPDDQVTKLYI  276

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGYLGNVVFTATP+A + +L S+P +  A  IH  L+RMDDEYLRSA
Sbjct  277  ATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRSA  336

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS LIRG+  +  PNL I SW RLP++++DFGWGRP+ MGP+ I +EG  +
Sbjct  337  LDYLEMQPDLSALIRGAQTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLSF  396

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LSL + L  EHM LF+++LY+
Sbjct  397  VLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>emb|CDY44162.1| BnaC01g22120D [Brassica napus]
Length=428

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K++ + L  LK K+K +G     S+YE LAAH+WR   KAR   DDQ TKLY+
Sbjct  217  NTTVSIFKLSRDLLVALKAKAKEDGNPVSYSSYETLAAHVWRSVTKARAFPDDQVTKLYI  276

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGYLGNVVFTATP+A + +L S+P +  A  IH  L+RMDDEYLRSA
Sbjct  277  ATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRSA  336

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS LIRG++ +  PNL I SW RLP++++DFGWGRP+ MGP+ I +EG  +
Sbjct  337  LDYLEMQPDLSALIRGAHTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLSF  396

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LSL + L  EHM LF+++LY+
Sbjct  397  VLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_009146509.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brassica 
rapa]
Length=428

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 155/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYV  583
            + + ++ K++ + L  LK K+K +G+T     YE LAAH+WR   KAR   DDQ TKLY+
Sbjct  217  NTTVSIFKLSRDLLVALKAKAKEDGNTVSYSSYETLAAHVWRSVTKARAFPDDQVTKLYI  276

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGYLGNVVFTATP+A + +L S+P +  A  IH  L+RMDDEYLRSA
Sbjct  277  ATDGRSRLRPQLPPGYLGNVVFTATPLAAAGDLLSKPTSYVAGLIHDVLARMDDEYLRSA  336

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS LIRG+  +  PNL I SW RLP++++DFGWGRP+ MGP+ I +EG  +
Sbjct  337  LDYLEMQPDLSALIRGAQTYNCPNLGITSWVRLPIYDADFGWGRPVFMGPSVIAFEGLSF  396

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LSL + L  EHM LF+++LY+
Sbjct  397  VLPSPTNDGSLSLFIALRTEHMKLFEKYLYE  427



>ref|XP_010479238.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Camelina 
sativa]
Length=428

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 157/218 (72%), Gaps = 6/218 (3%)
 Frame = -3

Query  762  SKRGSSAST-AMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
            SK G   +T ++ KI+ E L  LK KS  +G+T     YE+LA H+WR   KARGL DDQ
Sbjct  211  SKPGPHDTTVSIFKISRELLLALKAKSNQDGNTVSYSSYEVLAGHVWRAVGKARGLPDDQ  270

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+A DGRSRL P LPPGY GNVVFTATP+  + +L S+P   +A  IH  + RMDD
Sbjct  271  ETKLYIAIDGRSRLRPQLPPGYFGNVVFTATPLTVAGDLVSKPTWYAAGMIHDVIVRMDD  330

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSALD+LE QPDLS L+RG++ +  PNL I SW +LP++++DFGWGRP+ MGP  I 
Sbjct  331  EYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWAKLPIYDADFGWGRPLFMGPGAIA  390

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +EG  ++LPSP  D +LSLA+ L +EHM LF++FLY+ 
Sbjct  391  FEGLSFLLPSPTDDGSLSLAISLQSEHMKLFEKFLYEI  428



>gb|KHN22398.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Glycine soja]
Length=540

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLY  586
            S+ + + +K+T +QL  LK KS+ +G     S+YE+LA H+WR  CKAR L DDQ TKLY
Sbjct  328  SAVAVSTVKLTRDQLSTLKGKSREDGNRISYSSYEMLAGHVWRSVCKARALPDDQETKLY  387

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +ATDGR+RL PPL PGY GNV+FT TP+A + +L S+P   +A RIH AL RMD+EYLRS
Sbjct  388  IATDGRARLQPPLTPGYFGNVIFTTTPIAVAGDLMSKPTWFAASRIHDALIRMDNEYLRS  447

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  
Sbjct  448  ALDYLELQPDLKVLVRGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLS  507

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +I+PS   D ++S+A+ L  E M +F+E  YD 
Sbjct  508  FIIPSSTNDGSMSVAIALPPEQMKVFQELFYDI  540



>ref|XP_010244683.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/220 (53%), Positives = 159/220 (72%), Gaps = 6/220 (3%)
 Frame = -3

Query  768  PESKRG-SSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTD  607
            P S+ G +  + A LKIT +Q+  LK K++ + +T     YE+L  H+WRC CKARGL D
Sbjct  213  PTSQSGPTHVAVAKLKITVDQINALKAKAEEDSNTLNYSSYEVLVGHVWRCVCKARGLCD  272

Query  606  DQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRM  427
            DQ TKLY+A D RSRL PPLP GY GN     +P+  + +L+S+PL  +  RIH  L RM
Sbjct  273  DQDTKLYMAVDLRSRLRPPLPQGYFGNGTLVTSPIGVAGDLRSKPLAYAVGRIHDQLMRM  332

Query  426  DDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPAC  247
            +DEYLRSA+D+LE QPDL+ L+RG++ F  PN+ I +WT+LP++++DFGWGRPI+MGPA 
Sbjct  333  NDEYLRSAIDYLELQPDLTALVRGADTFRCPNMGIVNWTQLPIYDADFGWGRPIYMGPAT  392

Query  246  ILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +L+EG  YILPSP +D + +LAV L ++HM LF++  YDF
Sbjct  393  VLHEGMAYILPSPAQDGSATLAVSLQSDHMQLFEKIFYDF  432



>ref|XP_010113235.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXC76036.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=439

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 156/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
             SK  ++ S A  KIT +QL  LK KSK +GS+     YE+L+ H+WRCACKAR L DDQ
Sbjct  222  NSKYQTTTSVANFKITKDQLIALKNKSKEDGSSVSYSSYEMLSGHVWRCACKARALPDDQ  281

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKL+VA DGR+RL PPLP  Y GNV+FT TP+A + +L S+P+  +A +IH  L + ++
Sbjct  282  ETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVSKPIWYAASQIHKTLVKTNN  341

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYL+SA+D+LE QPDLS L+RG++ F  PNL I SW RLP++++DFGWGRPI MGP  I+
Sbjct  342  EYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIM  401

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +EG  Y+LPSP  D +LS+A+ L  EHM  F + + D 
Sbjct  402  FEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLICDI  439



>gb|AFR40245.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=191

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWXAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  123  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  182

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  183  IIPSSTND  190



>gb|AFR40214.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40215.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40218.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40220.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40221.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40222.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40224.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40225.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40227.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40228.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40237.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40247.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=193

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|AFR40216.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=192

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|AFR40219.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40226.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=191

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  123  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  182

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  183  IIPSSTND  190



>gb|AFR40243.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=191

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  4    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  63

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  64   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  123

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  124  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  183

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  184  IIPSSTND  191



>gb|KEH38242.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 159/225 (71%), Gaps = 9/225 (4%)
 Frame = -3

Query  774  SVPESKRGS----SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            S+  +K+GS    S + ++ K+T +QL +LK KSK +G+T     YE+LA H+WR   KA
Sbjct  208  SMQHAKQGSDTSASVTVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKA  267

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L  DQ TKLY+ATDGRSRL P LP GY GNV+FT TP+A + +L S+P   +A RIH+
Sbjct  268  RALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHN  327

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            AL +MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP++E+DFGWGRPI 
Sbjct  328  ALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIF  387

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  I YEG  +I+PS   D +LSLA+ L  + M LF+E  YD 
Sbjct  388  MGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFYDI  432



>ref|XP_010094062.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
 gb|EXB55152.1| Hydroxycinnamoyl-Coenzyme A shikimate/quinate hydroxycinnamoyltransferase 
[Morus notabilis]
Length=432

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 156/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  765  ESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQ  601
             SK  ++ S A  KIT +QL  LK KSK +GS+     YE+L+ H+WRCACKAR L DDQ
Sbjct  215  NSKYQTTTSVANFKITKDQLIALKNKSKEDGSSVSYSSYEMLSGHVWRCACKARALPDDQ  274

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKL+VA DGR+RL PPLP  Y GNV+FT TP+A + +L S+P+  +A +IH  L + ++
Sbjct  275  ETKLFVAVDGRARLQPPLPQSYFGNVIFTTTPIALAGDLVSKPIWYAASQIHKTLVKTNN  334

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYL+SA+D+LE QPDLS L+RG++ F  PNL I SW RLP++++DFGWGRPI MGP  I+
Sbjct  335  EYLKSAIDYLEIQPDLSALVRGAHTFRCPNLGITSWVRLPIYDADFGWGRPIFMGPGGIM  394

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +EG  Y+LPSP  D +LS+A+ L  EHM  F + + D 
Sbjct  395  FEGLAYVLPSPTNDGSLSIAIGLQPEHMEAFGKLICDI  432



>gb|KFK35521.1| hypothetical protein AALP_AA4G001700 [Arabis alpina]
Length=424

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 156/218 (72%), Gaps = 5/218 (2%)
 Frame = -3

Query  768  PESKRGSSASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDD  604
            P      + + ++ K++ +QL  LK KSK + +T     YE+LA H+WR   KARGL ++
Sbjct  206  PSQSDPDNTTVSIFKLSRDQLLALKAKSKDDANTVSYSSYEMLAGHVWRSVGKARGLPEN  265

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKLY+ATDGRSRL P LPPGY GNV+FTATP+A + +L S+P   +A  IH  LSRMD
Sbjct  266  QETKLYIATDGRSRLRPQLPPGYFGNVIFTATPLAVAGDLLSKPTWYAAGLIHDVLSRMD  325

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            D YLRSALD+LE QPDLS L+RG++ +  PNL I SW RLP++++DFGWGRPI MGP  I
Sbjct  326  DNYLRSALDYLEMQPDLSALVRGAHTYKCPNLGITSWVRLPIYDADFGWGRPIFMGPGGI  385

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             YEG  ++LPSP  D +LS+A+ L  EHM LF++ LYD
Sbjct  386  PYEGLSFVLPSPINDGSLSVAIALQTEHMKLFEKLLYD  423



>ref|XP_003637275.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase 
[Medicago truncatula]
Length=432

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 159/225 (71%), Gaps = 9/225 (4%)
 Frame = -3

Query  774  SVPESKRGS----SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            S+  +K+GS    S + ++ K+T +QL +LK KSK +G+T     YE+LA H+WR   KA
Sbjct  208  SMQHAKQGSDTSASVAVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKA  267

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L  DQ TKLY+ATDGRSRL P LP GY GNV+FT TP+A + +L S+P   +A RIH+
Sbjct  268  RALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHN  327

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            AL +MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP++E+DFGWGRPI 
Sbjct  328  ALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIF  387

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  I YEG  +I+PS   D +LSLA+ L  + M LF+E  YD 
Sbjct  388  MGPGGIAYEGLSFIIPSSTNDGSLSLAIALPPDQMKLFQELFYDI  432



>ref|XP_002979061.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
 gb|EFJ20018.1| probable hydroxycinnamoyltransferase [Selaginella moellendorffii]
Length=451

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 154/207 (74%), Gaps = 5/207 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            +  + K T EQL  LK+++  E      S+YE+L+ HIWR  C ARGL DDQ TKLY+AT
Sbjct  242  AVGLFKFTKEQLQALKSQATDEETNTTYSSYEMLSGHIWRSMCLARGLDDDQETKLYIAT  301

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+R+ PPLP  Y GNV+FT TPMA + +L S PL  +A  IH+A+SRM+DEYLRSALD
Sbjct  302  DGRARVVPPLPKHYFGNVIFTCTPMALAGDLVSRPLYYAASVIHNAVSRMNDEYLRSALD  361

