BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013B20

Length=792
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004236119.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   2e-112   
ref|XP_006345041.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    346   2e-112   Solanum tuberosum [potatoes]
ref|XP_009617290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    344   8e-112   Nicotiana tomentosiformis
ref|XP_009617291.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    344   9e-112   Nicotiana tomentosiformis
gb|KJB53134.1|  hypothetical protein B456_008G294300                    330   9e-109   Gossypium raimondii
ref|XP_011044321.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    333   2e-107   Populus euphratica
ref|XP_002511424.1|  aldehyde dehydrogenase, putative                   333   2e-107   
ref|XP_002318034.1|  aldehyde dehydrogenase 1 precursor family pr...    330   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_008360830.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   4e-106   
gb|KJB53133.1|  hypothetical protein B456_008G294300                    329   5e-106   Gossypium raimondii
ref|XP_011044320.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    329   5e-106   Populus euphratica
gb|KJB53131.1|  hypothetical protein B456_008G294300                    329   7e-106   Gossypium raimondii
gb|KHG08400.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    328   2e-105   Gossypium arboreum [tree cotton]
ref|XP_002321583.2|  aldehyde dehydrogenase 1 precursor family pr...    327   2e-105   
gb|KCW83435.1|  hypothetical protein EUGRSUZ_B00357                     323   2e-105   Eucalyptus grandis [rose gum]
ref|XP_004138115.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    327   4e-105   Cucumis sativus [cucumbers]
ref|XP_004155012.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    327   5e-105   
ref|XP_008453101.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    327   5e-105   Cucumis melo [Oriental melon]
ref|XP_007155411.1|  hypothetical protein PHAVU_003G199100g             326   9e-105   Phaseolus vulgaris [French bean]
ref|XP_007155410.1|  hypothetical protein PHAVU_003G199100g             326   1e-104   Phaseolus vulgaris [French bean]
emb|CDP18933.1|  unnamed protein product                                326   1e-104   Coffea canephora [robusta coffee]
gb|KDP31120.1|  hypothetical protein JCGZ_11496                         326   2e-104   Jatropha curcas
gb|EPS72259.1|  hypothetical protein M569_02499                         317   2e-104   Genlisea aurea
ref|XP_010037573.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    325   2e-104   Eucalyptus grandis [rose gum]
ref|XP_010546022.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    325   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_004298932.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    325   2e-104   Fragaria vesca subsp. vesca
gb|KEH35050.1|  NAD-dependent aldehyde dehydrogenase family protein     325   3e-104   Medicago truncatula
gb|EYU42550.1|  hypothetical protein MIMGU_mgv1a004919mg                323   4e-104   Erythranthe guttata [common monkey flower]
ref|XP_010101190.1|  Aldehyde dehydrogenase family 2 member             325   5e-104   Morus notabilis
ref|XP_004508854.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   6e-104   Cicer arietinum [garbanzo]
gb|KHN18468.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    324   7e-104   Glycine soja [wild soybean]
ref|XP_010028184.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    323   9e-104   Eucalyptus grandis [rose gum]
ref|XP_008374451.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    323   1e-103   Malus domestica [apple tree]
ref|XP_006439785.1|  hypothetical protein CICLE_v10019638mg             320   3e-103   
gb|AEV54528.1|  aldehyde dehydrogenase ALDH2B4_V3                       322   5e-103   Vitis vinifera
ref|XP_008239742.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   5e-103   Prunus mume [ume]
ref|XP_008367527.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    322   5e-103   
ref|XP_006439784.1|  hypothetical protein CICLE_v10019638mg             322   6e-103   Citrus clementina [clementine]
ref|XP_007210569.1|  hypothetical protein PRUPE_ppa003869mg             322   6e-103   Prunus persica
ref|XP_007044551.1|  Aldehyde dehydrogenase 2B4                         322   6e-103   
gb|AEV54527.1|  aldehyde dehydrogenase ALDH2B4_V2                       320   7e-103   Vitis vinifera
gb|AAO72532.1|  aldehyde dehydrogenase 1 precursor                      322   7e-103   Lotus corniculatus
ref|XP_004508853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    321   7e-103   Cicer arietinum [garbanzo]
ref|XP_002283132.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    321   1e-102   Vitis vinifera
emb|CAN63005.1|  hypothetical protein VITISV_013710                     321   1e-102   Vitis vinifera
ref|XP_009150211.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   2e-102   Brassica rapa
gb|AFK44278.1|  unknown                                                 315   2e-102   Medicago truncatula
ref|XP_011028588.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   3e-102   Populus euphratica
ref|XP_003527026.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    320   3e-102   
emb|CDY36910.1|  BnaA06g16950D                                          319   5e-102   Brassica napus [oilseed rape]
ref|XP_006476755.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   1e-101   Citrus sinensis [apfelsine]
gb|AAZ79358.1|  aldehyde dehydrogenase                                  318   1e-101   Vitis pseudoreticulata
ref|XP_009149853.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    318   2e-101   Brassica rapa
gb|AAZ79356.1|  aldehyde dehydrogenase                                  316   2e-101   Vitis pseudoreticulata
ref|XP_006404308.1|  hypothetical protein EUTSA_v10010271mg             318   2e-101   Eutrema salsugineum [saltwater cress]
emb|CDY44985.1|  BnaCnng12150D                                          317   2e-101   Brassica napus [oilseed rape]
gb|EYU31278.1|  hypothetical protein MIMGU_mgv1a004311mg                317   3e-101   Erythranthe guttata [common monkey flower]
gb|AAZ79355.1|  aldehyde dehydrogenase                                  317   3e-101   Vitis pseudoreticulata
ref|XP_010682578.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   4e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009761724.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    317   5e-101   Nicotiana sylvestris
gb|KDP26565.1|  hypothetical protein JCGZ_17723                         317   5e-101   Jatropha curcas
ref|XP_011086550.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   6e-101   Sesamum indicum [beniseed]
gb|AFK41217.1|  unknown                                                 316   8e-101   Lotus japonicus
gb|AES91175.2|  NAD-dependent aldehyde dehydrogenase family protein     316   9e-101   Medicago truncatula
ref|XP_003608978.1|  Mitochondrial aldehyde dehydrogenase               316   1e-100   
ref|XP_011071828.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    316   1e-100   Sesamum indicum [beniseed]
emb|CDY21806.1|  BnaA06g20750D                                          314   2e-100   Brassica napus [oilseed rape]
gb|ACM89738.1|  mitochondrial benzaldehyde dehydrogenase                315   2e-100   Antirrhinum majus [garden snapdragon]
ref|XP_010316283.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   3e-100   Solanum lycopersicum
ref|XP_010503421.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010682575.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   4e-100   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682577.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   4e-100   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL77005.1|  aldehyde dehydrogenase                                  303   5e-100   Allium cepa
gb|KJB50198.1|  hypothetical protein B456_008G158500                    312   7e-100   Gossypium raimondii
gb|KFK44454.1|  hypothetical protein AALP_AA1G258900                    313   8e-100   Arabis alpina [alpine rockcress]
ref|XP_010914166.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    314   9e-100   Elaeis guineensis
gb|KHG27537.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    313   1e-99    Gossypium arboreum [tree cotton]
ref|XP_010678738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   1e-99    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY47634.1|  BnaC05g18900D                                          313   1e-99    Brassica napus [oilseed rape]
emb|CDX91724.1|  BnaC08g06430D                                          313   1e-99    
emb|CDY57318.1|  BnaA08g20300D                                          313   2e-99    Brassica napus [oilseed rape]
ref|XP_009110081.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   2e-99    Brassica rapa
gb|KFK34098.1|  hypothetical protein AALP_AA5G101700                    313   2e-99    Arabis alpina [alpine rockcress]
ref|XP_010515110.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    312   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009600000.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    313   2e-99    
gb|KJB50197.1|  hypothetical protein B456_008G158500                    312   2e-99    Gossypium raimondii
gb|EPS72983.1|  mitochondrial benzaldehyde dehydrogenase                311   2e-99    Genlisea aurea
gb|KCW56066.1|  hypothetical protein EUGRSUZ_I01821                     308   3e-99    Eucalyptus grandis [rose gum]
ref|XP_010913576.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    312   4e-99    Elaeis guineensis
ref|XP_006290873.1|  hypothetical protein CARUB_v10016983mg             311   4e-99    Capsella rubella
ref|XP_009115500.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   6e-99    Brassica rapa
ref|XP_002877590.1|  ALDH2B4                                            311   7e-99    
ref|XP_010426271.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010552639.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   7e-99    Tarenaya hassleriana [spider flower]
gb|AAL99612.1|AF348416_1  mitochondrial aldehyde dehydrogenase          311   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003519638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   8e-99    
ref|XP_008781996.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    311   8e-99    Phoenix dactylifera
gb|AEV40467.1|  mitochondrial aldehyde dehydrogenase                    299   9e-99    Miscanthus sinensis
gb|AAC98035.1|  Strong similarity to gb|Y09876 aldehyde dehydroge...    310   9e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564204.1|  aldehyde dehydrogenase 2B7                            310   1e-98    Arabidopsis thaliana [mouse-ear cress]
gb|KHN00347.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    311   1e-98    Glycine soja [wild soybean]
ref|XP_007031425.1|  Aldehyde dehydrogenase 2B7 isoform 3               306   2e-98    
gb|AFK40301.1|  unknown                                                 303   2e-98    Medicago truncatula
ref|NP_190383.1|  aldehyde dehydrogenase 2B4                            310   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517756.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    310   2e-98    
emb|CDY61548.1|  BnaA09g29890D                                          310   2e-98    Brassica napus [oilseed rape]
ref|XP_002893307.1|  hypothetical protein ARALYDRAFT_472641             309   3e-98    
ref|XP_003532011.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    309   4e-98    
ref|XP_010029206.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    309   4e-98    Eucalyptus grandis [rose gum]
ref|XP_006416054.1|  hypothetical protein EUTSA_v10007303mg             309   5e-98    Eutrema salsugineum [saltwater cress]
ref|XP_010551563.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   8e-98    Tarenaya hassleriana [spider flower]
ref|XP_009612265.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   1e-97    Nicotiana tomentosiformis
ref|XP_010100483.1|  Aldehyde dehydrogenase family 2 member             308   1e-97    Morus notabilis
ref|XP_009759823.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    308   1e-97    Nicotiana sylvestris
ref|XP_006307216.1|  hypothetical protein CARUB_v10008816mg             307   2e-97    Capsella rubella
ref|XP_010251301.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   2e-97    Nelumbo nucifera [Indian lotus]
emb|CAA71003.1|  aldehyde dehydrogenase (NAD+)                          308   2e-97    Nicotiana tabacum [American tobacco]
ref|XP_010653335.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   2e-97    Vitis vinifera
gb|KJB31274.1|  hypothetical protein B456_005G183300                    306   2e-97    Gossypium raimondii
ref|XP_007031423.1|  Aldehyde dehydrogenase 2B4 isoform 1               306   2e-97    
ref|XP_010044646.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    307   3e-97    Eucalyptus grandis [rose gum]
ref|XP_004238676.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   3e-97    
ref|XP_006355977.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   4e-97    Solanum tuberosum [potatoes]
ref|XP_003552014.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    306   5e-97    
gb|KJB11464.1|  hypothetical protein B456_001G261100                    302   6e-97    Gossypium raimondii
gb|KJB11463.1|  hypothetical protein B456_001G261100                    302   7e-97    Gossypium raimondii
ref|XP_007036177.1|  Aldehyde dehydrogenase family 2 member B4          306   2e-96    
ref|XP_007157468.1|  hypothetical protein PHAVU_002G072100g             305   2e-96    Phaseolus vulgaris [French bean]
ref|XP_002301540.1|  mitochondrial aldehyde dehydrogenase family ...    305   2e-96    Populus trichocarpa [western balsam poplar]
gb|KCW86739.1|  hypothetical protein EUGRSUZ_B03349                     305   2e-96    Eucalyptus grandis [rose gum]
ref|XP_010477684.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_009399660.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   4e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   4e-96    Fragaria vesca subsp. vesca
ref|XP_010265814.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   4e-96    Nelumbo nucifera [Indian lotus]
ref|XP_008221788.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    304   4e-96    Prunus mume [ume]
ref|XP_004297641.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   5e-96    Fragaria vesca subsp. vesca
ref|XP_010477682.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   5e-96    Camelina sativa [gold-of-pleasure]
gb|AGV54428.1|  mitochondrial aldehyde dehydrogenase                    303   5e-96    Phaseolus vulgaris [French bean]
gb|EYU22484.1|  hypothetical protein MIMGU_mgv1a004342mg                303   6e-96    Erythranthe guttata [common monkey flower]
emb|CDP00179.1|  unnamed protein product                                303   6e-96    Coffea canephora [robusta coffee]
ref|XP_007153639.1|  hypothetical protein PHAVU_003G052500g             303   7e-96    Phaseolus vulgaris [French bean]
ref|XP_006594290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   7e-96    Glycine max [soybeans]
dbj|BAB92019.1|  mitochondrial aldehyde dehydrogenase                   304   7e-96    Sorghum bicolor [broomcorn]
ref|XP_003542700.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   8e-96    
gb|KEH19981.1|  NAD-dependent aldehyde dehydrogenase family protein     302   8e-96    Medicago truncatula
ref|XP_010271955.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    303   1e-95    Nelumbo nucifera [Indian lotus]
gb|KJB11461.1|  hypothetical protein B456_001G261100                    302   1e-95    Gossypium raimondii
gb|KCW56067.1|  hypothetical protein EUGRSUZ_I01824                     302   1e-95    Eucalyptus grandis [rose gum]
gb|AFK40600.1|  unknown                                                 298   1e-95    Medicago truncatula
ref|XP_007221800.1|  hypothetical protein PRUPE_ppa004036mg             302   1e-95    Prunus persica
gb|KEH19980.1|  NAD-dependent aldehyde dehydrogenase family protein     303   2e-95    Medicago truncatula
gb|KHG06517.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    302   2e-95    Gossypium arboreum [tree cotton]
ref|XP_010029207.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    302   2e-95    Eucalyptus grandis [rose gum]
emb|CBI32134.3|  unnamed protein product                                303   2e-95    Vitis vinifera
dbj|BAB62757.1|  mitochondrial aldehyde dehydrogenase ALDH2             302   3e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB92018.1|  mitochondrial aldehyde dehydrogenase                   302   3e-95    Sorghum bicolor [broomcorn]
ref|XP_004297642.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   4e-95    Fragaria vesca subsp. vesca
gb|ABK24267.1|  unknown                                                 301   5e-95    Picea sitchensis
gb|KDO82491.1|  hypothetical protein CISIN_1g009035mg                   294   6e-95    Citrus sinensis [apfelsine]
ref|XP_011003158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    301   7e-95    Populus euphratica
ref|NP_001105891.1|  mitochondrial aldehyde dehydrogenase 2             301   8e-95    Zea mays [maize]
ref|XP_002274863.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   1e-94    Vitis vinifera
ref|XP_011071082.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   1e-94    
ref|XP_006356663.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    300   1e-94    Solanum tuberosum [potatoes]
gb|AAK58370.1|AF269064_1  T-cytoplasm male sterility restorer fac...    300   1e-94    Zea mays [maize]
gb|EMS51754.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    300   2e-94    Triticum urartu
gb|AHM26656.1|  aldehyde dehydrogenase 2-1                              300   2e-94    Zea mays subsp. mays [corn]
gb|EMT04899.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    300   2e-94    
dbj|BAB92017.1|  mitochondrial aldehyde dehydrogenase                   299   4e-94    Secale cereale
ref|XP_006844236.1|  hypothetical protein AMTR_s00006p00268060          297   5e-94    
gb|KDO82489.1|  hypothetical protein CISIN_1g009035mg                   293   6e-94    Citrus sinensis [apfelsine]
ref|NP_001105576.1|  aldehyde dehydrogenase2                            299   6e-94    Zea mays [maize]
ref|XP_004509835.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   6e-94    
ref|XP_004509834.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   6e-94    Cicer arietinum [garbanzo]
gb|ACG32898.1|  aldehyde dehydrogenase                                  299   6e-94    Zea mays [maize]
emb|CBI16844.3|  unnamed protein product                                293   6e-94    Vitis vinifera
ref|XP_006647839.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   1e-93    
gb|AAL99614.2|AF348418_1  mitochondrial aldehyde dehydrogenase RF2B     298   1e-93    Zea mays [maize]
ref|XP_004245256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    298   1e-93    Solanum lycopersicum
gb|KDO82486.1|  hypothetical protein CISIN_1g009035mg                   293   2e-93    Citrus sinensis [apfelsine]
ref|XP_006656871.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    297   2e-93    Oryza brachyantha
ref|XP_004965205.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    297   3e-93    Setaria italica
gb|KHN47185.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    296   3e-93    Glycine soja [wild soybean]
gb|AHM26657.1|  aldehyde dehydrogenase 2-2                              296   5e-93    Zea mays subsp. mays [corn]
ref|XP_008389628.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   7e-93    
gb|KDO82484.1|  hypothetical protein CISIN_1g009035mg                   293   1e-92    Citrus sinensis [apfelsine]
ref|XP_004139235.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   2e-92    
gb|KHN23562.1|  Aldehyde dehydrogenase family 2 member B7, mitoch...    293   2e-92    Glycine soja [wild soybean]
ref|XP_004156463.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    295   2e-92    
ref|XP_010498885.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    294   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_003563967.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    294   4e-92    Brachypodium distachyon [annual false brome]
ref|XP_009363532.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   5e-92    Pyrus x bretschneideri [bai li]
gb|AAF73828.1|AF162665_1  aldehyde dehydrogenase                        293   7e-92    Oryza sativa [red rice]
ref|NP_001057358.1|  Os06g0270900                                       293   7e-92    
gb|EAZ00462.1|  hypothetical protein OsI_22484                          293   7e-92    Oryza sativa Indica Group [Indian rice]
gb|KGN60807.1|  hypothetical protein Csa_2G010420                       295   8e-92    Cucumis sativus [cucumbers]
ref|XP_006438422.1|  hypothetical protein CICLE_v10031155mg             293   9e-92    Citrus clementina [clementine]
gb|KDO82485.1|  hypothetical protein CISIN_1g009035mg                   293   9e-92    Citrus sinensis [apfelsine]
ref|XP_004953799.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    293   1e-91    Setaria italica
dbj|BAJ85552.1|  predicted protein                                      289   1e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002970420.1|  hypothetical protein SELMODRAFT_231526             290   2e-91    
ref|XP_010460154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   3e-91    Camelina sativa [gold-of-pleasure]
ref|XP_002978501.1|  hypothetical protein SELMODRAFT_233128             290   3e-91    
ref|XP_008793866.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   3e-91    Phoenix dactylifera
ref|XP_004953798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    291   4e-91    
dbj|BAD15920.1|  putative mitochondrial aldehyde dehydrogenase AL...    288   4e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009391259.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    290   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391258.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    290   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391257.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    289   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391256.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    289   2e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456004.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    289   3e-90    Cucumis melo [Oriental melon]
gb|EEC73936.1|  hypothetical protein OsI_08800                          288   7e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001048010.1|  Os02g0730000                                       288   7e-90    
ref|XP_010928601.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    287   2e-89    Elaeis guineensis
ref|XP_010928603.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    285   1e-88    Elaeis guineensis
ref|XP_008793883.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    283   6e-88    
ref|XP_009363534.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    282   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_001785650.1|  predicted protein                                  281   2e-87    
gb|ABU96176.1|  aldehyde dehydrogenase                                  272   5e-86    Populus tremula x Populus alba [gray poplar]
gb|ADK98279.1|  aldehyde dehydrogenase                                  261   3e-84    Schiedea globosa
gb|ADW10252.1|  putative aldehyde dehydrogenase                         260   6e-84    Schiedea globosa
gb|ADK98278.1|  aldehyde dehydrogenase                                  259   1e-83    Schiedea globosa
gb|ADK98289.1|  aldehyde dehydrogenase                                  258   3e-83    Schiedea globosa
gb|ADW10232.1|  putative aldehyde dehydrogenase                         258   3e-83    Schiedea globosa
gb|ADK98288.1|  aldehyde dehydrogenase                                  258   4e-83    Schiedea globosa
ref|XP_002961352.1|  hypothetical protein SELMODRAFT_266598             269   5e-83    
gb|ADK98275.1|  aldehyde dehydrogenase                                  258   5e-83    Schiedea globosa