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL KL+RG++ F SPNL I SW+RLPV+++DFGWGRP+ MGPA I +EG VY+L
Sbjct  362  YLELQPDLYKLVRGAHTFRSPNLGITSWSRLPVYDADFGWGRPVFMGPAVIAFEGLVYVL  421

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFL  136
            PS   D +LS+++ L  EHMP F++ +
Sbjct  422  PSGTGDGSLSISLGLQPEHMPRFEQLI  448



>ref|XP_002991534.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
 gb|EFJ07456.1| probable hydroxycinnamoyl transferase [Selaginella moellendorffii]
Length=449

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 153/207 (74%), Gaps = 5/207 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            +  + K T EQL  LK+++  E      S+YE+L+ HIWR  C ARGL DDQ TKLY+AT
Sbjct  240  AVGLFKFTKEQLQALKSQATDEETNTTYSSYEMLSGHIWRSMCLARGLDDDQETKLYIAT  299

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+R+ PPLP  Y GNV+FT TPMA + +L S PL  +A  IH A+SRM+DEYLRSALD
Sbjct  300  DGRARVVPPLPKHYFGNVIFTCTPMALAGDLVSRPLYYAASVIHDAVSRMNDEYLRSALD  359

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDL KL+RG++ F SPNL I SW+RLPV+++DFGWGRP+ MGPA I +EG VY+L
Sbjct  360  YLELQPDLYKLVRGAHTFRSPNLGITSWSRLPVYDADFGWGRPVFMGPAVIAFEGLVYVL  419

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFL  136
            PS   D +LS+++ L  EHMP F++ +
Sbjct  420  PSGTGDGSLSISLGLQPEHMPRFEQLI  446



>gb|AEJ88365.1| hydroxycinnamoyltransferase [Cucumis sativus]
Length=430

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K T EQL +LK KSK  G+T     YE+L+ H+WR  CKAR L +DQ TKLY+AT
Sbjct  221  TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLYIAT  280

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+RL PPLP GY GNV+FT TP+A + EL S P   +A +IH AL+RMD++YLRSALD
Sbjct  281  DGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALD  340

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QP++S L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +I+
Sbjct  341  YLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFII  400

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS + D +LS+A+ L   HM +F++  +D 
Sbjct  401  PSASDDGSLSVAISLQNRHMKVFEKLFFDI  430



>gb|AFR40239.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   246 bits (628),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  4    STAVSIFKLTXDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  63

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  64   ATDGRSRLXPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  123

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  124  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  183

Query  222  ILPS  211
            I+PS
Sbjct  184  IIPS  187



>ref|XP_004135880.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis 
sativus]
 gb|KGN45212.1| hypothetical protein Csa_7G431440 [Cucumis sativus]
Length=430

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K T EQL +LK KSK  G+T     YE+L+ H+WR  CKAR L +DQ TKLY+AT
Sbjct  221  TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKLYIAT  280

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+RL PPLP GY GNV+FT TP+A + EL S P   +A +IH AL+RMD++YLRSALD
Sbjct  281  DGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALD  340

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QP++S L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +I+
Sbjct  341  YLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFII  400

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS + D +LS+A+ L   HM +F++  +D 
Sbjct  401  PSASDDGSLSVAISLQNRHMKVFEKLFFDI  430



>gb|AFR40251.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40252.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40253.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40254.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40255.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40256.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40257.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40258.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40259.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40260.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40261.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40262.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40263.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40265.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=193

 Score =   246 bits (628),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWCAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|KEH39662.1| shikimate/quinate hydroxycinnamoyltransferase [Medicago truncatula]
Length=432

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/224 (54%), Positives = 159/224 (71%), Gaps = 9/224 (4%)
 Frame = -3

Query  774  SVPESKRGS----SASTAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKA  622
            S+  +K+GS    S + ++ K+T +QL +LK KSK +G+T     YE+LA H+WR   KA
Sbjct  208  SMQHAKQGSDTSASVAVSIFKLTRQQLNILKGKSKEDGNTINYSSYEMLAGHVWRSVSKA  267

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            R L  DQ TKLY+ATDGRSRL P LP GY GNV+FT TP+A + +L S+P   +A RIH+
Sbjct  268  RALPVDQETKLYIATDGRSRLQPSLPQGYFGNVIFTTTPIAVAVDLMSKPTWYAASRIHN  327

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
            AL +MD++YLRSALD+LE QPDL  L+RG++ F  PNL I SW RLP++E+DFGWGRPI 
Sbjct  328  ALLQMDNDYLRSALDYLELQPDLKALVRGAHTFKCPNLGITSWARLPIYEADFGWGRPIF  387

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            MGP  I YEG  +I+PS   D +LSLA+ L  + M LF+E  YD
Sbjct  388  MGPGGIAYEGLSFIIPSSTNDGSLSLAIGLPPDQMKLFQELFYD  431



>gb|AFK40022.1| unknown [Medicago truncatula]
Length=178

 Score =   245 bits (626),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 0/178 (0%)
 Frame = -3

Query  660  ILAAHIWRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQ  481
            +LA H+WR  CKAR L DDQ TKLY+ATDGR+RL PP PPGY GNV+FT TP+A + +L 
Sbjct  1    MLAGHVWRSVCKARSLPDDQETKLYIATDGRARLQPPPPPGYFGNVIFTTTPIAIAGDLM  60

Query  480  SEPLTNSAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLP  301
            ++P   +A RIH+ALSRMD+EYLRSALDFLE QPDL  L+RG++ F  PNL I SW RLP
Sbjct  61   TKPTWYAASRIHNALSRMDNEYLRSALDFLELQPDLKALVRGAHTFKCPNLGITSWARLP  120

Query  300  VHESDFGWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +H++DFGWGRPI MGP  I YEG  +I+PS   D +LS+A+ L  EHM + K+FLYD 
Sbjct  121  IHDADFGWGRPIFMGPGGIAYEGLSFIIPSSANDGSLSVAIALQHEHMKVLKDFLYDI  178



>gb|AFR40264.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=192

 Score =   246 bits (627),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWCAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|AFR40240.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=189

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWXAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  123  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  182

Query  222  ILPS  211
            I+PS
Sbjct  183  IIPS  186



>gb|AFR40246.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   245 bits (626),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  2    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  61

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  62   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  121

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  122  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  181

Query  222  ILPS  211
            I+PS
Sbjct  182  IIPS  185



>gb|AFR40241.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40244.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40249.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=189

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  123  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  182

Query  222  ILPS  211
            I+PS
Sbjct  183  IIPS  186



>gb|AFR40250.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  123  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  182

Query  222  ILPS  211
            I+PS
Sbjct  183  IIPS  186



>gb|AFR40238.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=188

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPS  211
            I+PS
Sbjct  185  IIPS  188



>ref|XP_004158793.1| PREDICTED: LOW QUALITY PROTEIN: shikimate O-hydroxycinnamoyltransferase-like 
[Cucumis sativus]
Length=430

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 153/210 (73%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGST-----YEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K T EQL +LK KSK  G+T     YE+L+ H+WR  CKAR L +DQ TK+Y+AT
Sbjct  221  TVSIFKFTREQLNLLKAKSKENGNTINYSSYEMLSGHVWRSTCKARELPEDQDTKVYIAT  280

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR+RL PPLP GY GNV+FT TP+A + EL S P   +A +IH AL+RMD++YLRSALD
Sbjct  281  DGRARLRPPLPNGYFGNVIFTTTPLAVAGELMSNPTWFAASKIHDALTRMDNDYLRSALD  340

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QP++S L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +I+
Sbjct  341  YLEIQPNISALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSFII  400

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS + D +LS+A+ L   HM +F++  +D 
Sbjct  401  PSASDDGSLSVAISLQNRHMKVFEKLFFDI  430



>gb|AFR40248.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=190

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  4    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  63

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  64   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  123

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  124  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  183

Query  222  ILPS  211
            I+PS
Sbjct  184  IIPS  187



>gb|AFR40231.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40232.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40234.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
 gb|AFR40235.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=193

 Score =   245 bits (625),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNIIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDL+ L+RG++ F  PNL I SW RLP+H++DFGWGRP+ MGP  I YEG  +
Sbjct  125  LDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPLFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|AFR40229.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=191

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  3    STAVSIFKLTRDQLNTLKAKAKEGGNIIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  62

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  63   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  122

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDL+ L+RG++ F  PNL I SW RLP+H++DFGWGRP+ MGP  I YEG  +
Sbjct  123  LDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPLFMGPGGIAYEGLSF  182

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  183  IIPSSTND  190



>gb|AFR40230.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=192

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 142/188 (76%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNIIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDL+ L+RG++ F  PNL I SW RLP+H++DFGWGRP+ MGP  I YEG  +
Sbjct  125  LDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPLFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>ref|XP_008353756.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Malus 
domestica]
Length=441

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 152/211 (72%), Gaps = 5/211 (2%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ ++T EQL VLK KSK EG     STYE+LA H+WRCA KAR L DD+ TKL+V
Sbjct  230  STTVSIFRLTREQLSVLKAKSKEEGNSINYSTYEMLAGHVWRCASKARNLPDDRVTKLHV  289

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            A DGRSRL PPLPPG+ GNVVF   P A + +L+S+P   +A  IH  + R +++YLRSA
Sbjct  290  AVDGRSRLQPPLPPGFFGNVVFAGAPFATAGDLKSKPTWYAASXIHDVVVRXNNDYLRSA  349

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDLS L+RG++ F  P L I SW RLP++++DFGWGRPI MGP  I YEG  +
Sbjct  350  LDYLEVQPDLSALVRGAHTFRCPKLGITSWARLPIYDADFGWGRPIFMGPGGIGYEGLAF  409

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L ++HM  F + LYD
Sbjct  410  VLPSPINDGSLSVAISLQSDHMKSFAKLLYD  440



>gb|AFR40223.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=193

 Score =   244 bits (624),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 141/188 (75%), Gaps = 5/188 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  5    STAVSIFKLTRDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  64

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L  MD++YLRSA
Sbjct  65   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVXMDNDYLRSA  124

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  125  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  184

Query  222  ILPSPNKD  199
            I+PS   D
Sbjct  185  IIPSSTND  192



>gb|AFF19203.1| hydroxycinnamoyl-CoA:quinate hydroxycinnamoyltransferase [Erythroxylum 
coca]
Length=433

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 151/211 (72%), Gaps = 5/211 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            A T +LK+T +Q+  LK  SK +      STYE LAAHIWRC C AR L  DQ T+LY+A
Sbjct  223  ACTKILKLTLDQINTLKATSKQQDGATKYSTYETLAAHIWRCMCMARELDADQPTRLYIA  282

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGRSRL PPLP GY GNV+FT T  + S ++++E L  + KR+  +L RMD+EYLRSAL
Sbjct  283  TDGRSRLRPPLPSGYFGNVIFTTTVTSLSGDIKTETLVQTIKRLRESLKRMDNEYLRSAL  342

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D L+ QPDL  L+RG   F SPNLN+NSW  LP H++DFGWGRP+HMGPA +LYEGTVYI
Sbjct  343  DHLQVQPDLGALVRGPTTFKSPNLNVNSWISLPTHDADFGWGRPLHMGPASVLYEGTVYI  402

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            L +P KD  LS+ + L+ + +  F+  L+DF
Sbjct  403  LKTPAKDGGLSVIIRLEDDILQRFETLLFDF  433



>ref|XP_006303767.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
 gb|EOA36665.1| hypothetical protein CARUB_v10011977mg [Capsella rubella]
Length=430

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 151/208 (73%), Gaps = 4/208 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
            + ++ KI+ + L  LK KS  E     S+YE+LAAH+WR   KARGL DDQ TKLY+ATD
Sbjct  222  TVSIFKISRDLLVSLKAKSNQENTLSYSSYEVLAAHVWRSVGKARGLPDDQETKLYIATD  281