gb|EMT22926.1|  Aldehyde dehydrogenase family 2 member B4, mitoch...    273   6e-83    
gb|ADK98272.1|  aldehyde dehydrogenase                                  257   9e-83    Schiedea globosa
gb|ADW10240.1|  putative aldehyde dehydrogenase                         256   1e-82    Schiedea globosa
gb|ADK98280.1|  aldehyde dehydrogenase                                  256   1e-82    Schiedea globosa
gb|ADK98270.1|  aldehyde dehydrogenase                                  256   2e-82    Schiedea globosa
gb|ADK98276.1|  aldehyde dehydrogenase                                  256   2e-82    Schiedea globosa
ref|XP_002983210.1|  hypothetical protein SELMODRAFT_234195             267   2e-82    
gb|ADK98284.1|  aldehyde dehydrogenase                                  256   2e-82    Schiedea globosa
gb|ADW10223.1|  putative aldehyde dehydrogenase                         256   2e-82    Schiedea globosa
gb|ADK98269.1|  aldehyde dehydrogenase                                  256   3e-82    Schiedea globosa
gb|ADW10209.1|  putative aldehyde dehydrogenase                         256   3e-82    Schiedea membranacea
gb|ADK98271.1|  aldehyde dehydrogenase                                  256   3e-82    Schiedea globosa
gb|ADW10226.1|  putative aldehyde dehydrogenase                         255   4e-82    Schiedea globosa
gb|ADW10224.1|  putative aldehyde dehydrogenase                         255   5e-82    Schiedea globosa
gb|ADK98277.1|  aldehyde dehydrogenase                                  253   2e-81    Schiedea globosa
emb|CAN80790.1|  hypothetical protein VITISV_020547                     264   3e-81    Vitis vinifera
gb|ADW10222.1|  putative aldehyde dehydrogenase                         253   5e-81    Schiedea globosa
gb|ADK98274.1|  aldehyde dehydrogenase                                  252   9e-81    Schiedea globosa
ref|XP_007151102.1|  hypothetical protein PHAVU_004G018000g             258   2e-78    Phaseolus vulgaris [French bean]
gb|ADW10246.1|  putative aldehyde dehydrogenase                         246   2e-78    Schiedea globosa
ref|XP_007160345.1|  hypothetical protein PHAVU_002G314000g             254   2e-77    Phaseolus vulgaris [French bean]
ref|XP_003525266.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    249   2e-75    
gb|ABR16485.1|  unknown                                                 248   9e-75    Picea sitchensis
ref|XP_003530494.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    247   2e-74    
gb|KEH21358.1|  NAD-dependent aldehyde dehydrogenase family protein     243   2e-74    Medicago truncatula
emb|CDP18934.1|  unnamed protein product                                239   2e-74    Coffea canephora [robusta coffee]
gb|KDP45377.1|  hypothetical protein JCGZ_09626                         242   2e-74    Jatropha curcas
gb|ACN27968.1|  unknown                                                 242   2e-74    Zea mays [maize]
gb|ABK24518.1|  unknown                                                 237   1e-73    Picea sitchensis
ref|XP_001690955.1|  aldehyde dehydrogenase                             245   2e-73    Chlamydomonas reinhardtii
gb|AET04123.2|  NAD-dependent aldehyde dehydrogenase family protein     243   3e-73    Medicago truncatula
ref|XP_002948098.1|  hypothetical protein VOLCADRAFT_73567              244   3e-73    Volvox carteri f. nagariensis
ref|XP_003620519.1|  Aldehyde dehydrogenase                             244   3e-73    
ref|XP_003629647.1|  Aldehyde dehydrogenase                             243   4e-73    
gb|ADW10245.1|  putative aldehyde dehydrogenase                         232   6e-73    Schiedea globosa
gb|KJB06930.1|  hypothetical protein B456_001G004300                    243   7e-73    Gossypium raimondii
gb|AHM26658.1|  aldehyde dehydrogenase 2-3                              243   8e-73    Zea mays subsp. mays [corn]
ref|WP_011612157.1|  betaine-aldehyde dehydrogenase                     242   9e-73    Trichodesmium erythraeum
gb|KHG07688.1|  Aldehyde dehydrogenase family 2 member C4               242   1e-72    Gossypium arboreum [tree cotton]
gb|KDO54179.1|  hypothetical protein CISIN_1g0107352mg                  240   1e-72    Citrus sinensis [apfelsine]
gb|AAL99608.1|AF348412_1  cytosolic aldehyde dehydrogenase RF2C         242   1e-72    Zea mays [maize]
gb|ABR25844.1|  retinal dehydrogenase 1, putative expressed             233   1e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_006587515.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    242   1e-72    Glycine max [soybeans]
ref|XP_006583373.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    240   1e-72    Glycine max [soybeans]
ref|XP_003534190.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    242   1e-72    
gb|KHN45659.1|  Aldehyde dehydrogenase family 2 member C4               241   2e-72    Glycine soja [wild soybean]
ref|XP_009347162.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    242   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_003534191.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    241   2e-72    
gb|KDO54178.1|  hypothetical protein CISIN_1g0107352mg                  240   2e-72    Citrus sinensis [apfelsine]
gb|KJB06941.1|  hypothetical protein B456_001G004400                    241   5e-72    Gossypium raimondii
ref|XP_010155846.1|  PREDICTED: retinal dehydrogenase 1                 233   5e-72    Eurypyga helias
emb|CAD10505.1|  aldehyde dehydrogenase                                 241   5e-72    Polytomella sp. Pringsheim 198.80
gb|KFV95675.1|  Retinal dehydrogenase 1                                 233   5e-72    
gb|KDO54177.1|  hypothetical protein CISIN_1g0107352mg                  239   6e-72    
ref|XP_010926277.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    240   7e-72    
ref|XP_007013215.1|  Aldehyde dehydrogenase 2C4                         240   8e-72    
ref|XP_003528912.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    240   8e-72    
gb|KHN20692.1|  Aldehyde dehydrogenase family 2 member C4               239   9e-72    
gb|KJB54168.1|  hypothetical protein B456_009G024000                    239   1e-71    
ref|XP_006451114.1|  hypothetical protein CICLE_v10010514mg             239   1e-71    
gb|KJB54167.1|  hypothetical protein B456_009G024000                    239   1e-71    
ref|XP_010724044.1|  PREDICTED: retinal dehydrogenase 1                 233   1e-71    
ref|XP_006475705.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    239   1e-71    
ref|XP_003629648.1|  Aldehyde dehydrogenase                             239   3e-71    
ref|XP_010926163.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    238   3e-71    
gb|KJB64880.1|  hypothetical protein B456_010G069600                    238   4e-71    
gb|KJB64879.1|  hypothetical protein B456_010G069600                    238   4e-71    
ref|NP_001105046.1|  cytosolic aldehyde dehydrogenase RF2C              238   4e-71    
ref|XP_004571367.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    239   6e-71    
ref|WP_008181335.1|  betaine-aldehyde dehydrogenase                     237   8e-71    
ref|XP_008632791.1|  PREDICTED: retinal dehydrogenase 1 isoform X3      232   9e-71    
ref|XP_009392919.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    237   9e-71    
ref|XP_005472420.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    236   9e-71    
ref|XP_009336918.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    237   9e-71    
ref|XP_011483309.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    235   1e-70    
gb|AFK35637.1|  unknown                                                 237   1e-70    
ref|XP_008361254.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    237   1e-70    
ref|XP_003979770.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   1e-70    
gb|EAW97976.1|  aldehyde dehydrogenase 2 family (mitochondrial), ...    228   1e-70    
ref|XP_010688155.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    236   1e-70    
ref|WP_016874813.1|  betaine-aldehyde dehydrogenase                     236   2e-70    
ref|WP_041229752.1|  betaine-aldehyde dehydrogenase                     234   2e-70    
ref|XP_003446212.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    237   2e-70    
ref|XP_010783440.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   2e-70    
ref|XP_008337462.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    236   2e-70    
gb|KDP33653.1|  hypothetical protein JCGZ_07224                         236   2e-70    
gb|ACK65581.1|  transposase, IS605 OrfB family                          234   2e-70    
ref|XP_008463376.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    236   3e-70    
ref|XP_008343979.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   3e-70    
gb|KCW82471.1|  hypothetical protein EUGRSUZ_C03860                     233   3e-70    
ref|XP_005752934.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    236   3e-70    
ref|WP_009547631.1|  MULTISPECIES: betaine-aldehyde dehydrogenase       236   3e-70    
ref|XP_007152817.1|  hypothetical protein PHAVU_004G162200g             236   3e-70    
ref|XP_005530420.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      235   4e-70    
ref|XP_003977205.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   4e-70    
ref|XP_002514327.1|  aldehyde dehydrogenase, putative                   236   4e-70    
ref|XP_005489689.1|  PREDICTED: retinal dehydrogenase 1 isoform X3      234   4e-70    
ref|XP_007160347.1|  hypothetical protein PHAVU_002G3141000g            234   4e-70    
ref|XP_009296559.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   5e-70    
gb|KIZ05750.1|  aldehyde dehydrogenase (NAD+)                           236   5e-70    
ref|XP_002961274.1|  hypothetical protein SELMODRAFT_164447             235   5e-70    
ref|XP_004969047.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    235   6e-70    
ref|XP_004969048.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    235   7e-70    
ref|XP_004571368.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    236   7e-70    
ref|XP_009336920.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    235   7e-70    
ref|XP_010925091.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    235   7e-70    
ref|WP_015783713.1|  betaine-aldehyde dehydrogenase                     234   8e-70    
ref|XP_003965899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    235   8e-70    
ref|XP_005061253.1|  PREDICTED: retinal dehydrogenase 1 isoform X4      234   9e-70    
ref|XP_005530419.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      235   9e-70    
ref|XP_002983288.1|  hypothetical protein SELMODRAFT_180171             234   1e-69    
ref|XP_007170973.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   1e-69    
ref|XP_008556898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    234   1e-69    
ref|XP_007079670.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   1e-69    
ref|XP_005489688.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      234   1e-69    
ref|XP_005489687.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      234   1e-69    
ref|XP_004635979.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   1e-69    
ref|XP_008687110.1|  PREDICTED: LOW QUALITY PROTEIN: aldehyde deh...    232   1e-69    
gb|KIE10085.1|  betaine-aldehyde dehydrogenase                          234   1e-69    
dbj|BAD93825.1|  aldehyde dehydrogenase                                 224   1e-69    
ref|XP_006579386.1|  PREDICTED: uncharacterized protein LOC100527...    235   2e-69    
ref|XP_005423478.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      233   2e-69    
ref|NP_001043453.1|  Os01g0591000                                       234   2e-69    
ref|XP_007528806.1|  PREDICTED: aldehyde dehydrogenase, cytosolic...    231   2e-69    
ref|XP_005061250.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      234   2e-69    
ref|NP_989908.1|  retinal dehydrogenase 1                               234   2e-69    
ref|XP_003620522.1|  Cytosolic aldehyde dehydrogenase                   234   2e-69    
ref|XP_001767457.1|  predicted protein                                  234   2e-69    
ref|XP_005423479.1|  PREDICTED: retinal dehydrogenase 1 isoform X3      233   2e-69    
ref|XP_003433425.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    233   2e-69    
ref|XP_005612652.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   2e-69    
ref|XP_006178148.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   2e-69    
ref|XP_008386638.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   2e-69    
gb|EKU99215.1|  NAD-dependent aldehyde dehydrogenase                    233   2e-69    
ref|XP_004753301.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    233   2e-69    
ref|WP_036019563.1|  betaine-aldehyde dehydrogenase                     233   3e-69    
ref|WP_008272605.1|  betaine-aldehyde dehydrogenase                     233   3e-69    
ref|XP_007058380.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-69    
gb|AAX27256.2|  SJCHGC03496 protein                                     225   3e-69    
ref|XP_004169738.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   3e-69    
ref|XP_008343978.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   3e-69    
emb|CCQ69085.1|  Aldehyde dehydrogenase                                 233   3e-69    
ref|XP_004595352.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-69    
ref|WP_017746980.1|  betaine-aldehyde dehydrogenase                     233   3e-69    
ref|XP_006204899.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-69    
ref|XP_005080706.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-69    
gb|KDP33652.1|  hypothetical protein JCGZ_07223                         233   3e-69    
ref|WP_026736388.1|  betaine-aldehyde dehydrogenase                     233   3e-69    
ref|XP_007529029.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   4e-69    
ref|XP_010926057.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   4e-69    
ref|WP_007312907.1|  betaine-aldehyde dehydrogenase                     233   4e-69    
ref|XP_009402158.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   4e-69    
ref|XP_002324977.1|  aldehyde dehydrogenase family protein              233   4e-69    
ref|XP_006865491.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   4e-69    
ref|XP_009695502.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   4e-69    
ref|XP_006178149.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   4e-69    
ref|WP_017721107.1|  betaine-aldehyde dehydrogenase                     233   4e-69    
ref|XP_007201949.1|  hypothetical protein PRUPE_ppa004555mg             233   4e-69    
ref|XP_004395896.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   4e-69    
ref|XP_010049710.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   4e-69    
gb|AGN03869.1|  retinol dehydrogenase 1                                 231   4e-69    
ref|XP_011043446.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   4e-69    
gb|KCW82468.1|  hypothetical protein EUGRSUZ_C03858                     233   4e-69    
ref|XP_008632790.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      232   5e-69    
ref|XP_005423477.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      233   5e-69    
dbj|GAA52081.1|  aldehyde dehydrogenase (NAD+)                          224   5e-69    
gb|KHN21546.1|  Aldehyde dehydrogenase family 2 member C4               233   5e-69    
ref|XP_010088835.1|  Aldehyde dehydrogenase family 2 member C4          233   5e-69    
ref|XP_004148716.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   5e-69    
ref|XP_003530501.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   5e-69    
ref|XP_008945790.1|  PREDICTED: retinal dehydrogenase 1                 230   5e-69    
ref|XP_010049706.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   5e-69    
gb|KFP63560.1|  hypothetical protein N322_11016                         232   5e-69    
ref|XP_004430030.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   6e-69    
ref|XP_009402159.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    233   6e-69    
ref|XP_009813513.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      230   6e-69    
gb|AAI07975.1|  Aldh2b protein                                          232   6e-69    
ref|WP_015137657.1|  NAD-dependent aldehyde dehydrogenase               232   6e-69    
ref|XP_004691129.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   6e-69    
ref|XP_003462991.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   6e-69    
ref|XP_009973193.1|  PREDICTED: retinal dehydrogenase 1                 230   7e-69    
ref|XP_007058379.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   7e-69    
ref|XP_010049708.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   8e-69    
ref|WP_036269309.1|  betaine-aldehyde dehydrogenase                     232   8e-69    
ref|XP_004753300.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    233   8e-69    
ref|XP_005902646.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   8e-69    
ref|XP_008354525.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    230   8e-69    
ref|XP_008808798.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   8e-69    
ref|XP_004635978.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   8e-69    
ref|XP_853628.1|  PREDICTED: aldehyde dehydrogenase, mitochondria...    233   9e-69    
ref|XP_006865490.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   9e-69    
ref|XP_002191253.1|  PREDICTED: retinal dehydrogenase 1                 232   9e-69    
ref|XP_008570927.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   9e-69    
ref|WP_039742627.1|  betaine-aldehyde dehydrogenase                     232   9e-69    
dbj|BAA76411.1|  aldehyde dehydrogenase class 1                         229   9e-69    
ref|XP_010254147.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   9e-69    
ref|XP_006178147.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   9e-69    
ref|XP_008242609.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   1e-68    
ref|XP_004595351.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   1e-68    
ref|XP_009980667.1|  PREDICTED: retinal dehydrogenase 1                 232   1e-68    
ref|WP_027845417.1|  betaine-aldehyde dehydrogenase                     231   1e-68    
ref|XP_005642984.1|  aldehyde dehydrogenase                             233   1e-68    
ref|XP_008140951.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   1e-68    
ref|XP_004671034.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   1e-68    
emb|CAF94009.1|  unnamed protein product                                232   1e-68    
ref|XP_010049713.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   1e-68    
ref|XP_010391368.1|  PREDICTED: retinal dehydrogenase 1                 232   1e-68    
gb|KDO54175.1|  hypothetical protein CISIN_1g015042mg                   229   1e-68    
ref|XP_003994722.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   1e-68    
ref|NP_998466.2|  aldehyde dehydrogenase 2 family (mitochondrial)...    232   1e-68    
ref|XP_011450475.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   1e-68    
ref|XP_008632789.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      232   1e-68    
gb|KHG05179.1|  Aldehyde dehydrogenase family 2 member C4               229   1e-68    
ref|XP_005237664.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   1e-68    
ref|XP_004287089.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   1e-68    
ref|XP_011458772.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    232   1e-68    
emb|CCQ61589.1|  Aldehyde dehydrogenase                                 231   1e-68    
ref|XP_009903926.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      231   1e-68    
ref|XP_002514330.1|  aldehyde dehydrogenase, putative                   231   1e-68    
ref|XP_004395895.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   1e-68    
ref|XP_010009261.1|  PREDICTED: retinal dehydrogenase 1 isoform X2      231   1e-68    
gb|EFX80526.1|  hypothetical protein DAPPUDRAFT_51170                   231   2e-68    
ref|XP_004483075.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   2e-68    
ref|XP_007528805.1|  PREDICTED: retinal dehydrogenase 1-like isof...    231   2e-68    
ref|XP_006644328.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_004287088.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
gb|AGN03871.1|  retinol dehydrogenase 2                                 231   2e-68    
ref|XP_010049715.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_008775315.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_003462990.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   2e-68    
ref|XP_005657378.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   2e-68    
gb|KFQ50915.1|  hypothetical protein N334_09435                         231   2e-68    
ref|XP_009048780.1|  hypothetical protein LOTGIDRAFT_177987             231   2e-68    
sp|P12762.1|ALDH2_HORSE  RecName: Full=Aldehyde dehydrogenase, mi...    231   2e-68    
ref|XP_004691128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   2e-68    
ref|XP_006640511.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    232   2e-68    
gb|AAK57732.1|  aldehyde dehydrogenase                                  229   2e-68    
ref|XP_010688154.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_010466859.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_005691616.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   2e-68    
ref|XP_005080705.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   2e-68    
gb|ABO93608.1|  cytosolic aldehyde dehydrogenase                        231   2e-68    
ref|XP_006148056.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   2e-68    
gb|EMT09311.1|  Aldehyde dehydrogenase family 2 member C4               231   2e-68    
gb|AJF41243.1|  mitochondrial aldehyde dehydrogenase 2                  231   2e-68    
ref|XP_005902645.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   2e-68    
ref|XP_007529021.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   2e-68    
ref|XP_006204898.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   2e-68    
ref|XP_010280104.1|  PREDICTED: retinal dehydrogenase 1                 231   2e-68    
ref|XP_008808790.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   2e-68    
ref|XP_003761681.1|  PREDICTED: retinal dehydrogenase 1-like            231   2e-68    
ref|WP_020722661.1|  betaine-aldehyde dehydrogenase                     231   2e-68    
ref|XP_008140950.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   2e-68    
ref|WP_015211001.1|  NAD-dependent aldehyde dehydrogenase               231   2e-68    
ref|XP_004635977.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   2e-68    
ref|XP_007936366.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   3e-68    
ref|XP_002913100.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    231   3e-68    
ref|XP_003569290.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   3e-68    
ref|XP_004671033.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    229   3e-68    
gb|KFV71223.1|  Retinal dehydrogenase 1                                 230   3e-68    
ref|XP_004379128.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-68    
ref|XP_010688156.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    231   3e-68    
ref|XP_008431064.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   3e-68    
ref|XP_010250355.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    230   3e-68    
ref|XP_005683810.1|  PREDICTED: retinal dehydrogenase 1                 231   3e-68    
ref|XP_006894735.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-68    
ref|XP_010009259.1|  PREDICTED: retinal dehydrogenase 1 isoform X1      231   3e-68    
ref|XP_005329686.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    230   3e-68    
ref|NP_956784.1|  aldehyde dehydrogenase 2                              231   3e-68    
ref|XP_008504073.1|  PREDICTED: retinal dehydrogenase 1 isoform X3      225   3e-68    
ref|XP_010162096.1|  PREDICTED: aldehyde dehydrogenase, mitochond...    228   3e-68    
ref|XP_005959008.1|  PREDICTED: retinal dehydrogenase 1                 231   3e-68    
ref|XP_011074009.1|  PREDICTED: aldehyde dehydrogenase family 2 m...    230   3e-68    



>ref|XP_004236119.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=535

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKG
Sbjct  353  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFQKILRYIREGRDSSATLECGGDRIGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VKEDM IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID 
Sbjct  413  YFIQPTVFSNVKEDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLRAGTVW+NCYD+FDA IPFGGYKMSG+GREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  473  ANTLTRGLRAGTVWVNCYDIFDAGIPFGGYKMSGMGREKGIYSLNNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AWI
Sbjct  533  AWI  535



>ref|XP_006345041.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Solanum tuberosum]
Length=535

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQF+K+LRYIR G++S ATLECGGDRIGSKG
Sbjct  353  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFKKILRYIREGRDSSATLECGGDRIGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VKEDM IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID 
Sbjct  413  YFIQPTVFSNVKEDMSIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLRAGTVWINCYD+FDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  473  ANTLTRGLRAGTVWINCYDIFDAGIPFGGYKMSGTGREKGIYSLNNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AWI
Sbjct  533  AWI  535



>ref|XP_009617290.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Nicotiana tomentosiformis]
Length=536

 Score =   344 bits (883),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAK RAMRRVVGDPFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKG
Sbjct  354  IEKAKTRAMRRVVGDPFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VKEDM+IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID 
Sbjct  414  YFIQPTVFSNVKEDMLIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLRAGTVW+NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  474  ANTLTRGLRAGTVWVNCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNP  533

Query  213  AWI  205
            AWI
Sbjct  534  AWI  536



>ref|XP_009617291.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Nicotiana tomentosiformis]
Length=535

 Score =   344 bits (883),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAK RAMRRVVGDPFKKGVEQGPQIDSEQF+K+LRYIRSG++S ATLECGGDR GSKG
Sbjct  353  IEKAKTRAMRRVVGDPFKKGVEQGPQIDSEQFQKILRYIRSGRDSSATLECGGDRFGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VKEDM+IAQDEIFGPVQCV KFKDI EVIKRANNT YGLAAGV+T +ID 
Sbjct  413  YFIQPTVFSNVKEDMLIAQDEIFGPVQCVFKFKDIGEVIKRANNTRYGLAAGVFTKNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLRAGTVW+NCYDVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  473  ANTLTRGLRAGTVWVNCYDVFDAGIPFGGYKMSGMGREKGIYSLSNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AWI
Sbjct  533  AWI  535



>gb|KJB53134.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=328

 Score =   330 bits (845),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KG
Sbjct  146  LEKAKARALRRVVGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKG  205

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ 
Sbjct  206  YFVQPTVFSNVMDDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVET  265

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  266  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  325

Query  213  AWI  205
            AW+
Sbjct  326  AWL  328



>ref|XP_011044321.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKG
Sbjct  357  IEKAKARALRRVVGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK+IDEVI+R+NNT YGLAAG++T ++D 
Sbjct  417  YFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKNIDEVIRRSNNTRYGLAAGIFTKNVDT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR GTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  477  ANTLSRALRVGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_002511424.1| aldehyde dehydrogenase, putative [Ricinus communis]
 gb|EEF52026.1| aldehyde dehydrogenase, putative [Ricinus communis]
Length=534