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSR  P LPPG+ GNVVF A P+    +L S+P + +A  IH A++ MDD YLRSALD+
Sbjct  282  GRSRFRPQLPPGFFGNVVFAAAPLTVVGDLLSKPTSYAAGIIHDAIASMDDSYLRSALDY  341

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            LE QPDLS L+RG+  + SPNL I SW RLP++++DFGWGRPI++GP  I YEG  ++LP
Sbjct  342  LEMQPDLSALVRGAQTYKSPNLGITSWARLPMYDADFGWGRPIYVGPGAIAYEGLSFVLP  401

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            SP  D +LSLA+ L  EHM LF++FL++
Sbjct  402  SPTNDGSLSLAIALQPEHMKLFEKFLFE  429



>gb|AFR40242.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=190

 Score =   243 bits (621),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR AC ARGL DDQ TKLY+
Sbjct  4    STAVSIFKLTXDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACXARGLPDDQETKLYI  63

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  64   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  123

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  124  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  183

Query  222  ILPS  211
            I+PS
Sbjct  184  IIPS  187



>gb|AFR40233.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus alba]
Length=190

 Score =   243 bits (620),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR ACKARGL DDQ TKLY+
Sbjct  4    STAVSIFKLTRDQLNTLKAKAKEGGNIIGYSSYEMLAGHVWRSACKARGLPDDQETKLYI  63

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  64   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  123

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDL+ L+RG++ F  PNL I SW RLP+H++DFGWGRP+ MGP  I YEG  +
Sbjct  124  LDFLELQPDLTALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPLFMGPGGIAYEGLSF  183

Query  222  ILPS  211
            I+PS
Sbjct  184  IIPS  187



>emb|CAR40185.1| hydroxycinnamoyl-CoA shikimate hydroxycinnamoyltransferase [Populus 
x canadensis]
Length=236

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 147/197 (75%), Gaps = 5/197 (3%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+V E+ +  S + ++ K++ +QL  LK K+K +G     S+YE+LAAH+WR  CKAR 
Sbjct  39   MKTVLETSKPESTAVSIFKLSRDQLSTLKAKAKEDGNNISYSSYEMLAAHVWRSTCKARE  98

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKLY+ATDGRSR  P LPPGY  NV+FTATP+A + E+QS+P   +A +IH AL
Sbjct  99   LPDDQETKLYIATDGRSRWHPQLPPGYFSNVIFTATPIAVAGEMQSKPTWYAAGKIHDAL  158

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MG
Sbjct  159  VRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADFGWGRPIFMG  218

Query  255  PACILYEGTVYILPSPN  205
            P  I YEG  +ILPSP 
Sbjct  219  PGGIAYEGLSFILPSPT  235



>gb|AFR40236.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=184

 Score =   242 bits (617),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 139/183 (76%), Gaps = 5/183 (3%)
 Frame = -3

Query  747  SASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYV  583
            S + ++ K+T +QL  LK K+K  G     S+YE+LA H+WR AC ARGL DDQ TKLY+
Sbjct  2    STAVSIFKLTXDQLNTLKAKAKEGGNNIGYSSYEMLAGHVWRSACXARGLPDDQETKLYI  61

Query  582  ATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSA  403
            ATDGRSRL P LPPGY GNV+FTATP+A + E+QS+P   +A +IH +L RMD++YLRSA
Sbjct  62   ATDGRSRLRPTLPPGYFGNVIFTATPIAVAGEIQSKPTWYAAGKIHDSLVRMDNDYLRSA  121

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LDFLE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I YEG  +
Sbjct  122  LDFLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIAYEGLSF  181

Query  222  ILP  214
            I+P
Sbjct  182  IIP  184



>gb|AFR40382.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  642  WRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTN  463
            WR  CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWXPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  462  SAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDF  283
            +A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFXCPNLGITSWVRLPIHDADF  120

Query  282  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            GWGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIYD  171



>ref|XP_007215395.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
 gb|EMJ16594.1| hypothetical protein PRUPE_ppa005872mg [Prunus persica]
Length=440

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 159/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  ++    SA+ ++ ++T EQL +LK KSK +G     +TYEILA H+WRCA  AR 
Sbjct  218  IKTGTKAVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEILAGHVWRCASVARE  277

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL PPLPPG+ GNVVF   P+A + +L+S+P   +A  IH  +
Sbjct  278  LPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASCIHDTV  337

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDLS L+RG++ F  P L I SW+RLP++++DFGWGRPI MG
Sbjct  338  VRMDNDYLRSALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPIYDADFGWGRPIFMG  397

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  + YEG  ++LPS   D +LS+A+ L ++HM  F + LY+ 
Sbjct  398  PGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>gb|AFR40372.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40373.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40376.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   241 bits (614),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  642  WRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTN  463
            WR  CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  462  SAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDF  283
            +A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADF  120

Query  282  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            GWGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  171



>ref|XP_007149790.1| hypothetical protein PHAVU_005G0989001g, partial [Phaseolus vulgaris]
 gb|ESW21784.1| hypothetical protein PHAVU_005G0989001g, partial [Phaseolus vulgaris]
Length=241

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 151/207 (73%), Gaps = 5/207 (2%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            +LK++ +QL +LK KSK +G     STYE+LAAHIWR  CKARGL + Q T+LY+  +GR
Sbjct  35   ILKLSRDQLNILKGKSKEDGNTINYSTYEMLAAHIWRSVCKARGLPEVQETRLYIPINGR  94

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
            SRL PPLPPGYLGN +F+  P A + +L S+P   +A +IH+A++RMD+EYLRSALD+L+
Sbjct  95   SRLQPPLPPGYLGNAIFSTIPKALAGDLVSKPTWYAANQIHNAIARMDNEYLRSALDYLK  154

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDL+ L+ G++ F  PN+ INSW + PV+++DFGWGRPI M P  I+YEG   I+PS 
Sbjct  155  LQPDLNALVPGAHTFGCPNVGINSWAKFPVYDADFGWGRPIFMRPGWIIYEGLAIIIPSS  214

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              D +L L + L   HM LF+EFLYD 
Sbjct  215  TNDGSLYLKMALPPHHMKLFQEFLYDI  241



>gb|AFR40350.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40351.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40352.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40353.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40354.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40355.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40356.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40357.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40358.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40359.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40360.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40361.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40362.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40363.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
 gb|AFR40364.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus trichocarpa]
Length=172

 Score =   240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  642  WRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTN  463
            WR  CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  462  SAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDF  283
            +A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  282  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            GWGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  171



>gb|AFR40387.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40388.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40389.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40390.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40391.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40392.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40393.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40394.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40395.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40396.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40397.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40398.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40399.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40400.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
 gb|AFR40401.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus nigra]
Length=172

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 134/171 (78%), Gaps = 0/171 (0%)
 Frame = -3

Query  642  WRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTN  463
            WR  CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   
Sbjct  1    WRSTCKARELPDDQETKLYIATDGRSRWQPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  462  SAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDF  283
            +A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFRCPNLGITSWVRLPIHDADF  120

Query  282  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            GWGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMELFEKFIYD  171



>ref|XP_002277474.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Vitis vinifera]
 emb|CBI36545.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 154/214 (72%), Gaps = 9/214 (4%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEGS---------TYEILAAHIWRCACKARGLTDDQSTKL  589
            ST +L +TPE L  LK KS   GS         TYE LAAH+WRC CKARGL+ DQ TKL
Sbjct  220  STLILHLTPEHLNALKAKSVRHGSPSPSSVKYSTYETLAAHLWRCICKARGLSHDQPTKL  279

Query  588  YVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLR  409
            Y+ TDGR RL P LPPGY GN +FT+T  A S +LQSE  +++ +RI +A++ M+DEYLR
Sbjct  280  YIPTDGRLRLRPTLPPGYFGNALFTSTLTANSGDLQSEAFSDTVQRIRNAIAGMEDEYLR  339

Query  408  SALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGT  229
            SA+D+LE QP+L+ L+RG++ F SPNL + SWTRLP+H+++FGWGRP+HMG    ++EG 
Sbjct  340  SAVDYLEMQPNLTALVRGAHTFRSPNLVVGSWTRLPIHDANFGWGRPMHMGLGSGVFEGN  399

Query  228  VYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              I  SP KD  LS+ +CL+A+ M LFK+ LYD 
Sbjct  400  ACIQRSPTKDNHLSVVICLEAQPMQLFKDLLYDI  433



>ref|XP_007215396.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
 gb|EMJ16595.1| hypothetical protein PRUPE_ppa005873mg [Prunus persica]
Length=440

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 159/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  ++    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA H+WRCA  AR 
Sbjct  218  IKTGTKAVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARE  277

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL PPLPPG+ GNVVF   P+A + +L+S+P   +A  IH  +
Sbjct  278  LPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASCIHDTV  337

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDLS L+RG++ F  P L I SW+RLP++++DFGWGRPI MG
Sbjct  338  VRMDNDYLRSALDYLELQPDLSPLVRGAHTFRCPRLGITSWSRLPIYDADFGWGRPIFMG  397

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  + YEG  ++LPS   D +LS+A+ L ++HM  F + LY+ 
Sbjct  398  PGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMQSFSKLLYEI  440



>ref|XP_008228811.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  ++    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA H+WRCA  AR 
Sbjct  218  IKTGTKAVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARE  277

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL PPLPPG+ GNVVF   P+A + +L+S+P   +A RIH  +
Sbjct  278  LPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDTV  337

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDL  L+RG+  F  P L I +W+RLP++++DFGWGRPI MG
Sbjct  338  VRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPIFMG  397

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  + YEG  ++LPS   D +LS+A+ L ++HM  F + LY+ 
Sbjct  398  PGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>gb|EPS67512.1| hypothetical protein M569_07262 [Genlisea aurea]
Length=448

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 153/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLY  586
            +  + ++ K+T +QL  L+ K   +      S+Y ++A H+WRCAC+AR L DDQ TK+Y
Sbjct  236  TETAVSIFKLTRQQLDSLRAKCGSDQQQAVYSSYVLVAGHVWRCACEARSLPDDQKTKVY  295

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +A DGRSRL PPLPPGY GN +FTATP+A + ++  + L +SA +IH A++RMDDEYLRS
Sbjct  296  IAIDGRSRLRPPLPPGYFGNALFTATPIAAAGDVIGKSLRHSATKIHEAIARMDDEYLRS  355

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL  L+RG++ +  PNL I SW RLP+HE+DFGWGRPI MGP  I +EG  
Sbjct  356  ALDYLELQPDLKALVRGAHTYRCPNLGITSWARLPIHEADFGWGRPIFMGPGGIAFEGLS  415

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLY  133
            ++LPSP+ D +LS+A+ L  +H+ +F +  Y
Sbjct  416  FVLPSPDNDGSLSVAISLQKDHLNVFHKLFY  446



>ref|XP_008228810.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=440

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  +S    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA H+WRCA  AR 
Sbjct  218  IKTGTKSVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARE  277

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL P LPPG+ GNVVF   P+A + +L+S+P   +A RIH A+
Sbjct  278  LPDDQETKLHIAVDGRSRLQPQLPPGFFGNVVFAGAPIAAAGDLKSKPTWYAASRIHDAV  337

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDL  L+RG+  F  P L I +W+RLP++++DFGWGRPI MG
Sbjct  338  VRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPIFMG  397

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  + YEG  ++LPS   D +LS+A+ L ++HM  F + LY+ 
Sbjct  398  PGGMGYEGLAFVLPSATNDGSLSVAISLQSQHMKSFSKLLYEI  440



>ref|XP_007149788.1| hypothetical protein PHAVU_005G0988001g, partial [Phaseolus vulgaris]
 gb|ESW21782.1| hypothetical protein PHAVU_005G0988001g, partial [Phaseolus vulgaris]
Length=189

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = -3

Query  672  STYEILAAHIWRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAES  493
            STYE+LAAH+WRC CKARGL +DQ T+LY+ TDGRSRL PPLPPGYLGNV+F+  P A +
Sbjct  8    STYEMLAAHMWRCLCKARGLPEDQETRLYIPTDGRSRLQPPLPPGYLGNVIFSTIPKALA  67

Query  492  RELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSW  313
             +L S+P   +A +IH+A++RMD+EYLRSALD+L+ QPDL+ L+RG++ F  PN+ INSW
Sbjct  68   GDLVSKPTWYAANQIHNAIARMDNEYLRSALDYLQLQPDLNALVRGAHTFGCPNVGINSW  127

Query  312  TRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLY  133
             + P++++DFGWGRPI M P  IL EG   I+PS   D  L LA+ L   HM LF+EFLY
Sbjct  128  AKFPIYDADFGWGRPIFMRPGWILNEGLSIIIPSSTNDGGLYLAMALPPHHMKLFQEFLY  187

Query  132  DF  127
            D 
Sbjct  188  DI  189



>gb|AFR40375.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40377.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40378.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40379.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40380.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40381.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40383.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40385.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=171

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -3

Query  639  RCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNS  460
            R  CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   +
Sbjct  1    RSTCKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYA  60

Query  459  AKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFG  280
            A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFG
Sbjct  61   AGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADFG  120

Query  279  WGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            WGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  WGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  170



>ref|XP_011036967.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 7/209 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEG-------STYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
            +L IT +QL  LK KS+ +        ST+EILAAHIW+C CKARG+T+DQ+TKL++ TD
Sbjct  235  ILTITSDQLRTLKNKSRKDVVDGTINYSTFEILAAHIWQCTCKARGITNDQATKLHIPTD  294

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PPLP GY GNV+FT   +  S E+QS+PL ++  +I  AL RMD+EYLRSA+D+
Sbjct  295  GRSRLNPPLPAGYCGNVLFTTAILGLSGEIQSKPLVHTIAKIRGALKRMDNEYLRSAIDY  354

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            L+ Q DL  L RG   F SPNLNI SW  +P++++DFGWGRP  MGPA + +EG  YI  
Sbjct  355  LQVQADLEALKRGPRTFKSPNLNIVSWMAMPIYDADFGWGRPYFMGPAIVGFEGMAYIAR  414

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             P+ D +L +  CL++ HM LFKEF YDF
Sbjct  415  CPSNDGSLMIFTCLESNHMELFKEFFYDF  443



>gb|KJB54947.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=417

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 150/210 (71%), Gaps = 5/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            ++ ++ KIT  QL  LK KS   G     STY ILAA+IWRCA KARGL+ DQ TKLY+ 
Sbjct  196  STVSVFKITQNQLNTLKAKSSEHGNKTNYSTYTILAAYIWRCATKARGLSYDQPTKLYMP  255

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            T+GR RL PPLP  Y+GN +FTA+ +A S  LQSEP  N+ +R+H  L RMD+EYLRSAL
Sbjct  256  TNGRPRLHPPLPSRYVGNAMFTASLIALSENLQSEPFVNTLERVHGTLRRMDNEYLRSAL  315

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+LE  PD++   R  + F  PNLNI +W RL +H++DFGWGRPI+MGPA I++EG +Y+
Sbjct  316  DYLETLPDITAARRAPDTFQCPNLNIINWIRLSIHDADFGWGRPIYMGPANIVHEGKIYL  375

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            LPSP  D +LS+  CL   HM LF++ LY+
Sbjct  376  LPSPTDDGSLSVVACLQTAHMKLFEKHLYE  405



>gb|AFR40386.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=172

 Score =   236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 132/171 (77%), Gaps = 0/171 (0%)
 Frame = -3

Query  642  WRCACKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTN  463
            WR  CK   L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   
Sbjct  1    WRSTCKXXELPDDQETKLYIATDGRSRWXPQLPPGYFGNVIFTATPIAVAGEMQSKPTWY  60

Query  462  SAKRIHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDF  283
            +A +IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DF
Sbjct  61   AAGKIHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFXCPNLGITSWVRLPIHDADF  120

Query  282  GWGRPIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            GWGRPI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  121  GWGRPIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMXLFEKFIYD  171



>gb|ACF85468.1| unknown [Zea mays]
 gb|AFW72295.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=257

 Score =   239 bits (611),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + A+ K++  +L  L+++    EG    STY +LAAH+WRCA  ARGL  DQ TKLY AT
Sbjct  49   AVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCAT  108

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR RL PPLP GY GNV+FTATP+A +  + +  +   A  I +AL RMDD Y RSALD
Sbjct  109  DGRQRLQPPLPEGYFGNVIFTATPLANAGTVTAG-VAEGASVIQAALDRMDDGYCRSALD  167

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++L
Sbjct  168  YLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVL  227

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  228  PSANRDGSLSVAISLQAEHMEKFRKLIYDF  257



>ref|XP_006382509.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
 gb|ERP60306.1| hypothetical protein POPTR_0005s02820g [Populus trichocarpa]
Length=444

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 150/210 (71%), Gaps = 8/210 (4%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEG--------STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            +L IT +QL  LK KS+ +         ST+E LAAHIW+C CKARG+T+DQ+TKL++ T
Sbjct  235  ILTITFDQLRTLKNKSRKDVADGSTINYSTFETLAAHIWQCTCKARGITNDQATKLHIPT  294

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLP GY GNV+FTA  +  S E+QS+PL ++  +I  AL RMD+EYLRSA+D
Sbjct  295  DGRSRLNPPLPAGYCGNVLFTAAILGLSGEIQSKPLVDTIAKIRGALKRMDNEYLRSAID  354

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +L+ Q DL  L RG + F SPNLNI SW  +P++++DFGWGRP  MGPA + +EG  YI 
Sbjct  355  YLQVQADLEALKRGPHTFKSPNLNIVSWMTMPIYDADFGWGRPYFMGPAIVGFEGMAYIA  414

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              PN D +L +  CL++ HM LFK+F YDF
Sbjct  415  RCPNNDGSLMIFTCLESNHMELFKKFFYDF  444



>ref|XP_007156887.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
 gb|ESW28881.1| hypothetical protein PHAVU_002G025600g [Phaseolus vulgaris]
Length=424

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 153/210 (73%), Gaps = 5/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            A  ++ K++ EQL +LK KSK +G     STYE+LAAHIWRC  KARGL +DQ T+LY+ 
Sbjct  214  AVASIFKLSREQLNILKGKSKEDGNTVNFSTYEMLAAHIWRCLSKARGLPEDQETRLYIP  273

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            T+GRSRL PPLPPGYLGN +F+  P A + +L S+P   +A +IH+AL+RMD+EY+RSAL
Sbjct  274  TNGRSRLQPPLPPGYLGNAIFSTIPKAFAGDLVSKPTWYAANKIHNALARMDNEYMRSAL  333

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+L+ QPDL+ L+  ++    PN+ INSW + P++++DFGWGRPI M PA I++EG   I
Sbjct  334  DYLQLQPDLNSLLPIAHTSRYPNVRINSWAKFPIYDADFGWGRPIFMRPAWIVHEGQSMI  393

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            LPSP  D  L L + L   HM LF+EFLYD
Sbjct  394  LPSPTNDGNLYLVINLPPHHMKLFQEFLYD  423



>gb|KJB54946.1| hypothetical protein B456_009G055900 [Gossypium raimondii]
Length=445

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 150/210 (71%), Gaps = 5/210 (2%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            ++ ++ KIT  QL  LK KS   G     STY ILAA+IWRCA KARGL+ DQ TKLY+ 
Sbjct  224  STVSVFKITQNQLNTLKAKSSEHGNKTNYSTYTILAAYIWRCATKARGLSYDQPTKLYMP  283

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            T+GR RL PPLP  Y+GN +FTA+ +A S  LQSEP  N+ +R+H  L RMD+EYLRSAL
Sbjct  284  TNGRPRLHPPLPSRYVGNAMFTASLIALSENLQSEPFVNTLERVHGTLRRMDNEYLRSAL  343

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+LE  PD++   R  + F  PNLNI +W RL +H++DFGWGRPI+MGPA I++EG +Y+
Sbjct  344  DYLETLPDITAARRAPDTFQCPNLNIINWIRLSIHDADFGWGRPIYMGPANIVHEGKIYL  403

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            LPSP  D +LS+  CL   HM LF++ LY+
Sbjct  404  LPSPTDDGSLSVVACLQTAHMKLFEKHLYE  433



>gb|ADB44897.1| hydroxycinnamoyl transferase [Sinopodophyllum hexandrum]
Length=438

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 148/213 (69%), Gaps = 5/213 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKH-----EGSTYEILAAHIWRCACKARGLTDDQSTKLY  586
            S +   M K++ +Q+ VLK K K        S++E++A HIWRC CKAR L DDQ +K+ 
Sbjct  226  SPSVVTMFKLSRDQISVLKAKCKDGPDIVSFSSFEVIAGHIWRCICKARQLPDDQESKVS  285

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
            +A DGRSRL P LPPGY GN +F  TPMA S ++ S+PL  +  ++H +L R +DEYLRS
Sbjct  286  IAVDGRSRLNPKLPPGYFGNAIFHITPMAASGDILSKPLIYAVGKLHESLQRANDEYLRS  345

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            A+DFLE  P+ S L+RG + F SPNL I SW ++P+HE+DFGWGRPI MGP  I+YEG  
Sbjct  346  AIDFLELHPNKSSLVRGPHTFRSPNLGITSWCQMPIHEADFGWGRPIFMGPGSIIYEGLA  405

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            Y+LP+P KD +  LAV L  +HM LFK+  YDF
Sbjct  406  YVLPTPEKDGSRFLAVSLLPDHMTLFKKSFYDF  438



>ref|XP_008228885.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=381

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  +S    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA H+WRCA  AR 
Sbjct  159  IKTGTKSVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARE  218

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ +KL++A DGRSRL PP+PPG+ GNVVF++ P+A + +L+S+P   +A RIH A+
Sbjct  219  LPDDQESKLHIAVDGRSRLQPPIPPGFFGNVVFSSAPIAAAGDLKSKPTWYAASRIHDAV  278

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDL  L+RG+  F  P L I +W+RLP++++DFGWGRP  MG
Sbjct  279  VRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPTFMG  338

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPS   D +LS+ + L ++ M  F + LY+ 
Sbjct  339  PGGIGYEGLAFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  381



>ref|XP_002452435.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
 pdb|4KE4|A Chain A, Elucidation Of The Structure And Reaction Mechanism 
Of Sorghum Bicolor Hydroxycinnamoyltransferase And Its Structural 
Relationship To Other Coa-dependent Transferases And Synthases
 pdb|4KEC|A Chain A, Sbhct-complex Form
 gb|EES05411.1| hypothetical protein SORBIDRAFT_04g025760 [Sorghum bicolor]
Length=448

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 152/213 (71%), Gaps = 8/213 (4%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTK---SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLY  586
            A+ A+ K++  +LG L+++    + EG    STY +LAAH+WRCA  ARGL  DQ TKLY
Sbjct  237  AAVAIFKLSRAELGRLRSQVPAREREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLY  296

Query  585  VATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRS  406
             ATDGR RL PPLP GY GNV+FTATP+A +  + +  +   A  I +AL RMDD Y RS
Sbjct  297  CATDGRQRLQPPLPEGYFGNVIFTATPLANAGTVTAG-VAEGAAVIQAALDRMDDGYCRS  355

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  
Sbjct  356  ALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLA  415