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARAMRRVVGDPF+KGVEQGPQIDSEQF+KVLRYI+SG ES ATLECGGDR G +G
Sbjct  352  LEKAKARAMRRVVGDPFRKGVEQGPQIDSEQFQKVLRYIKSGIESNATLECGGDRFGPRG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T++ID 
Sbjct  412  YFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKDLDEVIRRANTTRYGLAAGVFTNNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  472  ANTLSRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_002318034.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEE96254.1| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=536

 Score =   330 bits (846),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKG
Sbjct  354  IEKAKARALRRVVGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D 
Sbjct  414  YFIQPTVFSNVEDDMLIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTKNVDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR GTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  474  ANTLSRALRVGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>ref|XP_008360830.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like, 
partial [Malus domestica]
Length=253

 Score =   320 bits (820),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKG
Sbjct  71   IEKAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKG  130

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID 
Sbjct  131  YFIQPTVFSNVKDDMLIAKDEIFGPVQSILKFKELDEVVRRANXTRYGLAAGVFTKNIDT  190

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  191  ANYLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  250

Query  213  AWI  205
            AW+
Sbjct  251  AWL  253



>gb|KJB53133.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=530

 Score =   329 bits (844),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KG
Sbjct  348  LEKAKARALRRVVGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKG  407

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ 
Sbjct  408  YFVQPTVFSNVMDDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVET  467

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  468  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  527

Query  213  AWI  205
            AW+
Sbjct  528  AWL  530



>ref|XP_011044320.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=538

 Score =   329 bits (844),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYIRSG ES ATLECGG R GSKG
Sbjct  356  IEKAKARALRRVVGDPFKKGVEQGPQIDSDQFEKVLRYIRSGVESNATLECGGQRFGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK++DEVI+R+N+T YGLAAG++T ++D 
Sbjct  416  YFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKNVDEVIRRSNSTRYGLAAGIFTRNLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR GTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKA+VTPLKNP
Sbjct  476  ANTLSRALRVGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAIVTPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>gb|KJB53131.1| hypothetical protein B456_008G294300 [Gossypium raimondii]
Length=541

 Score =   329 bits (844),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KG
Sbjct  359  LEKAKARALRRVVGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ 
Sbjct  419  YFVQPTVFSNVMDDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVET  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  479  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>gb|KHG08400.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=540

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF+KGVEQGPQID+EQFEKVLRYIR+G ES ATLECGGDR+G+KG
Sbjct  358  IEKAKARALKRVVGDPFRKGVEQGPQIDTEQFEKVLRYIRAGIESNATLECGGDRLGTKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V +DM+IA+DEIFGPVQ +LKFKDIDEVI+RANNT YGLAAGV+T  ++ 
Sbjct  418  YFVQPTVFSNVMDDMLIAKDEIFGPVQSILKFKDIDEVIRRANNTRYGLAAGVFTKSVET  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  478  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>ref|XP_002321583.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
 gb|EEF05710.2| aldehyde dehydrogenase 1 precursor family protein [Populus trichocarpa]
Length=497

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RRVVGDPFKKGVEQGPQIDSEQFEK+LRYI+SG ES ATLECGG R GSKG
Sbjct  315  VEKAKARALRRVVGDPFKKGVEQGPQIDSEQFEKILRYIKSGVESNATLECGGQRFGSKG  374

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG++T ++D 
Sbjct  375  YFIQPTVFSNVQDDMLIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGIFTKNVDT  434

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR G+VW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  435  ANTLSRALRVGSVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  494

Query  213  AWI  205
            AW+
Sbjct  495  AWL  497



>gb|KCW83435.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=378

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG
Sbjct  196  VEKAKARALKRSVGDPFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKG  255

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID 
Sbjct  256  FFVQPTVFSNVQDDMLIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDV  315

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L+R LR GTVWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  316  ANALSRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  375

Query  213  AWI  205
            AW+
Sbjct  376  AWL  378



>ref|XP_004138115.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
 gb|KGN63591.1| hypothetical protein Csa_1G005520 [Cucumis sativus]
Length=548

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA RRVVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKG
Sbjct  366  VEKSKARAQRRVVGDPFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKG  425

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+VK+DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID 
Sbjct  426  YFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDT  485

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNP
Sbjct  486  ANTLIRGLRTGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNP  545

Query  213  AWI  205
            AW+
Sbjct  546  AWL  548



>ref|XP_004155012.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=549

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA RRVVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG ES ATLECGG R+GSKG
Sbjct  367  VEKSKARAQRRVVGDPFKKGVEQGPQIDSDQFEKVLRYIKSGIESNATLECGGGRLGSKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+VK+DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+G++TS+ID 
Sbjct  427  YFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGIFTSNIDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNP
Sbjct  487  ANTLIRGLRTGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNP  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>ref|XP_008453101.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis melo]
Length=554

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA RRVVGDPFKKGVEQGPQID EQFEKVLRYI+SG ES ATLECGG R+GSKG
Sbjct  372  VEKSKARAQRRVVGDPFKKGVEQGPQIDLEQFEKVLRYIKSGIESNATLECGGGRLGSKG  431

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+VK+DM+IA+DEIFGPVQ +LKFKDIDEVI RAN+T YGLA+GV+TS+ID 
Sbjct  432  YFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIDEVIHRANSTRYGLASGVFTSNIDT  491

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNP
Sbjct  492  ANTLTRGLRTGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIYSLQNYLQVKAVVTPLKNP  551

Query  213  AWI  205
            AW+
Sbjct  552  AWL  554



>ref|XP_007155411.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27405.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=536

 Score =   326 bits (836),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG
Sbjct  354  LEKSKKRALRRVVGDPFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DMVIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D 
Sbjct  414  FFIQPTVFSNVQDDMVIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  474  ANRLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  533

Query  213  AWI  205
            AWI
Sbjct  534  AWI  536



>ref|XP_007155410.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
 gb|ESW27404.1| hypothetical protein PHAVU_003G199100g [Phaseolus vulgaris]
Length=535

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQID EQFEKVL YIRSG ES ATLECGG+R+GSKG
Sbjct  353  LEKSKKRALRRVVGDPFKKGVEQGPQIDGEQFEKVLSYIRSGIESNATLECGGNRLGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DMVIAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++D 
Sbjct  413  FFIQPTVFSNVQDDMVIAQDEIFGPVQSILKFKDIDEVIQRANRTRYGLAAGVFTKNVDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  473  ANRLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AWI
Sbjct  533  AWI  535



>emb|CDP18933.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RR VGDPF+KGVEQGPQIDSEQF+KVLRYI+SG +S ATLECGG+RIGSKG
Sbjct  352  LEKAKARALRRTVGDPFRKGVEQGPQIDSEQFDKVLRYIKSGVDSNATLECGGERIGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V+++M+IA+DEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGVYT +ID 
Sbjct  412  FFIQPTVFSNVQDNMLIAKDEIFGPVQSILKFKDLDEVIKRANATRYGLAAGVYTKNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+RGLRAGTVWINC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  472  ANTLSRGLRAGTVWINCFDVFDAAIPFGGYKMSGHGREKGFYSLQNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KDP31120.1| hypothetical protein JCGZ_11496 [Jatropha curcas]
Length=541

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RRVVGDPFKKGVEQGPQID EQF+KVLRYI+SG ES   LECGG+R+GSKG
Sbjct  359  VEKAKARAVRRVVGDPFKKGVEQGPQIDDEQFQKVLRYIKSGIESNGKLECGGERLGSKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V+EDM+IA+DEIFGPVQ +LKFKD+DEVI+RAN++ YGLAAGV+T +ID 
Sbjct  419  YFIQPTVFSNVQEDMLIAKDEIFGPVQSILKFKDVDEVIRRANSSRYGLAAGVFTKNIDT  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  479  ANTLSRALRAGTVWVNCFDVFDAAIPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLKNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>gb|EPS72259.1| hypothetical protein M569_02499, partial [Genlisea aurea]
Length=291

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAM+R VGDPFK+G+EQGPQID EQF+K+LRYIRSG E+ A LECGG+ +GSKG
Sbjct  109  VEKAKARAMKRTVGDPFKRGIEQGPQIDDEQFQKILRYIRSGTETKAVLECGGESLGSKG  168

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ +L+FK+IDEVIKRAN T YGLAAGV+T +ID 
Sbjct  169  YYIQPTVFSNVEDDMLIAKDEIFGPVQSILRFKNIDEVIKRANATRYGLAAGVFTRNIDT  228

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGLRAGTVW+NCYDVFDA IPFGGYKMSGIGREKG++SLNNYLQVK++++PL NP
Sbjct  229  ANTLTRGLRAGTVWVNCYDVFDAAIPFGGYKMSGIGREKGIHSLNNYLQVKSIISPLSNP  288

Query  213  AWI  205
            AW+
Sbjct  289  AWL  291



>ref|XP_010037573.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW49300.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
 gb|KCW49301.1| hypothetical protein EUGRSUZ_K02858 [Eucalyptus grandis]
Length=542

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARAM+RVVGDPFKKGVEQGPQID EQFEK+LRYI+ G ES ATLECGG+R GSKG
Sbjct  360  LEKAKARAMKRVVGDPFKKGVEQGPQIDVEQFEKILRYIKLGVESNATLECGGERFGSKG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+VK+DM IAQDEIFGPVQ +LKFKD+DEV++RAN T YGLAAGVYT +ID 
Sbjct  420  FFIQPTVFSNVKDDMTIAQDEIFGPVQSILKFKDLDEVVRRANATAYGLAAGVYTKNIDT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NCYDVFDA IPFGGYKMSGIGREKG+Y LN+YLQVKAVVTPLKNP
Sbjct  480  ANTLTRALRAGTVWVNCYDVFDAAIPFGGYKMSGIGREKGIYGLNSYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_010546022.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Tarenaya hassleriana]
Length=539

 Score =   325 bits (834),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RR VGDPFKKG+EQGPQ+DSEQFEKV+RYIRSG ES A LECGG+RIG+KG
Sbjct  357  VEKAKARALRRAVGDPFKKGIEQGPQVDSEQFEKVMRYIRSGLESDAVLECGGERIGNKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VKEDM+IA+DEIFGPVQ +LKFKD+DEVI+RANNT YGLAAGV+T  ++ 
Sbjct  417  YFIQPTVFSNVKEDMLIARDEIFGPVQSILKFKDLDEVIQRANNTRYGLAAGVFTRSLET  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN + R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNP
Sbjct  477  ANRMTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVAPLKNP  536

Query  213  AWI  205
            AWI
Sbjct  537  AWI  539



>ref|XP_004298932.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=532

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFKKG+EQGPQIDSEQF+KVL+YI+SG ES ATLECGG+R GSKG
Sbjct  350  LEKAKARALKRTVGDPFKKGIEQGPQIDSEQFQKVLKYIKSGVESDATLECGGERFGSKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK+IDEV++RAN+T +GLAAGV+T +ID 
Sbjct  410  YFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKEIDEVVRRANSTRFGLAAGVFTKNIDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  470  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>gb|KEH35050.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=542

 Score =   325 bits (833),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKA A+RRVVGDPFKKGVEQGPQ+DS+QFEK+L+YI+SG ES ATLECGGDRIG+KG
Sbjct  360  LEKAKAAALRRVVGDPFKKGVEQGPQVDSQQFEKILKYIKSGVESNATLECGGDRIGTKG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM IA+DEIFGPVQ +LKFKD DEVI+RANNT YGLAAGV+T+++D 
Sbjct  420  FFVQPTVFSNVQDDMSIAKDEIFGPVQTILKFKDTDEVIRRANNTRYGLAAGVFTNNLDT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL RGL+AGTVWINC+DVFDA IPFGGYKMSG+GREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  480  ANTLMRGLKAGTVWINCFDVFDAAIPFGGYKMSGVGREKGIYSLHNYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>gb|EYU42550.1| hypothetical protein MIMGU_mgv1a004919mg [Erythranthe guttata]
Length=504

 Score =   323 bits (829),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V+KAKARA+ R VGDPFK G+EQGPQID +QFEKVLRYI+SG +S ATLECGGDR GSKG
Sbjct  322  VDKAKARALGRTVGDPFKNGIEQGPQIDLKQFEKVLRYIKSGIDSDATLECGGDRFGSKG  381

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+D+VIKRAN T YGLAAGV+T++IDK
Sbjct  382  YFVQPTVFSNVKDDMLIAQDEIFGPVQSILKFKDVDKVIKRANATRYGLAAGVFTTNIDK  441

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT++RGL+AGTVWINCYD+FDA IPFGGYKMSGIGREKGVYSLNNYLQVK+V++PLKNP
Sbjct  442  ANTISRGLKAGTVWINCYDIFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKSVISPLKNP  501

Query  213  AWI  205
            AW+
Sbjct  502  AWL  504



>ref|XP_010101190.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB87864.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=546

 Score =   325 bits (832),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFKKGVEQGPQIDSEQF K+L+YIRSG +S ATLECGGDRIGSKG
Sbjct  364  VEKAKARAVNRSVGDPFKKGVEQGPQIDSEQFRKILKYIRSGIDSNATLECGGDRIGSKG  423

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK+IDEVIKRAN T YGLAAGV+T +ID 
Sbjct  424  YFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKEIDEVIKRANATRYGLAAGVFTKNIDT  483

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+AGTVW+NC+DVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKAVVT LKNP
Sbjct  484  ANTLTRALKAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTRLKNP  543

Query  213  AWI  205
            AW+
Sbjct  544  AWL  546



>ref|XP_004508854.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=423

 Score =   320 bits (821),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG
Sbjct  241  LEKSKERALRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKG  300

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  
Sbjct  301  FFIQPTVFSNVQDDMLIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLST  360

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNP
Sbjct  361  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNP  420

Query  213  AWI  205
            AW+
Sbjct  421  AWL  423



>gb|KHN18468.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=542

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+GSKG
Sbjct  360  LEKSKKRALRRVVGDPFKKGVEQGPQIDVEQFEKVLRYIRSGIESHATLECGGDRLGSKG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IAQDEIFGPVQ +LKFKDIDEVI+RAN T YGLAAGV+T ++  
Sbjct  420  FFVQPTVFSNVQDDMLIAQDEIFGPVQSILKFKDIDEVIRRANKTRYGLAAGVFTKNVST  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+P+KNP
Sbjct  480  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPVKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_010028184.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW83434.1| hypothetical protein EUGRSUZ_B00357 [Eucalyptus grandis]
Length=534

 Score =   323 bits (829),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFKKG+EQGPQID EQF+KVLRYIR+G +S ATLECGGDR+GSKG
Sbjct  352  VEKAKARALKRSVGDPFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKD+DEV++RAN+T YGLAAGV+T DID 
Sbjct  412  FFVQPTVFSNVQDDMLIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDV  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L+R LR GTVWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  472  ANALSRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_008374451.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Malus domestica]
Length=539