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            ++LPS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  416  FVLPSANRDGSLSVAISLQAEHMEKFRKLIYDF  448



>ref|XP_010244666.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010244671.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Nelumbo 
nucifera]
Length=440

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 152/220 (69%), Gaps = 6/220 (3%)
 Frame = -3

Query  768  PESKRG-SSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTD  607
            P+S+ G +  + A  KIT +Q+  LKT +K        STY +LA H+WRC  KARGL D
Sbjct  221  PKSQSGPTDVAVAKFKITVDQINTLKTNAKENDNTLNYSTYAVLAGHVWRCVSKARGLRD  280

Query  606  DQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRM  427
            DQ T L++  DGRSRL PPLPPGY GN +   T  A   EL+S+PL  +  R+H  ++RM
Sbjct  281  DQDTNLFITVDGRSRLRPPLPPGYFGNGILLTTSNALCGELRSKPLGYAVGRVHDVVTRM  340

Query  426  DDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPAC  247
            +DEY+RSA+D+LE QPDL+  +RG + F SPN  + SW RLP++++DFGWGRPIH+GPA 
Sbjct  341  NDEYVRSAIDYLELQPDLTPFVRGPHMFRSPNFWMVSWARLPLYDADFGWGRPIHVGPAV  400

Query  246  ILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            +  EG  YILPSP  D ++ LA+ L ++HM +F++ LYDF
Sbjct  401  VYSEGLSYILPSPTNDGSVLLAISLQSDHMEVFRKILYDF  440



>gb|AFR40374.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
 gb|AFR40384.1| hydroxcinnamoyl-CoA quinate/shikimate hydroxycinnamoyltransferase, 
partial [Populus fremontii]
Length=170

 Score =   235 bits (599),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = -3

Query  630  CKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKR  451
            CKAR L DDQ TKLY+ATDGRSR  P LPPGY GNV+FTATP+A + E+QS+P   +A +
Sbjct  3    CKARELPDDQETKLYIATDGRSRWHPQLPPGYFGNVIFTATPIAVAGEMQSKPTWYAAGK  62

Query  450  IHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGR  271
            IH AL RMD++YL+SALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGR
Sbjct  63   IHDALVRMDNDYLKSALDYLELQPDLSALVRGAHSFQCPNLGITSWVRLPIHDADFGWGR  122

Query  270  PIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            PI MGP  I YEG  +ILPSP  D ++S+A+ L A+HM LF++F+YD
Sbjct  123  PIFMGPGGIAYEGLSFILPSPTNDGSMSVAISLQAQHMKLFEKFIYD  169



>gb|AGM90558.1| hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyltransferase 
2 [Panicum virgatum]
Length=446

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/211 (55%), Positives = 152/211 (72%), Gaps = 6/211 (3%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            A+ A+ +++   LG L+++    EG    STY +LAAH+WRCA  ARGL  DQ TKLY A
Sbjct  237  AAVAIFRLSRADLGRLRSQIPAREGVPRLSTYAVLAAHVWRCASLARGLPADQPTKLYCA  296

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGR RL PPLP GY GNV+FTATP+A++  + +  +   A  I +AL RMD+ Y RSAL
Sbjct  297  TDGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAG-VAEGAAVIQAALDRMDEGYCRSAL  355

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++
Sbjct  356  DYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFV  415

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            LPS N+D +LS+A+ L AEHM  F++F+YDF
Sbjct  416  LPSANRDGSLSVAISLQAEHMEKFRKFIYDF  446



>ref|XP_008228828.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Prunus 
mume]
Length=442

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  +S    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA H+WRCA  AR 
Sbjct  220  IKTGTKSVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHVWRCASVARE  279

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ +KL++A DGRSRL PPLPPG+ GNV+F++ P+A + +L+S+P   +A RIH A+
Sbjct  280  LPDDQESKLHIAVDGRSRLQPPLPPGFFGNVIFSSAPIAAAGDLKSKPTWYAASRIHDAV  339

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDL  L+RG+  F  P L I +W+RLP++++DFGWGRP  MG
Sbjct  340  VRMDNDYLRSALDYLELQPDLLPLVRGARTFRCPRLAITNWSRLPIYDADFGWGRPTFMG  399

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPS   D +LS+ + L ++ M  F + LY+ 
Sbjct  400  PGGIGYEGLAFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  442



>ref|XP_007215406.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
 gb|EMJ16605.1| hypothetical protein PRUPE_ppa005955mg [Prunus persica]
Length=435

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  ++    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA HIW+CA  AR 
Sbjct  213  IKTGTKAVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHIWKCASVARE  272

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL PPLPPG+ GNVVF++ P+A + +L+SEP   +A RIH A+
Sbjct  273  LPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFSSAPIAATGDLKSEPTWYAASRIHDAV  332

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD++YLRSALD+LE QPDL   +RG++ F  P L I +W+RLP++++DFGWGRP  MG
Sbjct  333  VRMDNDYLRSALDYLELQPDLLPHVRGAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMG  392

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPS   D +LS+ + L ++ M  F + LY+ 
Sbjct  393  PGGIGYEGLAFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  435



>gb|ACF81845.1| unknown [Zea mays]
 gb|AFW72296.1| hypothetical protein ZEAMMB73_779483 [Zea mays]
Length=319

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + A+ K++  +L  L+++    EG    STY +LAAH+WRCA  ARGL  DQ TKLY AT
Sbjct  111  AVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCAT  170

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR RL PPLP GY GNV+FTATP+A +  + +  +   A  I +AL RMDD Y RSALD
Sbjct  171  DGRQRLQPPLPEGYFGNVIFTATPLANAGTVTAG-VAEGASVIQAALDRMDDGYCRSALD  229

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++L
Sbjct  230  YLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVL  289

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  290  PSANRDGSLSVAISLQAEHMEKFRKLIYDF  319



>ref|XP_009380783.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=440

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 153/212 (72%), Gaps = 5/212 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSK---HEGSTYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            ++A+  + K+T  QL +LK K+       STY +LAAH+WRCAC ARGL  DQ TK+Y+A
Sbjct  228  AAAAVDIFKLTKAQLSLLKLKAPPGPASYSTYALLAAHVWRCACVARGLPPDQPTKMYIA  287

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPL--TNSAKRIHSALSRMDDEYLRS  406
            TDGR RL P LP GY GNV+FT TP+A + E+ +E      +A RI +AL+RMD+ YLRS
Sbjct  288  TDGRQRLRPALPEGYFGNVIFTTTPIATAGEVAAEGCGPAPAAGRIQAALARMDEPYLRS  347

Query  405  ALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTV  226
            ALD+LE QPDL+ L+RG++ F  PN+ + SW RLP+H++DFGWGRP+ MGP  I YEG  
Sbjct  348  ALDYLELQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLA  407

Query  225  YILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            ++LPSP  D +LSLA+ L A+HM  F++ +YD
Sbjct  408  FLLPSPTGDGSLSLAISLRADHMLKFRKLIYD  439



>ref|XP_011018051.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
 ref|XP_011018052.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=440

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 157/221 (71%), Gaps = 8/221 (4%)
 Frame = -3

Query  768  PESKRGS-SASTAMLKITPEQLGVLK------TKSKHEGSTYEILAAHIWRCACKARGLT  610
            P  + GS   S A LKI  + L  LK      T SK E STY IL AHIWRCACKARGL+
Sbjct  215  PIRQSGSRDISVANLKIPRDLLNTLKAMAKNDTASKTEYSTYVILTAHIWRCACKARGLS  274

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
             DQ+TK+ ++T+GR+RL PP+PPGY GNV+F ATP+A S +L SE L + A+RIH A+ R
Sbjct  275  YDQATKINISTNGRNRLRPPIPPGYFGNVIFQATPIALSGDLSSERLAHIAERIHKAIKR  334

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSA+D+LE   DL+ ++R S  + SPNLNI SW R P +++DFGWG+P++M PA
Sbjct  335  MDDEYLRSAVDYLEKVDDLTTVMRSSETYRSPNLNIVSWVRFPFYDADFGWGKPVYMRPA  394

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
               +EG  YILPSP  D TLSL +CL+ +H+  F++  Y++
Sbjct  395  -FAFEGKGYILPSPTNDGTLSLTICLETDHLESFQKLFYEY  434



>ref|XP_008790160.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790161.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
 ref|XP_008790163.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Phoenix dactylifera]
Length=434

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 147/203 (72%), Gaps = 4/203 (2%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEGS--TYEILAAHIWRCACKARGLTDDQSTKLYVATDGRSRL  559
            + K T  QL +LK K+    S  TY + +AH+WRCA  AR L  DQ TKLY+ATDGR RL
Sbjct  233  LFKFTRAQLDLLKAKTPKGSSYSTYALFSAHVWRCASLARELPPDQLTKLYIATDGRQRL  292

Query  558  CPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLECQP  379
             PPLP GY GNV+FTATP+A + E+ S     +A RI ++L+RMDD+YLRSA+D+LE QP
Sbjct  293  RPPLPAGYFGNVIFTATPVAAAAEVVSS--EGAAGRIQASLARMDDQYLRSAVDYLEIQP  350

Query  378  DLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSPNKD  199
            DL  L+RG++ F  PN+ + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPSP+ D
Sbjct  351  DLRALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSPDGD  410

Query  198  RTLSLAVCLDAEHMPLFKEFLYD  130
             +LSLA+ L AEHM  F++ +YD
Sbjct  411  GSLSLAISLQAEHMLRFQKLIYD  433



>ref|XP_010942061.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase [Elaeis guineensis]
Length=434

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 149/210 (71%), Gaps = 4/210 (2%)
 Frame = -3

Query  753  GSSASTAMLKITPEQLGVLKTKSKHEG--STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            G   + ++ K T  QL +LK K+      STY + AAH+WRCA  AR L  DQ +KLY+A
Sbjct  226  GPVTAVSLFKFTRAQLDLLKAKAPKGSRYSTYALFAAHVWRCASLARELPPDQLSKLYIA  285

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGR RL P LP GY GNV+FTATP+AE  E+       +A RI ++L+RMDDEYLRSAL
Sbjct  286  TDGRQRLRPQLPAGYFGNVIFTATPVAEMVEVVGS--EGAAGRIQASLARMDDEYLRSAL  343

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+LE QPDL+ L+RG++ F  PN+ + SW RLP+H++DFGWGRP+ MGP  I YEG  ++
Sbjct  344  DYLEIQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFV  403

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            LPSP+ D +LSLA+ L AEHM  F++ +Y+
Sbjct  404  LPSPDGDGSLSLAISLQAEHMLRFQKLIYE  433



>ref|XP_011036823.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Populus 
euphratica]
Length=443

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 149/209 (71%), Gaps = 7/209 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEG-------STYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
            +L IT +QL  LK KS+ +        ST+E LAAHIW+C CKARG+T+DQ+TKL++ TD
Sbjct  235  ILIITSDQLRTLKNKSRKDVVDGTINYSTFETLAAHIWQCTCKARGITNDQATKLHIPTD  294

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PPLP GY GN +FT   +  S E+QS+PL ++  +I  AL RMD+EYLRSA+D+
Sbjct  295  GRSRLNPPLPAGYCGNALFTTAILGLSGEIQSKPLVHTIAKIRGALKRMDNEYLRSAIDY  354

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
             + Q DL  L RG + F +PN+NI SW  +P++++DFGWGRP  MGPA +L+EG  YI  
Sbjct  355  SQVQTDLEALKRGPHTFNNPNINIVSWMTMPIYDADFGWGRPSFMGPAVVLFEGMAYITR  414

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP+ D +  + +CL++ HM LFKEF YDF
Sbjct  415  SPSNDGSFMVFICLESNHMELFKEFFYDF  443



>ref|XP_006382508.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
 gb|ERP60305.1| hypothetical protein POPTR_0005s02810g [Populus trichocarpa]
Length=443

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 149/209 (71%), Gaps = 7/209 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKH-------EGSTYEILAAHIWRCACKARGLTDDQSTKLYVATD  574
            +L IT +QL  LK KS+          ST+E LAAHIW+C CKARG+++DQ+TKL++ TD
Sbjct  235  ILTITFDQLRTLKNKSRKGVVDGTINYSTFETLAAHIWQCTCKARGISNDQATKLHIPTD  294

Query  573  GRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDF  394
            GRSRL PPLP GY GN +FT   +  S E+QS+PL ++  +I  AL RMD+EYLRSA+D+
Sbjct  295  GRSRLNPPLPAGYCGNALFTTAVLGLSGEIQSKPLVHTITKIRGALKRMDNEYLRSAIDY  354

Query  393  LECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILP  214
            L  QP+L  L RG + F +PN+NI SW  +P++++DFGWGRP  MGPA +L+EG  YI  
Sbjct  355  LHVQPNLEALKRGPHTFNNPNINIVSWMTMPIYDADFGWGRPSFMGPAVVLFEGMAYITR  414

Query  213  SPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            SP+ D +  + +CL++ HM LFK+F YDF
Sbjct  415  SPSNDGSFMIFICLESNHMELFKKFFYDF  443



>ref|XP_003575337.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Brachypodium 
distachyon]
Length=442

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 151/211 (72%), Gaps = 6/211 (3%)
 Frame = -3

Query  744  ASTAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVA  580
            A+  + K++   LG L+ +    EG    STY +L AH+WRCA  ARGL  +Q TKLY A
Sbjct  233  AAVDIFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCA  292

Query  579  TDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSAL  400
            TDGR RL PPLP GY GNV+FTATP+AE+ ++ +  L + A  I +AL RMD+EY RSAL
Sbjct  293  TDGRQRLLPPLPEGYFGNVIFTATPLAEAGKVIAS-LADGANTIQAALERMDNEYCRSAL  351

Query  399  DFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYI  220
            D+LE QPDLS L+RG++ F  PNL + SW RLP+HE+DFGWGRP+ MGP  I YEG  ++
Sbjct  352  DYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHEADFGWGRPVFMGPGGIAYEGLAFV  411

Query  219  LPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            LPS ++D +LS+A+ L AEHM  F++ ++DF
Sbjct  412  LPSASRDGSLSVAISLQAEHMEKFRKMIFDF  442



>ref|XP_007216677.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
 gb|EMJ17876.1| hypothetical protein PRUPE_ppa1027182mg [Prunus persica]
Length=442

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 156/223 (70%), Gaps = 5/223 (2%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARG  616
            +K+  ++    SA+ ++ ++T EQL +LK KSK +G     +TYE+LA HIWRCA  AR 
Sbjct  220  IKTGTKAVGDESATVSIFRLTREQLNILKAKSKEDGNTINYTTYEMLAGHIWRCASVARE  279

Query  615  LTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSAL  436
            L DDQ TKL++A DGRSRL PPLPPG+ GNVVF+  P+A + +++S+P   +A RIH A+
Sbjct  280  LPDDQETKLHIAVDGRSRLQPPLPPGFFGNVVFSGAPIAAAGDIKSKPTWYAASRIHDAV  339

Query  435  SRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMG  256
             RMD+ YLRSALD+LE QPDL   +RG++ F  P L I +W+RLP++++DFGWGRP  MG
Sbjct  340  VRMDNNYLRSALDYLELQPDLLPHVRGAHTFRCPRLAITNWSRLPIYDADFGWGRPTFMG  399

Query  255  PACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            P  I YEG  ++LPS   D +LS+ + L ++ M  F + LY+ 
Sbjct  400  PGGIGYEGLAFVLPSATNDGSLSVVISLQSQRMKSFSKLLYEI  442



>ref|XP_001756433.1| predicted protein [Physcomitrella patens]
 gb|EDQ78829.1| predicted protein [Physcomitrella patens]
Length=410

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 151/207 (73%), Gaps = 5/207 (2%)
 Frame = -3

Query  732  MLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + + T EQL  LK  +  E      S+YE+L+ HIW+C  +AR L + Q TKL+VATDGR
Sbjct  204  VFRFTKEQLATLKRMAVEEKADVTFSSYEMLSGHIWKCITQARKLAESQETKLFVATDGR  263

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
            SRL PPLP GY GNV+FT TP+A + EL S P+T +A++IH +L+RM+DEYLRSALD+LE
Sbjct  264  SRLNPPLPKGYFGNVIFTCTPIATAGELVSNPITYAARKIHDSLARMNDEYLRSALDYLE  323

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             Q D+SKL+RG+++F SPNL I SW R+P ++ DFGWGRPI MGPA I YEG VY+L SP
Sbjct  324  TQEDISKLVRGAHHFNSPNLGITSWARMPTYDCDFGWGRPIFMGPATIAYEGLVYVLASP  383

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
              D +LSL++ L ++HM  F + +  F
Sbjct  384  VNDGSLSLSLGLRSDHMDTFAKLVASF  410



>gb|ACG29714.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
 gb|ACG30562.1| anthranilate N-benzoyltransferase protein 1 [Zea mays]
Length=447

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + A+ K++  +L  L+++    EG    STY +LAAH+WRCA  ARGL  DQ TKLY AT
Sbjct  239  AVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCAT  298

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR RL PPLP GY GNV+FTATP+A +  + +  +   A  I +AL RMDD Y RSALD
Sbjct  299  DGRQRLQPPLPEGYFGNVIFTATPLANAGTVTAG-VAEGASVIQAALDRMDDGYCRSALD  357

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++L
Sbjct  358  YLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVL  417

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  418  PSANRDGSLSVAISLQAEHMEKFRKLIYDF  447



>ref|NP_001132890.1| LOC100194386 [Zea mays]
 ref|XP_008681252.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 ref|XP_008681253.1| PREDICTED: LOC100194386 isoform X1 [Zea mays]
 gb|ACF81923.1| unknown [Zea mays]
 gb|ACF84236.1| unknown [Zea mays]
 gb|ACR38175.1| unknown [Zea mays]
 gb|AFW72298.1| anthranilate N-benzoyltransferase protein 1 isoform 1 [Zea mays]
 gb|AFW72299.1| anthranilate N-benzoyltransferase protein 1 isoform 2 [Zea mays]
 gb|AFW72300.1| anthranilate N-benzoyltransferase protein 1 isoform 3 [Zea mays]
 gb|AFW72301.1| anthranilate N-benzoyltransferase protein 1 isoform 4 [Zea mays]
Length=446

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + A+ K++  +L  L+++    EG    STY +LAAH+WRCA  ARGL  DQ TKLY AT
Sbjct  238  AVAIFKLSRAELVRLRSQVPAREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKLYCAT  297

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR RL PPLP GY GNV+FTATP+A +  + +  +   A  I +AL RMDD Y RSALD
Sbjct  298  DGRQRLQPPLPEGYFGNVIFTATPLANAGTVTAG-VAEGASVIQAALDRMDDGYCRSALD  356

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++L
Sbjct  357  YLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVL  416

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  417  PSANRDGSLSVAISLQAEHMEKFRKLIYDF  446



>ref|NP_001053225.1| Os04g0500700 [Oryza sativa Japonica Group]
 emb|CAC09509.2| H0711G06.15 [Oryza sativa Indica Group]
 dbj|BAF15139.1| Os04g0500700 [Oryza sativa Japonica Group]
 dbj|BAG96851.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99596.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77573.1| hypothetical protein OsI_16514 [Oryza sativa Indica Group]
 gb|EEE61270.1| hypothetical protein OsJ_15346 [Oryza sativa Japonica Group]
Length=442

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 155/227 (68%), Gaps = 11/227 (5%)
 Frame = -3

Query  780  LKSVPESKRGSSAS-----TAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCA  631
            L SVP+S   +  +       + K+T   LG L+++    EG    STY +LAAH+WRC 
Sbjct  216  LSSVPQSVTANKTTPPPTAVDIFKLTRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCV  275

Query  630  CKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKR  451
              ARGL  +Q TKLY ATDGR RL PPLP GY GNV+FTATP+AE+ ++ S  L + A  
Sbjct  276  SLARGLPSEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGKVTSG-LADGAAV  334

Query  450  IHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGR  271
            I  AL RM+D Y RSALD+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGR
Sbjct  335  IQEALDRMNDSYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGR  394

Query  270  PIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P+ MGP  I YEG  ++LPS NKD +LS+A+ L AEHM  F++ +++
Sbjct  395  PVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  441



>emb|CAE01635.3| OSJNBa0029H02.19 [Oryza sativa Japonica Group]
Length=484

 Score =   239 bits (611),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 155/227 (68%), Gaps = 11/227 (5%)
 Frame = -3

Query  780  LKSVPESKRGSSAS-----TAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCA  631
            L SVP+S   +  +       + K+T   LG L+++    EG    STY +LAAH+WRC 
Sbjct  233  LSSVPQSVTANKTTPPPTAVDIFKLTRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCV  292

Query  630  CKARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKR  451
              ARGL  +Q TKLY ATDGR RL PPLP GY GNV+FTATP+AE+ ++ S  L + A  
Sbjct  293  SLARGLPSEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGKVTSG-LADGAAV  351

Query  450  IHSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGR  271
            I  AL RM+D Y RSALD+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGR
Sbjct  352  IQEALDRMNDSYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGR  411

Query  270  PIHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            P+ MGP  I YEG  ++LPS NKD +LS+A+ L AEHM  F++ +++
Sbjct  412  PVFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  458



>ref|XP_004953073.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=518

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 149/210 (71%), Gaps = 6/210 (3%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + A+ +++   LG L+++    EG    STY +LAAH+WRCA  ARGL  DQ TK+Y AT
Sbjct  310  AVAIFRLSRADLGRLRSRIPAREGAPRFSTYAVLAAHVWRCASLARGLPADQPTKMYCAT  369

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGR RL PPLP GY GNV+FTATP+A++  + +  +   A  I  AL RMDD Y RSALD
Sbjct  370  DGRQRLQPPLPEGYFGNVIFTATPLADAGTVTAG-VAEGAAVIQEALDRMDDGYCRSALD  428

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            +LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++L
Sbjct  429  YLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVL  488

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PS N+D +LS+A+ L AEHM  F++ +YDF
Sbjct  489  PSANRDGSLSVAISLQAEHMEKFRKLIYDF  518



>ref|XP_006652479.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Oryza 
brachyantha]
Length=440

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 159/226 (70%), Gaps = 10/226 (4%)
 Frame = -3

Query  780  LKSVPES--KRGSSASTA--MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCAC  628
            L S+P+S   + ++  TA  + K++   LG L+++    EG    STY +LAAH+WRC  
Sbjct  215  LSSMPQSVIAKTTTPPTAVDIFKLSRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVS  274

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             ARGL  +Q TKLY ATDGR RL PPLP GY GNV+FTATP+AE+ ++ S  L + A  I
Sbjct  275  LARGLPTEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGKVTSG-LADGAAVI  333

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
              AL RM+D+Y RSALD+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP
Sbjct  334  QEALDRMNDDYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRP  393

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            + MGP  I YEG  ++LPS NKD +LS+A+ L AEHM  F++ +++
Sbjct  394  VFMGPGGIAYEGLAFVLPSANKDGSLSIAISLQAEHMEKFRKLIFE  439



>ref|XP_009365251.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Pyrus 
x bretschneideri]
Length=441

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 156/219 (71%), Gaps = 7/219 (3%)
 Frame = -3

Query  762  SKRGSSAST--AMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDD  604
            +K G S ST  ++ ++T EQL VLK KSK EG     STYE+LA H+WRCA KAR L DD
Sbjct  223  TKDGDSESTTVSIFRLTREQLSVLKAKSKEEGNTINYSTYEMLAGHVWRCASKARNLPDD  282