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID+EQFEKVLRYIRSG +S ATLECGG+R+GSKG
Sbjct  357  IEKAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRSGIDSNATLECGGERLGSKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +I+ 
Sbjct  417  YFIQPTVFSNVEDDMLIAQDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNINT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  477  ANYLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_006439785.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53025.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=478

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAMRR+VGDPFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++G
Sbjct  296  VEKAKARAMRRIVGDPFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRG  355

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FSDVK+DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D 
Sbjct  356  YFVQPTVFSDVKDDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADT  415

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R LRAGTVWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNP
Sbjct  416  ANTMMRALRAGTVWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNP  475

Query  213  AWI  205
            AW+
Sbjct  476  AWL  478



>gb|AEV54528.1| aldehyde dehydrogenase ALDH2B4_V3 [Vitis vinifera]
Length=524

 Score =   322 bits (824),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKG
Sbjct  342  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKG  401

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  402  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  461

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNP
Sbjct  462  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNP  521

Query  213  AWI  205
            AW+
Sbjct  522  AWL  524



>ref|XP_008239742.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Prunus mume]
Length=537

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKG
Sbjct  355  IEKAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+VK+DM+IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID 
Sbjct  415  YFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  475  ANYLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>ref|XP_008367527.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Malus domestica]
Length=541

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKG
Sbjct  359  IEKAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSBATLECGGGRLGSKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IA+DEIFGPVQ +LKFK++DEV++RAN T YGLAAGV+T +ID 
Sbjct  419  YFIQPTVFSNVKDDMLIAKDEIFGPVQSILKFKELDEVVRRANATRYGLAAGVFTKNIDT  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  479  ANYLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>ref|XP_006439784.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
 gb|ESR53024.1| hypothetical protein CICLE_v10019638mg [Citrus clementina]
Length=538

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAMRR+VGDPFK GVEQGPQID EQFEKVLRYIRSG ES ATLECGGDR+G++G
Sbjct  356  VEKAKARAMRRIVGDPFKSGVEQGPQIDPEQFEKVLRYIRSGIESNATLECGGDRLGNRG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FSDVK+DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D 
Sbjct  416  YFVQPTVFSDVKDDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R LRAGTVWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNP
Sbjct  476  ANTMMRALRAGTVWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_007210569.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
 gb|EMJ11768.1| hypothetical protein PRUPE_ppa003869mg [Prunus persica]
Length=543

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID+EQFEKVLRYIR+G +S ATLECGG R+GSKG
Sbjct  361  IEKAKARAVKRVVGDPFKKGVEQGPQIDNEQFEKVLRYIRAGIDSDATLECGGGRLGSKG  420

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+VK+DM+IA+DEIFGPVQ +LKFKD+DEV++RAN T YGLAAGV+T +ID 
Sbjct  421  YFIEPTVFSNVKDDMLIAKDEIFGPVQSILKFKDLDEVVRRANATRYGLAAGVFTRNIDT  480

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN   R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVVTPLKNP
Sbjct  481  ANYFTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNP  540

Query  213  AWI  205
            AW+
Sbjct  541  AWL  543



>ref|XP_007044551.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
 gb|EOY00383.1| Aldehyde dehydrogenase 2B4 [Theobroma cacao]
Length=538

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQIDSEQFEK+LRYIRSG ESGATLE GG+RIGSKG
Sbjct  356  VEKAKARALNRTVGDPFKAGIEQGPQIDSEQFEKILRYIRSGIESGATLETGGERIGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VKEDM+IAQDEIFGPVQ +LKFKDI EVI+RAN+T YGLAAGV+T DID 
Sbjct  416  YYIQPTVFSNVKEDMLIAQDEIFGPVQSILKFKDIKEVIRRANSTSYGLAAGVFTKDIDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG+ SL+NYLQVKAVVTPLKNP
Sbjct  476  ANTVTRALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGIQSLSNYLQVKAVVTPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWM  538



>gb|AEV54527.1| aldehyde dehydrogenase ALDH2B4_V2 [Vitis vinifera]
Length=477

 Score =   320 bits (819),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKG
Sbjct  295  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKG  354

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  355  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  414

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNP
Sbjct  415  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNP  474

Query  213  AWI  205
            AW+
Sbjct  475  AWL  477



>gb|AAO72532.1| aldehyde dehydrogenase 1 precursor [Lotus corniculatus]
Length=542

 Score =   322 bits (824),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG
Sbjct  360  LEKSKKRALRRVVGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+V++DM+IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  
Sbjct  420  FYVQPTVFSNVQDDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLAT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  480  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_004508853.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=536

 Score =   321 bits (823),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSG +S ATLECGG+R GSKG
Sbjct  354  LEKSKERALRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIDSNATLECGGERFGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAGV+T ++  
Sbjct  414  FFIQPTVFSNVQDDMLIAKDEIFGPVQSILKFKEIDEVIRRANATRYGLAAGVFTKNLST  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PLKNP
Sbjct  474  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>ref|XP_002283132.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI15054.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKG
Sbjct  356  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  416  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNP
Sbjct  476  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>emb|CAN63005.1| hypothetical protein VITISV_013710 [Vitis vinifera]
Length=538

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYIRSG ES ATLECGG RIGSKG
Sbjct  356  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIRSGIESNATLECGGGRIGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  416  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+YSLNNYLQVKAV+TPLKNP
Sbjct  476  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_009150211.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Brassica rapa]
Length=538

 Score =   320 bits (820),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQIDS+QFEKV+RYIRSG ES ATLECGGD+IG+KG
Sbjct  356  VEKAKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMRYIRSGVESNATLECGGDQIGNKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF+D+DEVI+RAN T YGLAAGV+T+ +D 
Sbjct  416  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFRDVDEVIRRANETRYGLAAGVFTNSLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NP
Sbjct  476  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNP  535

Query  213  AWI  205
            AWI
Sbjct  536  AWI  538



>gb|AFK44278.1| unknown [Medicago truncatula]
Length=378

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG
Sbjct  196  LEKSKERALRRVVGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKG  255

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  
Sbjct  256  FFVQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVST  315

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NP
Sbjct  316  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNP  375

Query  213  AWI  205
            AW+
Sbjct  376  AWL  378



>ref|XP_011028588.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Populus euphratica]
Length=539

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPFKKGVEQGPQIDSEQFEKVLRYI+SG ES ATLECGG R GSKG
Sbjct  357  IEKAKARALRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIKSGVESNATLECGGQRFGSKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++DM+IA+DEIFGPVQ +LKFK+IDEVI+RAN T YGLAAG +T ++D 
Sbjct  417  YFIQPTVFSNVQDDMLIAKDEIFGPVQSILKFKNIDEVIQRANTTRYGLAAGSFTKNVDT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR G+VW+NC+DVFDA IP GGYKMSGIGR KG+YSL+NYLQVKAVVTPLKNP
Sbjct  477  ANTLSRALRVGSVWVNCFDVFDAAIPLGGYKMSGIGRGKGIYSLHNYLQVKAVVTPLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_003527026.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN19318.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=540

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQID EQF+KVLRYI+SG ES ATLECGGD+IGSKG
Sbjct  358  LEKAKARALKRVVGDPFKKGVEQGPQIDVEQFQKVLRYIKSGIESKATLECGGDQIGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKDIDEVI+R+N THYGLAAGV+T ++  
Sbjct  418  FFVQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDIDEVIRRSNATHYGLAAGVFTKNVHT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDA IPFGGYKMSGIGREKG+YSLNNYLQVKAVV+P+K P
Sbjct  478  ANTLMRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVSPVKKP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>emb|CDY36910.1| BnaA06g16950D [Brassica napus]
Length=539

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G KG
Sbjct  357  VEKAKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  417  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NP
Sbjct  477  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNP  536

Query  213  AWI  205
            AWI
Sbjct  537  AWI  539



>ref|XP_006476755.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Citrus sinensis]
Length=538

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAMRR+VGDPFK GVEQGPQID EQF+KVLRYIRSG ES ATLECGGDR+G++G
Sbjct  356  VEKAKARAMRRIVGDPFKNGVEQGPQIDPEQFQKVLRYIRSGIESNATLECGGDRLGNRG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FSDV +DM+IAQDEIFGPVQ +LKFK+ D+VI+RAN T +GLAAGV+T   D 
Sbjct  416  YFVQPTVFSDVTDDMLIAQDEIFGPVQSILKFKETDDVIRRANKTRFGLAAGVFTKSADT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R LRAGTVWINCYDVFDA IPFGGYK+SGIGREKG+YSLN YLQVKAVV P+KNP
Sbjct  476  ANTMMRALRAGTVWINCYDVFDAAIPFGGYKLSGIGREKGIYSLNAYLQVKAVVQPVKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>gb|AAZ79358.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=524

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKG
Sbjct  342  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKG  401

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  402  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  461

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NP
Sbjct  462  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNP  521

Query  213  AWI  205
            AW+
Sbjct  522  AWL  524



>ref|XP_009149853.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Brassica rapa]
Length=539

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGG ++G +G
Sbjct  357  VEKAKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGGQVGDRG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  417  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NP
Sbjct  477  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNP  536

Query  213  AWI  205
            AWI
Sbjct  537  AWI  539



>gb|AAZ79356.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=477

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKG
Sbjct  295  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKG  354

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  355  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  414

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NP
Sbjct  415  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNP  474

Query  213  AWI  205
            AW+
Sbjct  475  AWL  477



>ref|XP_006404308.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
 dbj|BAJ34644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45761.1| hypothetical protein EUTSA_v10010271mg [Eutrema salsugineum]
Length=538

 Score =   318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG EQGPQID +QFEKV++YIRSG ES ATLECGGD+ G KG
Sbjct  356  VEKAKARALKRVVGDPFKKGTEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQFGKKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D 
Sbjct  416  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NP
Sbjct  476  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNP  535

Query  213  AWI  205
            AWI
Sbjct  536  AWI  538



>emb|CDY44985.1| BnaCnng12150D [Brassica napus]
Length=538

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQ+DS+QFEKV++YIRSG ES ATLECGG ++G +G
Sbjct  356  VEKAKARALKRVVGDPFKKGIEQGPQVDSKQFEKVMKYIRSGVESNATLECGGGQVGDRG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  416  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NP
Sbjct  476  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNP  535

Query  213  AWI  205
            AWI
Sbjct  536  AWI  538



>gb|EYU31278.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
 gb|EYU31279.1| hypothetical protein MIMGU_mgv1a004311mg [Erythranthe guttata]
Length=533

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G+EQGPQIDSEQFEK+L+YIRSG ESGATLE GGDR+G+KG
Sbjct  351  LEKAKARALQRAVGDPFKSGMEQGPQIDSEQFEKILKYIRSGTESGATLETGGDRLGTKG  410

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y++QPT+FS+VK+DM+IA+DEIFGPVQ +LKF ++++VIKRANNT YGLAAGV+TS++D 
Sbjct  411  YYVQPTVFSNVKDDMLIAKDEIFGPVQTILKFNELNDVIKRANNTRYGLAAGVFTSNLDT  470

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNP
Sbjct  471  ANTLTRALRAGTVWINCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNP  530

Query  213  AWI  205
            AW+
Sbjct  531  AWL  533



>gb|AAZ79355.1| aldehyde dehydrogenase [Vitis pseudoreticulata]
Length=537

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+ R VGDPFKKG+EQGPQID EQF KVLRYI+SG ES ATLECGG RIGSKG
Sbjct  355  IEKAKARALSRTVGDPFKKGIEQGPQIDPEQFAKVLRYIKSGVESNATLECGGGRIGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF+QPT+FS+V++DM+IA+DEIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T +I+ 
Sbjct  415  YFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGLAAGVFTKNINT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+Y+LNNYLQVKAV+TPL+NP
Sbjct  475  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYNLNNYLQVKAVITPLRNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>ref|XP_010682578.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=550

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+K +EQGPQIDSEQFEKV++YI+SG ESGA LE GG+R+GSKG
Sbjct  368  VEKAKARAIQRVVGDPFRKDIEQGPQIDSEQFEKVMQYIKSGIESGAKLETGGERLGSKG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+V EDM+IAQDEIFGPVQ + KFKD+ EV +RANNTHYGLAAGV+T DID 
Sbjct  428  FYIQPTVFSNVNEDMLIAQDEIFGPVQSIFKFKDLQEVARRANNTHYGLAAGVFTQDIDT  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVW+NCYDVFDA IPFGGYKMSG GREKG+Y L NYLQVK+VVTPLKNP
Sbjct  488  ANTLARALRVGTVWVNCYDVFDAAIPFGGYKMSGQGREKGIYCLMNYLQVKSVVTPLKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>ref|XP_009761724.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=540

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKGVEQGPQID+EQFEK+L+YI SG ESGATLE GG+++GSKG
Sbjct  358  VEKAKARALKRVVGDPFKKGVEQGPQIDTEQFEKILKYIESGIESGATLESGGEKLGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+V+++M+IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID 
Sbjct  418  FYVQPTVFSNVQDNMLIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTQNIDV  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT++R LR GTVW+NC+++FDA IPFGGYKMSG GREKGVYSLNNYLQVKAVVTPLKNP
Sbjct  478  ANTISRALRVGTVWVNCFNIFDAAIPFGGYKMSGHGREKGVYSLNNYLQVKAVVTPLKNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWM  540



>gb|KDP26565.1| hypothetical protein JCGZ_17723 [Jatropha curcas]
Length=537

 Score =   317 bits (811),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF+ G+EQGPQ+DSEQFEK+LRYIRSG ESGATLE GGDR G+KG
Sbjct  355  IEKAKARAIKRVVGDPFRGGIEQGPQVDSEQFEKILRYIRSGIESGATLEAGGDRFGTKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VK+DM+IA+DEIFGPVQ +LKFKD+ EVI RAN+T YGLAAGV+T +ID 
Sbjct  415  YYIQPTVFSNVKDDMLIAKDEIFGPVQSILKFKDLGEVIHRANSTRYGLAAGVFTQNIDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVTPLKNP
Sbjct  475  ANILTRALRVGTVWINCFDVFDAAIPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>ref|XP_011086550.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Sesamum indicum]
Length=532

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPF+ G+EQGPQIDSEQFEK+L+YIR G+ESGAT+E GGDR GSKG
Sbjct  350  VEKAKARALKRAVGDPFRAGMEQGPQIDSEQFEKILKYIRWGRESGATVEAGGDRFGSKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VK+DM IA DEIFGPVQ +LK+K++DEVI+RANNT YGLAAGV+T ++D 
Sbjct  410  YYIQPTVFSNVKDDMRIATDEIFGPVQTILKYKELDEVIRRANNTRYGLAAGVFTHNLDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D FDATIPFGGYKMSGIGREKG YSL NYLQVKAVVTPLKNP
Sbjct  470  ANTLMRALRAGTVWINCFDTFDATIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPLKNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>gb|AFK41217.1| unknown [Lotus japonicus]
Length=543