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q TKL++A DGRSRL PPLP G+ GNVVF   P+A   +L+S+P   +A RIH  + RM+
Sbjct  283  QVTKLHIAVDGRSRLQPPLPIGFFGNVVFAGAPLATVGDLKSKPTWYAASRIHDIVVRMN  342

Query  423  DEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            ++YLRSALD+LE QPDLS L+RG++ F  P L I SW RLP++E+DFGWG P+ MGP  I
Sbjct  343  NDYLRSALDYLEVQPDLSALVRGAHTFGCPKLGITSWVRLPIYEADFGWGGPMFMGPGGI  402

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
             YEG  ++LPSP  D +LS+A+ L ++HM  F + LYD 
Sbjct  403  GYEGLSFVLPSPTSDGSLSVAISLKSDHMESFAKLLYDI  441



>gb|KJB56505.1| hypothetical protein B456_009G122600 [Gossypium raimondii]
Length=404

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 146/217 (67%), Gaps = 22/217 (10%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEGSTYEILAAHIWRCACKARGLTDDQ  601
            +K  P+S    S + ++ K+T +QL  LK K K +                      DDQ
Sbjct  209  MKIPPQSTGPESTAISIFKLTRDQLNALKAKCKED----------------------DDQ  246

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             TKLY+ATDGR+RL PPLPPGY GNV+FTATP+A + +L S+P   +A RIH AL RMDD
Sbjct  247  GTKLYIATDGRARLRPPLPPGYFGNVIFTATPIAVAGDLLSKPTWYAASRIHDALVRMDD  306

Query  420  EYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACIL  241
            EYLRSALD+LE QPDLS L+RG++ F  PNL I SW RLP+H++DFGWGRPI MGP  I 
Sbjct  307  EYLRSALDYLELQPDLSALVRGAHTFRCPNLGITSWVRLPIHDADFGWGRPIFMGPGGIP  366

Query  240  YEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            YEG  ++LPSPN D +LS+A+ L  EHM +F++  YD
Sbjct  367  YEGLSFVLPSPNNDGSLSVAISLQTEHMNVFEKLFYD  403



>ref|XP_002324530.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
 gb|EEF03095.2| hypothetical protein POPTR_0018s11370g [Populus trichocarpa]
Length=440

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 153/221 (69%), Gaps = 8/221 (4%)
 Frame = -3

Query  771  VPESKRGSSASTAMLKITPEQLGVLKT------KSKHEGSTYEILAAHIWRCACKARGLT  610
            +PES      S A LKI  + L  LK        SK E STY IL AHIWRCACKARGL+
Sbjct  216  IPESG-SKDISVANLKIPSDLLNTLKAMAKNDIASKTEYSTYVILTAHIWRCACKARGLS  274

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            +DQ+TK+ ++TDGR+R  PP+PPGY GNV+F ATP+A S  L SEPL ++A+RIH A+ R
Sbjct  275  NDQATKINISTDGRNRFRPPIPPGYFGNVIFQATPIALSGALLSEPLAHTAERIHKAIKR  334

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSA+D+LE   D + ++R S  + SPNL I SW RLP +++DFGWG+P++M PA
Sbjct  335  MDDEYLRSAVDYLERVDDFTTVMRSSETYRSPNLTIASWVRLPFYDADFGWGKPVYMRPA  394

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
               + G  YI PSP  D TLSL + L+ +H+  F++  Y++
Sbjct  395  SA-FVGKGYIQPSPTNDGTLSLTIFLETDHLQSFQKLFYEY  434



>ref|XP_004976123.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Setaria 
italica]
Length=439

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/227 (51%), Positives = 155/227 (68%), Gaps = 10/227 (4%)
 Frame = -3

Query  780  LKSVPES----KRGSSASTAMLKITPEQLGVLKTK-SKHEGS----TYEILAAHIWRCAC  628
            L S P+S     +  + +  + K+T   LG L+++    EG+    TY +LAAH+W+C  
Sbjct  214  LSSTPQSLTSISKPPATAVDIFKLTRSDLGRLRSQLPTGEGAPRFNTYAVLAAHVWKCVS  273

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             ARGLT +Q TKLY ATDGR RL PPLP GY GNV+FTATP+AE+ ++ S  L   A  I
Sbjct  274  LARGLTPEQPTKLYCATDGRQRLQPPLPDGYFGNVIFTATPLAEAGKVTSG-LAEGAAVI  332

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
              AL RMD++Y RSALD+LE QPDLS L+RG++ F  PNL + SW RLP+H+++FGWGRP
Sbjct  333  QGALDRMDNDYCRSALDYLELQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDANFGWGRP  392

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + MGP  I YEG  ++LPS N D +LS+A+ L AEHM  F++ +Y+ 
Sbjct  393  VFMGPGGIAYEGLAFVLPSANGDGSLSIAISLQAEHMVKFRKLIYEL  439



>dbj|BAC78635.1| hydroxyanthranilate hydroxycinnamoyltransferase 3 [Avena sativa]
Length=440

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 145/207 (70%), Gaps = 6/207 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + K++   LG L+ +    EG    STY +L AH+WRCA  ARGL  +Q TKLY ATDGR
Sbjct  235  IFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGR  294

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
             RL P LP GY GNV+FTATP+AE+ ++    L + A  I  AL +MDDEY  SALD+LE
Sbjct  295  QRLTPTLPDGYFGNVIFTATPLAEAGKVTGS-LADGATTIQDALEKMDDEYCHSALDYLE  353

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPS 
Sbjct  354  LQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSA  413

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            N+D +LS+A+ L AEHM  F++ ++DF
Sbjct  414  NRDGSLSVAISLQAEHMEKFRKMIFDF  440



>gb|EPS67739.1| hypothetical protein M569_07035, partial [Genlisea aurea]
Length=428

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 153/217 (71%), Gaps = 5/217 (2%)
 Frame = -3

Query  768  PESKRGSSA---STAMLKITPEQLGVLKTK-SKHEGSTYEILAAHIWRCACKARGLTDDQ  601
            P+ K  ++A     A+ K+T +Q+  LK +   +  STY ILAAHIWRCAC AR L +DQ
Sbjct  210  PQMKSAAAAPETVEAIFKLTRKQIASLKAQHGDNTLSTYVILAAHIWRCACSARALPEDQ  269

Query  600  STKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDD  421
             T+L +A +GRSRL PPLPP Y GN +FTATP++ + ++  +PL +SA +I  AL RMDD
Sbjct  270  ETQLDIAVNGRSRLRPPLPPAYFGNAIFTATPLSVAGDVTGKPLRHSAAKIQEALWRMDD  329

Query  420  EYLRSALDFLECQP-DLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACI  244
            EYLRSALD+LE +  +L  L+RG   F  PNL I SW RLPVHE+DFGWG+P+ MGPA I
Sbjct  330  EYLRSALDYLELRRLELKGLVRGRESFRCPNLGIVSWIRLPVHEADFGWGKPVFMGPAGI  389

Query  243  LYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLY  133
             YEG  Y++PSP  D +LS+A+CL  +H+  F++ LY
Sbjct  390  GYEGLCYVIPSPADDGSLSVAICLLEDHVEAFRKSLY  426



>dbj|BAC78634.1| hydroxyanthranilate hydroxycinnamoyltransferase 2 [Avena sativa]
Length=440

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 144/207 (70%), Gaps = 6/207 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + K++   LG L+ +    EG    STY +L AH+WRCA  ARGL  +Q TKLY ATDGR
Sbjct  235  IFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASMARGLAPEQPTKLYCATDGR  294

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
             RL P LP GY GN +FTATP+AE+ ++    L + A  I  AL +MDDEY  SALD+LE
Sbjct  295  QRLTPTLPDGYFGNAIFTATPLAEAGKVTGS-LADGATTIQEALEKMDDEYCHSALDYLE  353

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPS 
Sbjct  354  LQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSA  413

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            N+D +LS+A+ L AEHM  F++ ++DF
Sbjct  414  NRDGSLSVAISLQAEHMEKFRKMIFDF  440



>gb|EPS73563.1| hypothetical protein M569_01193, partial [Genlisea aurea]
Length=305

 Score =   230 bits (586),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 151/220 (69%), Gaps = 6/220 (3%)
 Frame = -3

Query  768  PESKRGSSAST--AMLKITPEQLGVLKTKSK---HEGSTYEILAAHIWRCACKARGLTDD  604
            P++   S A T  ++LK+T EQL  LKTKS+   +  +TY  +AAH+WRCA  AR L+ D
Sbjct  75   PDAAAVSDAETVESILKLTREQLNSLKTKSREGNNSATTYVTIAAHVWRCATLARSLSAD  134

Query  603  QSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMD  424
            Q T+L +  +GRSRL PPLPPGY GN +F A   A + ++  +PL+ SA  I  AL+RMD
Sbjct  135  QKTQLDIPVNGRSRLRPPLPPGYFGNGIFPAAASAVAGDVVGKPLSQSAATIREALARMD  194

Query  423  DEYLRSALDFLEC-QPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPAC  247
            DEYLRSALD++E  +P+L  L+RGS  F  PNL I SW  LP+HE+DFGWGRP+ MGP  
Sbjct  195  DEYLRSALDYVETFRPNLKGLVRGSETFRCPNLGIVSWIGLPIHEADFGWGRPVFMGPIG  254

Query  246  ILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            I YEG  Y++PSP+ D +LS+A+CL  +HM  F++  Y  
Sbjct  255  IGYEGLSYVIPSPDNDGSLSVAICLHKDHMVRFQKLFYQI  294



>ref|XP_007011894.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
 gb|EOY29513.1| Hydroxycinnamoyl CoA shikimate/quinate hydroxycinnamoyltransferase, 
putative [Theobroma cacao]
Length=543

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 148/206 (72%), Gaps = 8/206 (4%)
 Frame = -3

Query  774  SVPESKRGSS-ASTAMLKITPEQLGVLKTKSKHEG-------STYEILAAHIWRCACKAR  619
            S P  + G   +ST++ KIT +QL  L++K+   G       +TY +L AH+WRC CKAR
Sbjct  214  STPNCQAGPKPSSTSIFKITADQLKTLESKATMNGNTTRANRTTYHVLTAHLWRCVCKAR  273

Query  618  GLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSA  439
            GL+DDQ TKLY+  DGRS+L PP+PPGYLGNV+F A   A S  LQSEP  ++ +RI+  
Sbjct  274  GLSDDQVTKLYIPIDGRSKLHPPIPPGYLGNVIFIAATTALSGVLQSEPFADTIQRINRT  333

Query  438  LSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHM  259
            + RMDD+Y+RSAL+++E  PD+  L+RG++ F SPNLNIN W RLPV+ +DFGWGRP+H+
Sbjct  334  VKRMDDKYMRSALEYIESVPDMETLVRGAHTFQSPNLNINGWMRLPVYAADFGWGRPMHV  393

Query  258  GPACILYEGTVYILPSPNKDRTLSLA  181
            G A ++ EG +YI+PSP  D +LSL 
Sbjct  394  GLANVIDEGQIYIIPSPVDDGSLSLV  419



>gb|KJB71577.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
 gb|KJB71579.1| hypothetical protein B456_011G130700 [Gossypium raimondii]
Length=436

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 153/225 (68%), Gaps = 9/225 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSASTAMLKITPEQLGVLKTKSKHEG-------STYEILAAHIWRCACKA  622
            LKS  +  + S  ST   K+T +QL  LK K+           S++ ILAAHIWRC  KA
Sbjct  214  LKSQSDDHKPSIVST--FKLTADQLNTLKAKANVANANGGIKYSSFNILAAHIWRCVSKA  271

Query  621  RGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHS  442
            RGL  DQ TKLY   DGR RL PPLPPGY GNV+FT   +A++  L++E  T++ KRIH 
Sbjct  272  RGLPADQDTKLYFPVDGRYRLDPPLPPGYFGNVIFTTALIAQAGNLETESFTDTIKRIHE  331

Query  441  ALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIH  262
             L++++DEYLRSA+D++E  PDL+ L+RG + F  PNL +  W  LP++E+DFGWGRPI+
Sbjct  332  RLNQINDEYLRSAIDYIEKVPDLNTLVRGPHTFRCPNLVVVPWNWLPIYEADFGWGRPIY  391

Query  261  MGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            MGP  ++ EG +Y+LPSP  D +L+LA  L+  HM +F++ +Y+F
Sbjct  392  MGPGNVVQEGKIYVLPSPTNDGSLTLAARLEIPHMKVFEKLIYEF  436



>ref|XP_009394928.1| PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=441

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 149/211 (71%), Gaps = 4/211 (2%)
 Frame = -3

Query  750  SSASTAMLKITPEQLGVLKTKSKHEG--STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
             S + ++ K+T  QL +LK K+   G  STY +LAAH+WRCAC AR L  DQ TK+Y+AT
Sbjct  230  GSVAVSIFKLTRAQLNLLKAKAPPGGTYSTYALLAAHVWRCACVARDLPPDQPTKMYIAT  289

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKR--IHSALSRMDDEYLRSA  403
            DGR RL PP P GY GNV+FTATPMAE+ E+ +     +     I  +L+RMDD Y+RSA
Sbjct  290  DGRQRLVPPPPEGYFGNVIFTATPMAEAGEVAAAGGGPAPTAGTIQESLTRMDDAYVRSA  349

Query  402  LDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVY  223
            LD+LE QPDL+ L+RG++ F  PN+ + SW RLP+H++DFGWGRP+ MGP  I YEG  +
Sbjct  350  LDYLEMQPDLAALVRGAHTFRCPNIGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAF  409

Query  222  ILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            +LPSP  D +LS+A+ L  +HM  F++ +YD
Sbjct  410  VLPSPTADGSLSVAISLQPDHMLEFRKLIYD  440



>ref|NP_001047408.1| Os02g0611800 [Oryza sativa Japonica Group]
 dbj|BAD19683.1| putative hydroxyanthranilate hydroxycinnamoyltransferase 3 [Oryza 
sativa Japonica Group]
 dbj|BAF09322.1| Os02g0611800 [Oryza sativa Japonica Group]
 gb|EAY86657.1| hypothetical protein OsI_08038 [Oryza sativa Indica Group]
 dbj|BAG96596.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + K++   LG L+++  + EG    STY +LAAH+WRCA  ARGL  +Q TKLY ATDGR
Sbjct  237  IFKLSRSDLGRLRSQLPRGEGAPRYSTYAVLAAHVWRCASLARGLPAEQPTKLYCATDGR  296

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
             RL P LP GY GNV+FTATP+AE+  +    L + A  I SAL RMD  Y RSALD+LE
Sbjct  297  QRLQPSLPDGYFGNVIFTATPLAEAGRVTGS-LADGAATIQSALDRMDSGYCRSALDYLE  355

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPS 
Sbjct  356  LQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSA  415

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + D +LS+A+ L AEHM  F++ ++DF
Sbjct  416  SGDGSLSVAISLQAEHMEKFRKMIFDF  442



>dbj|BAJ95750.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=438

 Score =   233 bits (594),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/226 (51%), Positives = 153/226 (68%), Gaps = 10/226 (4%)
 Frame = -3

Query  780  LKSVPESKRGSSA----STAMLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCAC  628
            L SVP++  G  A    +  + K+T  +LG L+++    EG    STY +LAAH+WRC  
Sbjct  213  LSSVPQALGGKPAPPPTAVGIFKLTRSELGRLRSQLPTGEGAPRFSTYAVLAAHVWRCVS  272

Query  627  KARGLTDDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRI  448
             AR L  +Q TKLY ATDGR RL PPLP GY GNV+FTATP+AE+ ++ S  L   A  I
Sbjct  273  LARNLAPEQPTKLYCATDGRQRLQPPLPEGYFGNVIFTATPLAEAGKVTSG-LAEGAAVI  331

Query  447  HSALSRMDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRP  268
              AL RM  +Y +SALD+LE QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP
Sbjct  332  QGALDRMTSDYCQSALDYLEMQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRP  391

Query  267  IHMGPACILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
            + MGP  I YEG  ++LPS +KD +LS+A+ L AEHM  F++ + D
Sbjct  392  VFMGPGGIAYEGLAFVLPSASKDGSLSIAISLQAEHMEKFRKLILD  437



>gb|EAZ23787.1| hypothetical protein OsJ_07497 [Oryza sativa Japonica Group]
Length=463

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 146/207 (71%), Gaps = 6/207 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + K++   LG L+++  + EG    STY +LAAH+WRCA  ARGL  +Q TKLY ATDGR
Sbjct  258  IFKLSRSDLGRLRSQLPRGEGAPRYSTYAVLAAHVWRCASLARGLPAEQPTKLYCATDGR  317

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
             RL P LP GY GNV+FTATP+AE+  +    L + A  I SAL RMD  Y RSALD+LE
Sbjct  318  QRLQPSLPDGYFGNVIFTATPLAEAGRVTGS-LADGAATIQSALDRMDSGYCRSALDYLE  376

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPS 
Sbjct  377  LQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSA  436

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            + D +LS+A+ L AEHM  F++ ++DF
Sbjct  437  SGDGSLSVAISLQAEHMEKFRKMIFDF  463



>ref|XP_007216058.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
 gb|EMJ17257.1| hypothetical protein PRUPE_ppa017691mg [Prunus persica]
Length=443

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 147/220 (67%), Gaps = 10/220 (5%)
 Frame = -3

Query  759  KRGSSASTAMLKITPEQLGVLKTKSKHEG---------STYEILAAHIWRCACKARGLTD  607
            K  S+ +T++ K+T +QL +LK KSK +G         S++E+LA HIWRCACKAR L D
Sbjct  223  KSTSNITTSIFKLTRKQLNILKDKSKKDGGNNINTINYSSFEMLAGHIWRCACKARKLPD  282

Query  606  DQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRM  427
            DQ TKL +ATD RSRL PPLPP + GN VF  TP+A + +LQS+P   +   +H AL RM
Sbjct  283  DQDTKLLIATDARSRLQPPLPPYFFGNAVFRTTPIAVAGDLQSKPTWYATSFVHDALVRM  342

Query  426  DDEYLRSALDFLEC-QPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            DD+Y RS LD+LE   P LS+LI G      PNL INSW R+P+H++DFGWGRPI MGP 
Sbjct  343  DDDYFRSVLDYLELHHPCLSELITGPPSICCPNLRINSWARMPIHDADFGWGRPIFMGPG  402

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYD  130
             I ++G  ++LPS   D +LSL + L +E M  F   LYD
Sbjct  403  AIPFDGMSFLLPSATNDGSLSLVISLKSEDMKSFSTLLYD  442



>gb|KJB54981.1| hypothetical protein B456_009G057200 [Gossypium raimondii]
Length=436

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = -3

Query  741  STAMLKITPEQLGVLKTKSKHEG-----STYEILAAHIWRCACKARGLTDDQSTKLYVAT  577
            + ++ K+T +QL  LK K+         STY  LAAHIWRC  KAR L DDQ+TKLY+  
Sbjct  227  TVSVFKLTRDQLNTLKAKANKNSDGGVYSTYNSLAAHIWRCVNKARCLLDDQATKLYIPI  286

Query  576  DGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALD  397
            DGRSRL PPLPPGYLGNV+F +  +A   ++Q E  +++AKRI + L R DDEYL+SA+D
Sbjct  287  DGRSRLRPPLPPGYLGNVIFMSATIASHGDIQCESFSDTAKRIQNILRRTDDEYLKSAID  346

Query  396  FLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYIL  217
            ++E +P++   +RG+  F  PNL+INSW  LP++++DFGWGRPI +GPA +  +G  YIL
Sbjct  347  YMEKEPNIKAPVRGARGFQCPNLSINSWMWLPLYDADFGWGRPIWLGPAKVSQDGKTYIL  406

Query  216  PSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            PSP  D +LS+  CLD  HM +F +  Y+F
Sbjct  407  PSPANDGSLSVMSCLDTSHMKIFGQLFYEF  436



>dbj|BAC78633.1| hydroxyanthranilate hydroxycinnamoyltransferase 1 [Avena sativa]
Length=441

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 144/207 (70%), Gaps = 6/207 (3%)
 Frame = -3

Query  732  MLKITPEQLGVLKTK-SKHEG----STYEILAAHIWRCACKARGLTDDQSTKLYVATDGR  568
            + K++   LG L+ +    EG    STY +L AH+WRCA  ARGL  +Q TKLY ATDGR
Sbjct  236  IFKLSRSDLGRLRAQLPTGEGAPRFSTYAVLGAHVWRCASLARGLAPEQPTKLYCATDGR  295

Query  567  SRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSRMDDEYLRSALDFLE  388
             RL P  P GY GNV+FTATP+AE+ ++    L + A  I  AL +MDDEY  SALD+LE
Sbjct  296  QRLTPTHPDGYFGNVIFTATPLAEAGKVTGS-LADGATTIQDALEKMDDEYCHSALDYLE  354

Query  387  CQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPACILYEGTVYILPSP  208
             QPDLS L+RG++ F  PNL + SW RLP+H++DFGWGRP+ MGP  I YEG  ++LPS 
Sbjct  355  LQPDLSALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSA  414

Query  207  NKDRTLSLAVCLDAEHMPLFKEFLYDF  127
            N+D +LS+A+ L AEHM  F++ ++DF
Sbjct  415  NRDGSLSVAISLQAEHMEKFRKMIFDF  441



>ref|XP_002324532.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
 gb|EEF03097.1| hypothetical protein POPTR_0018s11380g [Populus trichocarpa]
Length=440

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 152/221 (69%), Gaps = 8/221 (4%)
 Frame = -3

Query  771  VPESKRGSSASTAMLKITPEQLGVLKT------KSKHEGSTYEILAAHIWRCACKARGLT  610
            +PES      S A LKIT + L  LK        SK E STY IL AHIWRCACKARGL+
Sbjct  216  IPESG-SKDISVANLKITSDLLNTLKAMAKNDIASKTEYSTYVILTAHIWRCACKARGLS  274

Query  609  DDQSTKLYVATDGRSRLCPPLPPGYLGNVVFTATPMAESRELQSEPLTNSAKRIHSALSR  430
            +DQ+TKL + T+GR R  PPL PGY GNV F ATP+A S  L SEPL ++A+RIH A+ R
Sbjct  275  NDQATKLSIPTNGRDRFRPPLQPGYFGNVTFLATPIALSGALLSEPLAHTAERIHKAIKR  334

Query  429  MDDEYLRSALDFLECQPDLSKLIRGSNYFASPNLNINSWTRLPVHESDFGWGRPIHMGPA  250
            MDDEYLRSA+D+LE   DL+ ++R S  + SPNL+I +W RLP +++DFGWG+P++M PA
Sbjct  335  MDDEYLRSAVDYLEKVDDLTTVMRSSETYRSPNLHIVNWVRLPFYDADFGWGKPVYMRPA  394

Query  249  CILYEGTVYILPSPNKDRTLSLAVCLDAEHMPLFKEFLYDF  127
               + G  YI PSP  D TLSL + L+ +H+  F++  Y++
Sbjct  395  SA-FVGKGYIQPSPTNDGTLSLTIFLETDHLQSFQKLFYEY  434



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940