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+R VVGDPFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG
Sbjct  361  LEKSKKRALRCVVGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKG  420

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+V++DM+IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  
Sbjct  421  FYVQPTVFSNVQDDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLAT  480

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAVVTPLKNP
Sbjct  481  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLLNYLQVKAVVTPLKNP  540

Query  213  AWI  205
            AW+
Sbjct  541  AWL  543



>gb|AES91175.2| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=544

 Score =   316 bits (810),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG
Sbjct  362  LEKSKERALRRVVGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  
Sbjct  422  FFVQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVST  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NP
Sbjct  482  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>ref|XP_003608978.1| Mitochondrial aldehyde dehydrogenase [Medicago truncatula]
Length=544

 Score =   316 bits (810),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+K RA+RRVVGDPFKKGVEQGPQIDS+QFEKVLRYI+SG +S ATLECGG R+GSKG
Sbjct  362  LEKSKERALRRVVGDPFKKGVEQGPQIDSKQFEKVLRYIKSGIDSNATLECGGGRLGSKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V++DM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T+++  
Sbjct  422  FFVQPTVFSNVQDDMLIAKDEIFGPVQTILKFKDINEVIRRANATRYGLAAGVFTNNVST  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV+PL NP
Sbjct  482  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVSPLNNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>ref|XP_011071828.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Sesamum indicum]
Length=536

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA RR VGDPFKKG+EQGPQIDS+QF+KVLRYIRSG +  A LECGG+R+GSKG
Sbjct  354  VEKAKARAARRTVGDPFKKGIEQGPQIDSDQFDKVLRYIRSGIDGNAKLECGGERVGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+V+++M+IAQDEIFGPVQ +LKFKD+DEVIKRAN T YGLAAGV+T +ID 
Sbjct  414  FYIQPTVFSNVEDNMLIAQDEIFGPVQSILKFKDVDEVIKRANATRYGLAAGVFTKNIDI  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT++RGLRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL NYLQVKAV++PL NP
Sbjct  474  ANTVSRGLRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLKNYLQVKAVISPLTNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>emb|CDY21806.1| BnaA06g20750D [Brassica napus]
Length=496

 Score =   314 bits (805),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQIDS QFEKV+RYIRSG ES ATLECGG +IG+KG
Sbjct  314  VEKAKARALKRVVGDPFKKGIEQGPQIDSRQFEKVMRYIRSGVESNATLECGGHQIGNKG  373

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+ M+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D 
Sbjct  374  YFIQPTVFSNVKDYMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDT  433

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L NP
Sbjct  434  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNNP  493

Query  213  AWI  205
            AWI
Sbjct  494  AWI  496



>gb|ACM89738.1| mitochondrial benzaldehyde dehydrogenase [Antirrhinum majus]
Length=534

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+D++QFEK+L+YIRSG ESGATLE GGDR+G+KG
Sbjct  352  VEKAKARALKRTVGDPFKAGMEQGPQVDADQFEKILKYIRSGAESGATLETGGDRLGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA+DEIFGPVQ +LKFK++DEVI+RANN+ YGLAAGV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIAKDEIFGPVQTILKFKELDEVIRRANNSSYGLAAGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R LRAGTVWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNP
Sbjct  472  ANTMMRALRAGTVWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_010316283.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=528

 Score =   314 bits (805),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R+VGDPFKKGVEQGPQID+EQFEK+L+YI+SG ESGATLE GG+++GSKG
Sbjct  346  VEKAKARALKRIVGDPFKKGVEQGPQIDTEQFEKILKYIKSGTESGATLESGGEKLGSKG  405

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+V+++M+IA+DEIFGPVQ +LKFKD++EVI+RAN++HYGLAAGV+T +ID 
Sbjct  406  FYVQPTVFSNVQDNMLIARDEIFGPVQSLLKFKDVEEVIRRANSSHYGLAAGVFTQNIDA  465

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT++R LR GTVW+NC+++FDA IPFGGYKMSG GREKGVYSL+NYLQVKA+VTPLKNP
Sbjct  466  ANTISRALRVGTVWVNCFNIFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAIVTPLKNP  525

Query  213  AWI  205
            AW+
Sbjct  526  AWL  528



>ref|XP_010503421.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KG
Sbjct  355  VEKSKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  415  YFIQPTVFSNVKDNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++RGL+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  475  ANRVSRGLKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  534

Query  213  AWI  205
            AWI
Sbjct  535  AWI  537



>ref|XP_010682575.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=534

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAK RA  R VGDPFK+G+EQGPQID EQF K+LRYI+SG ESGATLE GGD+IGSKG
Sbjct  352  VEKAKLRAANRSVGDPFKQGIEQGPQIDPEQFNKILRYIKSGVESGATLETGGDKIGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+V +DM+IAQDEIFGPVQ +LKFK IDEVI+RAN + YGLAAGV+T +ID 
Sbjct  412  YYIKPTVFSNVTDDMLIAQDEIFGPVQSILKFKSIDEVIRRANASDYGLAAGVFTKNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT++R L+AGTVWINCYDVFDA IPFGGYKMSGIGREKGVYSLNNYLQVKA+VTPLKNP
Sbjct  472  ANTISRALKAGTVWINCYDVFDAAIPFGGYKMSGIGREKGVYSLNNYLQVKAIVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_010682577.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=535

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V KAKARAM+RVVGDPF+K +EQGPQIDSEQFEKV+RYIRSG E+GA LE GG++ GSKG
Sbjct  353  VAKAKARAMQRVVGDPFRKDIEQGPQIDSEQFEKVMRYIRSGIENGAKLETGGEQFGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V EDM+IAQDEIFGPVQ + KFKD++EV++RANNT YGLAAGV+T DID 
Sbjct  413  YYIQPTVFSNVNEDMLIAQDEIFGPVQSIFKFKDLEEVVRRANNTRYGLAAGVFTQDIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR GTVW+NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNP
Sbjct  473  ANTLSRALRVGTVWVNCFDIFDAGIPFGGYKMSGQGREKGIYSLMNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>gb|AAL77005.1| aldehyde dehydrogenase [Allium cepa]
Length=230

 Score =   303 bits (777),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 167/197 (85%), Gaps = 5/197 (3%)
 Frame = -1

Query  780  CS*THIRR-----VVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESG  616
            CS T +        VEKAKARAMRRVVGDPFKKGVEQGPQID EQF K+LRYI+ G + G
Sbjct  34   CSPTFVHEKIYDEFVEKAKARAMRRVVGDPFKKGVEQGPQIDDEQFNKILRYIKLGVDGG  93

Query  615  ATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTH  436
            A+L  GG+RIGSKGY+IQPTIFSDVK+DMVIA++EIFGPVQ +LKF D++EVI+RAN + 
Sbjct  94   ASLVTGGERIGSKGYYIQPTIFSDVKDDMVIAKEEIFGPVQSILKFNDLNEVIRRANASR  153

Query  435  YGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNN  256
            YGLAAGV+TS+IDKANTL R LR GTVW+NC+DVFDA IPFGGYKMSG GREKG+ SL  
Sbjct  154  YGLAAGVFTSNIDKANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGQGREKGIDSLKG  213

Query  255  YLQVKAVVTPLKNPAWI  205
            YLQ KAVVTPLKNPAW+
Sbjct  214  YLQTKAVVTPLKNPAWL  230



>gb|KJB50198.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=492

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG
Sbjct  310  LEKAKARALKRSVGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKG  369

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VKEDM+IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID 
Sbjct  370  FYIQPTVFSNVKEDMLIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDT  429

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+P
Sbjct  430  ANTLTRALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDP  489

Query  213  AWI  205
            AWI
Sbjct  490  AWI  492



>gb|KFK44454.1| hypothetical protein AALP_AA1G258900 [Arabis alpina]
Length=524

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G +SGATL+ GGDR+GSKG
Sbjct  342  VEKAKARAINRSVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVDSGATLQAGGDRLGSKG  401

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IAQDEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  402  YYIQPTVFSDVKDDMLIAQDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDT  461

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L+R LR GTVWINCYDV D TIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNP
Sbjct  462  ANRLSRALRVGTVWINCYDVLDITIPFGGYKMSGIGREKGIYSLSNYLQVKAVVTALKNP  521

Query  213  AWI  205
            AW+
Sbjct  522  AWL  524



>ref|XP_010914166.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=571

 Score =   314 bits (805),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K++RYIRSG +SGATL+ GGDR+GSKG
Sbjct  389  VEKAKARALKRVVGDPFRKGVEQGPQIDEEQFNKIMRYIRSGVDSGATLQAGGDRLGSKG  448

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPTIFSDVK+ M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D 
Sbjct  449  YFIQPTIFSDVKDGMPIAQEEIFGPVQSILKFNDLNEVIQRANTTRYGLAAGVFTNNLDT  508

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNP
Sbjct  509  ANTLTRALRAGTVWINCFDVFDAAIPFGGYKMSGHGREKGIDSLKNYLQVKAVVTPLKNP  568

Query  213  AWI  205
            AW+
Sbjct  569  AWL  571



>gb|KHG27537.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG KG
Sbjct  349  LEKAKARALKRSVGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGDKG  408

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VKEDM+IA+DEIFGPVQ +LKFKDI+EVI+RAN T YGLAAGV+T DID 
Sbjct  409  FYIQPTVFSNVKEDMLIAKDEIFGPVQSILKFKDINEVIRRANTTSYGLAAGVFTQDIDT  468

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+P
Sbjct  469  ANTLTRALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDP  528

Query  213  AWI  205
            AWI
Sbjct  529  AWI  531



>ref|XP_010678738.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=534

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA  RA RR VGDPFK G+EQGPQID+EQFEKVLRYI+SG ES A LECGG R GS+G
Sbjct  352  VEKATQRAKRRTVGDPFKSGIEQGPQIDTEQFEKVLRYIKSGSESNAKLECGGQRFGSRG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
             FIQPT+FS+V++DM+IAQDEIFGPVQ +LKFK++D+V+ RAN T YGLAAGV+T++++ 
Sbjct  412  LFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKELDDVVHRANTTQYGLAAGVFTNNLNT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKGVYSL+NYLQVKAVVTPLKNP
Sbjct  472  ANTLSRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>emb|CDY47634.1| BnaC05g18900D [Brassica napus]
Length=544

 Score =   313 bits (802),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G ESGATL+ GGDR GSKG
Sbjct  362  VEKAKARAIKRAVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVESGATLQAGGDRFGSKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  422  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTHNLDT  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  482  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>emb|CDX91724.1| BnaC08g06430D [Brassica napus]
Length=537

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKG
Sbjct  355  VEKAKARAINRAVGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  415  YYIQPTVFSDVKDDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  475  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>emb|CDY57318.1| BnaA08g20300D [Brassica napus]
Length=537

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKG
Sbjct  355  VEKAKARAINRAVGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  415  YYIQPTVFSDVKDDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  475  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>ref|XP_009110081.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=537

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+DSEQFEK+L+YIR G +SGATL+ GGDR GSKG
Sbjct  355  VEKAKARAINRAVGDPFKSGIEQGPQVDSEQFEKILKYIRHGVDSGATLQAGGDRHGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA+DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  415  YYIQPTVFSDVKDDMLIAKDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  475  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSIKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>gb|KFK34098.1| hypothetical protein AALP_AA5G101700 [Arabis alpina]
Length=540

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFKKG+EQGPQID +QFEKV++YIRSG ES ATLECGGD+IG+KG
Sbjct  358  VEKSKARALKRVVGDPFKKGIEQGPQIDLKQFEKVMKYIRSGVESNATLECGGDQIGNKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF+D+DEVIKRAN T YGLAAGV+T  +D 
Sbjct  418  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFRDVDEVIKRANETRYGLAAGVFTKSLDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  478  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  537

Query  213  AWI  205
            AWI
Sbjct  538  AWI  540



>ref|XP_010515110.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Camelina sativa]
Length=537

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFKKG+EQGPQIDS+QFEKV+ YIRSG ES ATLECGGD+IG KG
Sbjct  355  VEKSKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMNYIRSGVESNATLECGGDQIGDKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  415  YFIQPTVFSNVKDNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  475  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  534

Query  213  AWI  205
            AWI
Sbjct  535  AWI  537



>ref|XP_009600000.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=544

 Score =   313 bits (801),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFKKG+EQGPQID+EQ+EK+L+YI+SG ESGATLE GGD++GSKG
Sbjct  362  VEKAKARALKRVVGDPFKKGIEQGPQIDTEQYEKILKYIKSGIESGATLESGGDKLGSKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+V+++M+IA+DEIFGPVQ +LKFKD++EVI+RAN+THYGLAAGV+T +ID 
Sbjct  422  FYVQPTVFSNVQDNMLIAKDEIFGPVQSLLKFKDLEEVIRRANSTHYGLAAGVFTRNIDV  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT+ R LR GTVW+NC+++FDA IPFGGY+MSG GREKGVYSLNNYLQVKAVVT LKNP
Sbjct  482  ANTITRALRVGTVWVNCFNIFDAAIPFGGYRMSGHGREKGVYSLNNYLQVKAVVTSLKNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWM  544



>gb|KJB50197.1| hypothetical protein B456_008G158500 [Gossypium raimondii]
Length=531

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPF  G+EQGPQIDSEQFEK++RYIRSG ESGATLE GG+RIG+KG
Sbjct  349  LEKAKARALKRSVGDPFVAGIEQGPQIDSEQFEKIMRYIRSGVESGATLETGGERIGNKG  408

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VKEDM+IA+DEIFGPVQ +LKFKDI+E I+RAN T YGLAAGV+T DID 
Sbjct  409  FYIQPTVFSNVKEDMLIAKDEIFGPVQSILKFKDINEAIRRANTTSYGLAAGVFTQDIDT  468

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG++ L+NYLQVKAVVTPLK+P
Sbjct  469  ANTLTRALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGIHCLSNYLQVKAVVTPLKDP  528

Query  213  AWI  205
            AWI
Sbjct  529  AWI  531



>gb|EPS72983.1| mitochondrial benzaldehyde dehydrogenase, partial [Genlisea aurea]
Length=512

 Score =   311 bits (798),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAK RA++R VGDPFK G+EQGPQID +QF K+L YIRSG+ESGA LE GG+R G KG
Sbjct  330  LEKAKVRALKRTVGDPFKSGIEQGPQIDQDQFNKILHYIRSGQESGARLETGGERFGEKG  389

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IAQDEIFGPVQ VLKFK++DEVIKRAN T YGLAAGV+T +ID 
Sbjct  390  YYIQPTVFSDVKDDMLIAQDEIFGPVQSVLKFKELDEVIKRANRTRYGLAAGVFTHNIDT  449

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVTP+KNP
Sbjct  450  ANTLTRALRAGTVWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTPIKNP  509

Query  213  AWI  205
            AW+
Sbjct  510  AWL  512



>gb|KCW56066.1| hypothetical protein EUGRSUZ_I01821 [Eucalyptus grandis]
Length=423

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARAM+RVVGDPFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG
Sbjct  241  VEKARARAMKRVVGDPFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKG  300

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DM+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID 
Sbjct  301  FFIQPTVFSNVQDDMLIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDT  360

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LRAG+VWINCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNP
Sbjct  361  ANTLARALRAGSVWINCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNP  420

Query  213  AWI  205
            AW+
Sbjct  421  AWL  423



>ref|XP_010913576.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K++RYI+SG +SGATL+ GGDR+GSKG
Sbjct  361  VEKAKARALKRVVGDPFRKGVEQGPQIDEEQFNKIMRYIKSGVDSGATLQAGGDRLGSKG  420

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPTIFSDVK+ M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D 
Sbjct  421  YFIQPTIFSDVKDGMPIAQEEIFGPVQSILKFSDLNEVIQRANTTRYGLAAGVFTNNLDT  480

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPLKNP
Sbjct  481  ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLKNP  540

Query  213  AWI  205
            AW+
Sbjct  541  AWL  543



>ref|XP_006290873.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
 gb|EOA23771.1| hypothetical protein CARUB_v10016983mg [Capsella rubella]
Length=537

 Score =   311 bits (798),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFKKG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KG
Sbjct  355  VEKSKARALKRVVGDPFKKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK++M+IAQDEIFGPVQ +LKF D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  415  YFIQPTVFSNVKDNMLIAQDEIFGPVQSILKFSDVDEVIKRANDTRYGLAAGVFTKSLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGT+W+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  475  ANRVSRALKAGTIWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  534

Query  213  AWI  205
            AWI
Sbjct  535  AWI  537



>ref|XP_009115500.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Brassica rapa]
Length=536

 Score =   311 bits (797),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKG
Sbjct  354  VEKAKARAIKRAVGDPFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  414  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  474  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>ref|XP_002877590.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53849.1| ALDH2B4 [Arabidopsis lyrata subsp. lyrata]
Length=537

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KG+EQGPQIDS+QFEKV++YIRSG ES ATLECGGD+IG KG
Sbjct  355  VEKSKARALKRVVGDPFRKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T  +D 
Sbjct  415  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETRYGLAAGVFTKSLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQ+KAVVT L  P
Sbjct  475  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLSNYLQIKAVVTALNKP  534

Query  213  AWI  205
            AWI
Sbjct  535  AWI  537



>ref|XP_010426271.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Camelina sativa]
Length=537

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFKKG+EQGPQIDS+QF+KV+ YIRSG ES ATLECGGD+IG KG
Sbjct  355  VEKSKARALKRVVGDPFKKGIEQGPQIDSKQFKKVMNYIRSGVESNATLECGGDQIGDKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK++M+IAQDEIFGPVQ +LKF+D+DEVIKRAN+T YGLAAGV+T  +D 
Sbjct  415  YFIQPTVFSNVKDNMLIAQDEIFGPVQSILKFRDVDEVIKRANDTRYGLAAGVFTKSLDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVWINC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  475  ANRVSRALKAGTVWINCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  534

Query  213  AWI  205
            AWI
Sbjct  535  AWI  537



>ref|XP_010552639.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=533

 Score =   311 bits (796),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF+K+L+YIRSG ESGATL+ GGD++GSKG
Sbjct  351  VEKAKARAIKRAVGDPFKAGIEQGPQVDSEQFQKILKYIRSGIESGATLQAGGDQLGSKG  410

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK++M+IA DEIFGPVQ +LKFKD+DE I+RAN + YGLAAGV+T ++D 
Sbjct  411  YYIQPTVFSDVKDEMLIANDEIFGPVQSILKFKDLDEAIRRANKSRYGLAAGVFTQNLDT  470

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDA++PFGGYKMSG GREKG+YSLNNYLQVKAVVTPL NP
Sbjct  471  ANRLMRALRVGSVWINCFDVFDASVPFGGYKMSGFGREKGIYSLNNYLQVKAVVTPLTNP  530

Query  213  AWI  205
            AW+
Sbjct  531  AWL  533



>gb|AAL99612.1|AF348416_1 mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana]
Length=534

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARALKRNVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            A+ L R LR GTVWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNP
Sbjct  472  AHRLMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_003519638.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
Length=539

 Score =   311 bits (796),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G
Sbjct  357  IEKAKARALKRAVGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ 
Sbjct  417  FYIQPTVFSNVKDDMLIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNP
Sbjct  477  ANTLTRALRAGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_008781996.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Phoenix dactylifera]
Length=543

 Score =   311 bits (797),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID +QF K+LRYI+SG +SGATL+ GGDR+GSKG
Sbjct  361  VEKAKARALKRVVGDPFRKGVEQGPQIDEDQFNKILRYIKSGIDSGATLQAGGDRLGSKG  420

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPTIFSDVK+ M IAQ+EIFGPVQ +LKF D++EVI+RAN T YGLAAGV+T+++D 
Sbjct  421  YFIQPTIFSDVKDGMQIAQEEIFGPVQSILKFSDLNEVIRRANTTRYGLAAGVFTNNLDT  480

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNP
Sbjct  481  ANTLTRALRAGTVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNP  540

Query  213  AWI  205
            AW+
Sbjct  541  AWL  543



>gb|AEV40467.1| mitochondrial aldehyde dehydrogenase [Miscanthus sinensis]
Length=201

 Score =   299 bits (766),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIRSG +SGA L  GGDR+G KG
Sbjct  19   VEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGANLVTGGDRLGDKG  78

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D 
Sbjct  79   YYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDT  138

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVTP+KN 
Sbjct  139  ANTLTRALRVGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTPIKNA  198

Query  213  AWI  205
            AW+
Sbjct  199  AWL  201



>gb|AAC98035.1| Strong similarity to gb|Y09876 aldehyde dehydrogenase (NAD+) 
from Nicotiana tabacum and a member of the aldehyde dehydrogenase 
family PF|00171. ESTs gb|F15117, gb|R83958 and gb|586262 
come from this gene [Arabidopsis thaliana]
Length=519

 Score =   310 bits (795),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  337  VEKAKARALKRNVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKG  396

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  397  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDT  456

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            A+ L R LR GTVWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNP
Sbjct  457  AHRLMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNP  516

Query  213  AWI  205
            AW+
Sbjct  517  AWL  519



>ref|NP_564204.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
 sp|Q8S528.2|AL2B7_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B7, mitochondrial; 
Short=ALDH2b; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59643.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAM44960.1| putative aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AEE30433.1| aldehyde dehydrogenase 2B7 [Arabidopsis thaliana]
Length=534

 Score =   310 bits (795),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARALKRNVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            A+ L R LR GTVWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNP
Sbjct  472  AHRLMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KHN00347.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=539

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G
Sbjct  357  IEKAKARALKRAVGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ 
Sbjct  417  FYIQPTVFSNVKDDMLIAKEEIFGPVQSILKFKDLDDVIQRANNTHYGLAAGVFTKNINT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNP
Sbjct  477  ANTLTRALRAGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_007031425.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
 gb|EOY02351.1| Aldehyde dehydrogenase 2B7 isoform 3 [Theobroma cacao]
Length=414

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+G
Sbjct  232  VEKAKARALKRVVGDPFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRG  291

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ 
Sbjct  292  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLET  351

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+P
Sbjct  352  ANTLTRALRAGTVWINCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHP  411

Query  213  AWI  205
            AW+
Sbjct  412  AWL  414



>gb|AFK40301.1| unknown [Medicago truncatula]
Length=328

 Score =   303 bits (776),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKG
Sbjct  146  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKG  205

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++ M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID 
Sbjct  206  YYIQPTVFSNVQDGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDT  265

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  266  ANTLTRALKVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNP  325

Query  213  AWI  205
            AW+
Sbjct  326  AWL  328



>ref|NP_190383.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
 sp|Q9SU63.1|AL2B4_ARATH RecName: Full=Aldehyde dehydrogenase family 2 member B4, mitochondrial; 
Short=ALDH2a; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG42016.1|AF327426_1 putative (NAD+) aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAK15569.1|AF349522_1 putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAK49627.1|AF372911_1 AT3g48000/T17F15_130 [Arabidopsis thaliana]
 emb|CAB41139.1| aldehyde dehydrogenase (NAD+)-like protein [Arabidopsis thaliana]
 dbj|BAA96792.1| aldehyde dehydrogenase [Arabidopsis thaliana]
 gb|AAL91287.1| AT3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AAM27003.1| aldehyde dehydrogenase ALDH2a [Arabidopsis thaliana]
 gb|AAN31892.1| putative aldehyde dehydrogenase (NAD+) [Arabidopsis thaliana]
 gb|AAP21179.1| At3g48000/T17F15_130 [Arabidopsis thaliana]
 gb|AEE78355.1| aldehyde dehydrogenase 2B4 [Arabidopsis thaliana]
Length=538

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KG+EQGPQID +QFEKV++YI+SG ES ATLECGGD+IG KG
Sbjct  356  VEKSKARALKRVVGDPFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+VK+DM+IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T ++D 
Sbjct  416  YFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN ++R L+AGTVW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  P
Sbjct  476  ANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKP  535

Query  213  AWI  205
            AWI
Sbjct  536  AWI  538



>ref|XP_003517756.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN12100.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=538

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G
Sbjct  356  IEKAKARALKRAVGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+DM+IA++EIFGPVQ +LKFKD+D+VI+RANNTHYGLAAGV+T +I+ 
Sbjct  416  FYIQPTVFSNVKDDMLIAKEEIFGPVQTILKFKDLDDVIQRANNTHYGLAAGVFTKNINT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNP
Sbjct  476  ANTLTRALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTSLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>emb|CDY61548.1| BnaA09g29890D, partial [Brassica napus]
Length=555

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF+K+L++I+ G ESGATL+ GGDR GSKG
Sbjct  373  VEKAKARAIKRAVGDPFKSGIEQGPQVDSEQFKKILKFIKHGVESGATLQAGGDRFGSKG  432

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFK++DEVI RANN+ YGLAAGV+T ++D 
Sbjct  433  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDT  492

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT +KNP
Sbjct  493  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNP  552

Query  213  AWI  205
            AW+
Sbjct  553  AWL  555



>ref|XP_002893307.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69566.1| hypothetical protein ARALYDRAFT_472641 [Arabidopsis lyrata subsp. 
lyrata]
Length=534

 Score =   309 bits (792),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARALKRNVGDPFKSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQAGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            A+ L R LR GTVWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNP
Sbjct  472  AHRLMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGLYSLNNYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_003532011.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Glycine max]
 gb|KHN10599.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   309 bits (792),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V+KAKARA+RRVVGDPFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG
Sbjct  354  VQKAKARALRRVVGDPFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+ M+IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T ++D 
Sbjct  414  FYIQPTVFSNVKDGMLIAKDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTKNMDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNP
Sbjct  474  ANTLTRALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>ref|XP_010029206.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARAM+RVVGDPFK GVEQGPQ+D +QFEK+  YI+SG ESGATLECGG+R GSKG
Sbjct  350  VEKARARAMKRVVGDPFKPGVEQGPQVDIKQFEKIHTYIKSGIESGATLECGGERYGSKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FIQPT+FS+V++DM+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID 
Sbjct  410  FFIQPTVFSNVQDDMLIAKDEIFGPVQTISKFKDLDEVIRRANKSPYGLAAGVFTQNIDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LRAG+VWINCY V DA IPFGGYKMSGIGREKGVYSL+NYLQVKAVV PLKNP
Sbjct  470  ANTLARALRAGSVWINCYHVVDAAIPFGGYKMSGIGREKGVYSLSNYLQVKAVVNPLKNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>ref|XP_006416054.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
 gb|ESQ34407.1| hypothetical protein EUTSA_v10007303mg [Eutrema salsugineum]
Length=541

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+D EQF+K+L+YI+ G +SGATL+ GGD++GSKG
Sbjct  359  VEKAKARAINRTVGDPFKSGIEQGPQVDKEQFKKILKYIKYGVDSGATLQAGGDQLGSKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IAQDEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D 
Sbjct  419  YYIQPTVFSDVKDDMLIAQDEIFGPVQTILKFKDLDEVIARANKSRYGLAAGVFTQNLDT  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDATIPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNP
Sbjct  479  ANRLMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTALKNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>ref|XP_010551563.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Tarenaya hassleriana]
Length=540

 Score =   308 bits (790),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++R VGDPFK G+EQGPQ+DSEQF+K+LRYIRSG E+GATL+ GGD++GSKG
Sbjct  358  VEKSKARAIKRAVGDPFKAGIEQGPQVDSEQFKKILRYIRSGIENGATLQAGGDQLGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK++MVIA++EIFGPVQ +LKFKD++EVI RAN + YGLAAGV+T ++D 
Sbjct  418  YYIQPTVFSDVKDEMVIAKEEIFGPVQSILKFKDLEEVIARANKSCYGLAAGVFTQNLDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDA +PFGGYKMSGIGREKG+YSLNNYLQVKAVVTPL NP
Sbjct  478  ANRLMRALRVGSVWINCFDVFDAAVPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLTNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>ref|XP_009612265.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=536

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G EQGPQIDS+QF K++ YIRSG +SGATLE GG+R+G +G
Sbjct  354  LEKAKARALKRTVGDPFKSGTEQGPQIDSKQFHKIMNYIRSGIDSGATLETGGERLGERG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID 
Sbjct  414  YYIKPTVFSNVKDDMLIAQDEIFGPVQSILKFKDLDDVIRRANNSRYGLAAGVFTQNIDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  474  ANTLTRALRVGTVWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>ref|XP_010100483.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
 gb|EXB82617.1| Aldehyde dehydrogenase family 2 member [Morus notabilis]
Length=537

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V KA ARA++R VGDPFK G+EQGPQID EQF+KVL YI+SG ESGATLE GG+RIGS G
Sbjct  355  VSKATARAIKRTVGDPFKAGIEQGPQIDPEQFDKVLSYIKSGNESGATLETGGNRIGSTG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YF++PT+FS+V +DM IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID 
Sbjct  415  YFVEPTVFSNVTDDMKIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVV PLKNP
Sbjct  475  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVEPLKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>ref|XP_009759823.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nicotiana sylvestris]
Length=542

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +G
Sbjct  360  LEKAKARALKRTVGDPFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID 
Sbjct  420  YYIKPTVFSNVKDDMLIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  480  ANTLTRALRVGTVWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_006307216.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
 gb|EOA40114.1| hypothetical protein CARUB_v10008816mg [Capsella rubella]
Length=532

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G+EQGPQIDSEQF K+L+YI+ G ++GATL+ GGDR GSKG
Sbjct  350  VEKAKARAVKRAVGDPFKSGIEQGPQIDSEQFNKILKYIKHGVDAGATLQAGGDRFGSKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D 
Sbjct  410  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSKYGLAAGVFTQNLDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+DV DATIPFGGYKMSGIGREKG+YSL++YLQVKAVVT LKNP
Sbjct  470  ANRLMRALRVGTVWINCFDVLDATIPFGGYKMSGIGREKGLYSLSHYLQVKAVVTSLKNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>ref|XP_010251301.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=534

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARAM+RVVGDPFKKGVEQGPQID+EQ EKVL+YIR+G E GATLE GG+R G+KG
Sbjct  352  IEKAKARAMKRVVGDPFKKGVEQGPQIDAEQLEKVLKYIRAGIECGATLETGGERFGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V++ M IA DEIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T +I+ 
Sbjct  412  YFIQPTVFSNVEDGMPIATDEIFGPVQSILKFKDLDDVIRRANKSRYGLAAGVFTKNIET  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKNP
Sbjct  472  ANTLMRALRVGTVWINCFDVFDAAIPFGGYKMSGQGREKGIYSLSNYLQVKAVVSPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>emb|CAA71003.1| aldehyde dehydrogenase (NAD+) [Nicotiana tabacum]
Length=542

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++R VGDPFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +G
Sbjct  360  LEKAKARALKRTVGDPFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID 
Sbjct  420  YYIKPTVFSNVKDDMLIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  480  ANTLTRALRVGTVWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_010653335.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial 
[Vitis vinifera]
 emb|CBI32132.3| unnamed protein product [Vitis vinifera]
 gb|AFY12671.1| mitochondrial aldehyde dehydrogenase 2B8 [Vitis quinquangularis]
Length=538

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RR VGDPFK G+EQGPQIDS+QFEK+LRYIRSG E+GATLE GG+R G +G
Sbjct  356  VEKAKARALRRTVGDPFKAGIEQGPQIDSDQFEKILRYIRSGVENGATLETGGERFGKEG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +FI+PT+FS+V++ M+IAQDEIFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T ++D 
Sbjct  416  FFIKPTVFSNVQDGMLIAQDEIFGPVQSILKFKDLGEVIRRANATSYGLAAGVFTQNLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVWINC+DVFDA IPFGGYKMSG GREKG+YSL NYLQVKAV+TPLKNP
Sbjct  476  ANTLTRALKVGTVWINCFDVFDAAIPFGGYKMSGHGREKGIYSLQNYLQVKAVITPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>gb|KJB31274.1| hypothetical protein B456_005G183300 [Gossypium raimondii]
Length=509

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = -1

Query  768  HIRRVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDR  589
            H      + KARA++R VGDPFK GVEQGPQIDSEQFEK+LRYIRSG ESGATL  GGDR
Sbjct  322  HFALFFNQRKARALKRSVGDPFKAGVEQGPQIDSEQFEKILRYIRSGIESGATLITGGDR  381

Query  588  IGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYT  409
            +GSKG++IQPT+F++VKEDM+I+QDEIFGPVQ +LKF+ +DEVI+RAN+T YGLAAGV+T
Sbjct  382  LGSKGFYIQPTVFTNVKEDMLISQDEIFGPVQSILKFRYMDEVIRRANSTRYGLAAGVFT  441

Query  408  SDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT  229
            +D+D ANTL+R L+ GTVWINCYDVFDA IPFGGYKMSG GREKGV+ L+NYLQVKA+V 
Sbjct  442  NDLDTANTLSRALKVGTVWINCYDVFDAAIPFGGYKMSGQGREKGVHCLSNYLQVKAIVA  501

Query  228  PLKNPAWI  205
            PLKNPAWI
Sbjct  502  PLKNPAWI  509



>ref|XP_007031423.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
 gb|EOY02349.1| Aldehyde dehydrogenase 2B4 isoform 1 [Theobroma cacao]
Length=511

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KG+EQGPQID EQF+K+L+YIRSG ESGATLE GG+++GS+G
Sbjct  329  VEKAKARALKRVVGDPFQKGIEQGPQIDDEQFKKILKYIRSGIESGATLESGGEQLGSRG  388

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD+DEVI+RAN T YGLAAGV+T +++ 
Sbjct  389  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLDEVIQRANATSYGLAAGVFTQNLET  448

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINCYD+FDA IPFGG+KMSG GREKG+Y L++YLQVKAVVTPLK+P
Sbjct  449  ANTLTRALRAGTVWINCYDIFDAAIPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKHP  508

Query  213  AWI  205
            AW+
Sbjct  509  AWL  511



>ref|XP_010044646.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW86738.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA  R VGDPFK G+EQGPQIDSEQF+K+LRYIRSG E GATLE GG+R G+KG
Sbjct  362  VEKAKARATVRSVGDPFKSGIEQGPQIDSEQFQKILRYIRSGVEGGATLETGGERFGTKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+DM+IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID 
Sbjct  422  HYIQPTVFSNVKDDMLIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDT  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNP
Sbjct  482  ANTLTRALKVGTVWVNCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>ref|XP_004238676.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Solanum lycopersicum]
Length=529

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KG
Sbjct  347  LEKAKARALKRVVGDPFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKG  406

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID 
Sbjct  407  YYIRPTVFSNVKDDMLIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDT  466

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVWINC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNP
Sbjct  467  ANTLARALRVGTVWINCFDTFDATIPFGGYKMSGQGREKGEYGLKNYLQVKAVVTPLKNP  526

Query  213  AWI  205
            AW+
Sbjct  527  AWL  529



>ref|XP_006355977.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=529

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFK G EQGPQIDS+QF+K+++YIRSG +SGATLE GG++ G KG
Sbjct  347  LEKAKARALKRVVGDPFKSGTEQGPQIDSKQFDKIMKYIRSGVDSGATLETGGEQFGKKG  406

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IAQDEIFGPVQ +LKFKD+DEV++RAN++ YGLAAGV++ +ID 
Sbjct  407  YYIKPTVFSNVKDDMLIAQDEIFGPVQSILKFKDLDEVVRRANSSRYGLAAGVFSQNIDT  466

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVWINC+D FDATIPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNP
Sbjct  467  ANTLARALRVGTVWINCFDTFDATIPFGGYKMSGQGREKGEYGLRNYLQVKAVVTPLKNP  526

Query  213  AWI  205
            AW+
Sbjct  527  AWL  529



>ref|XP_003552014.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Glycine max]
 gb|KHN39739.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=536

 Score =   306 bits (784),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQIDS+QFEK+LRYIRSG ESGATLE GGD++G+KG
Sbjct  354  VEKAKARALKRVVGDPFKGGIEQGPQIDSDQFEKILRYIRSGVESGATLETGGDKLGNKG  413

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+ M+IA+DEIFGPVQ +LKFKD+ EV++RANNT YGLAAGV+T+++D 
Sbjct  414  FYIQPTVFSNVKDGMLIARDEIFGPVQSILKFKDLGEVVQRANNTRYGLAAGVFTTNMDT  473

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            A TL R LR GTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNP
Sbjct  474  AYTLTRALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNPLKNP  533

Query  213  AWI  205
            AW+
Sbjct  534  AWL  536



>gb|KJB11464.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=414

 Score =   302 bits (774),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKG
Sbjct  232  VEKAKARALKRVVGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKG  291

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ 
Sbjct  292  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIET  351

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNP
Sbjct  352  ANTLTRALRVGTVWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNP  411

Query  213  AWI  205
            AW+
Sbjct  412  AWL  414



>gb|KJB11463.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=423

 Score =   302 bits (774),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKG
Sbjct  241  VEKAKARALKRVVGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKG  300

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ 
Sbjct  301  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIET  360

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNP
Sbjct  361  ANTLTRALRVGTVWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNP  420

Query  213  AWI  205
            AW+
Sbjct  421  AWL  423



>ref|XP_007036177.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
 gb|EOY20678.1| Aldehyde dehydrogenase family 2 member B4 [Theobroma cacao]
Length=567

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA+RRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSG ES ATLECGGDR+G KG
Sbjct  358  LEKAKARALRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGIESNATLECGGDRLGKKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FS+V +DM+IA+DEIFGPVQ +LKFKD+DEVI+RAN T YGLAAGV+T +ID 
Sbjct  418  YFIQPTVFSNVTDDMLIAKDEIFGPVQSILKFKDLDEVIRRANATRYGLAAGVFTKNIDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQV  244
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQ+
Sbjct  478  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQI  527



>ref|XP_007157468.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
 gb|ESW29462.1| hypothetical protein PHAVU_002G072100g [Phaseolus vulgaris]
Length=538

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKA+ARA++R VGDPFK G+EQGPQIDSEQF+K+L+YIRSG ESGATLE GGDR G+ G
Sbjct  356  IEKARARALKRAVGDPFKGGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FS+VK+DM+IA++ IFGPVQ +LKFK++DEVI RANNTHYGLAAGV+T +I+ 
Sbjct  416  FYVQPTVFSNVKDDMLIAKETIFGPVQSILKFKELDEVIHRANNTHYGLAAGVFTKNINT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+DVFDA IPFGGYKMSG GREKG YSL NYLQVKAVVT LKNP
Sbjct  476  ANTLTRALKVGTVWVNCFDVFDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTSLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_002301540.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE80813.1| mitochondrial aldehyde dehydrogenase family protein [Populus 
trichocarpa]
Length=540

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA +R VGDPFK+G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ G
Sbjct  358  VEKAKARANQRAVGDPFKEGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDV++DM+IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D 
Sbjct  418  YYIQPTVFSDVQDDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG+YSLNNYLQVKAVVT LKNP
Sbjct  478  ANTLSRALKVGTVWINCYDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTSLKNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>gb|KCW86739.1| hypothetical protein EUGRSUZ_B03349 [Eucalyptus grandis]
Length=544

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA  R VGDPFK G+EQGPQ++SEQF+K+LRYIRSG E GATLE GG+R G+KG
Sbjct  362  VEKAKARATVRSVGDPFKSGIEQGPQVNSEQFQKILRYIRSGVEGGATLETGGERFGTKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+VK+DM+IA+DEIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID 
Sbjct  422  HYIQPTVFSNVKDDMLIAKDEIFGPVQTILKFKDLKEVIQRANNSRYGLAAGVFTQNIDT  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+DVFDA IPFGGYKMSG GREKGVYSL+NYLQVKAVVT LKNP
Sbjct  482  ANTLTRALKVGTVWVNCFDVFDAAIPFGGYKMSGHGREKGVYSLSNYLQVKAVVTSLKNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>ref|XP_010477684.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V KAKARA+ R VGDPFK G+EQGPQ+DSEQF K+L+YI+ G ESGATL+ GGDR+GSKG
Sbjct  352  VAKAKARAVNRSVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVESGATLQAGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RAN + YGLAAGV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANKSMYGLAAGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+D+FDATIPFGGYKMSGIGREK +YSL++YLQVKAVVT LKNP
Sbjct  472  ANRLMRALRVGTVWINCFDLFDATIPFGGYKMSGIGREKSLYSLSHYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_009399660.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=542

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K+L YI+SG +SGATL  GGDRIGSKG
Sbjct  360  VEKAKARALKRVVGDPFRKGVEQGPQIDEEQFSKILHYIKSGVDSGATLVTGGDRIGSKG  419

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDV++ M IA++EIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T +++ 
Sbjct  420  YYIQPTVFSDVEDKMKIAKEEIFGPVQTILKFKDVNEVIQRANTTRYGLAAGVFTHNLNT  479

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT  R LRAGTVWINCYDVFDA IPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNP
Sbjct  480  ANTFMRALRAGTVWINCYDVFDAAIPFGGYKMSGNGREKGIDSLKNYLQVKAVVTPLKNP  539

Query  213  AWI  205
            AW+
Sbjct  540  AWL  542



>ref|XP_011463376.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=531

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA +RVVGDPFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKG
Sbjct  349  VEKAKARAEKRVVGDPFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKG  408

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID 
Sbjct  409  YYIKPTVFSNVKDDMQIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDT  468

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNP
Sbjct  469  ANTLTRALRVGTVWINCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNP  528

Query  213  AWI  205
            AW+
Sbjct  529  AWL  531



>ref|XP_010265814.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Nelumbo nucifera]
Length=539

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+KARAMRR+VGDPFKKGVEQGPQID  QFEK+L  IRSG ESGATLE GG+R G+KG
Sbjct  357  IEKSKARAMRRIVGDPFKKGVEQGPQIDKAQFEKILSCIRSGIESGATLETGGERFGTKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+FSDV++DM IA +EIFGPVQ +LKFKD+D+VI+RAN + YGLAAGV+T++I+ 
Sbjct  417  YFIQPTVFSDVQDDMAIATEEIFGPVQSILKFKDLDDVIQRANKSRYGLAAGVFTNNIET  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCY VFDA IPFGGYKMSG GREKG Y LNNYLQVKAVV+PLKNP
Sbjct  477  ANTLMRSLRVGTVWINCYFVFDAAIPFGGYKMSGKGREKGAYCLNNYLQVKAVVSPLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_008221788.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Prunus mume]
Length=534

 Score =   304 bits (778),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA +R+VGDPFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG
Sbjct  352  IEKAKARAEKRIVGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PT+FS+VK+DM IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID 
Sbjct  412  FYIKPTVFSNVKDDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKAVVTPLKNP
Sbjct  472  ANTLTRALRVGSVWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_004297641.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=535

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA +RVVGDPFK G EQGPQIDS+QFEK+L+YI  G + GATLE GG++ GSKG
Sbjct  353  VEKAKARAEKRVVGDPFKGGTEQGPQIDSDQFEKILKYIDYGIKGGATLETGGEQFGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM IA+DEIFGPVQ VLK+K++DEVIKRANNT YGLAAGV+T +ID 
Sbjct  413  YYIKPTVFSNVKDDMQIAKDEIFGPVQMVLKYKELDEVIKRANNTRYGLAAGVFTQNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDATIP GGYKMSGIGREKG+Y L NYLQVKAVVTPLKNP
Sbjct  473  ANTLTRALRVGTVWINCFDVFDATIPIGGYKMSGIGREKGIYGLQNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>ref|XP_010477682.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+ R VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARAIHRSVGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQTGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+DV DATIPFGGYKMSG GREK +YSL++YLQVKAVVT LKNP
Sbjct  472  ANRLMRALRVGTVWINCFDVLDATIPFGGYKMSGTGREKSLYSLSHYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|AGV54428.1| mitochondrial aldehyde dehydrogenase [Phaseolus vulgaris]
Length=535

 Score =   303 bits (777),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KG
Sbjct  353  VEKAKARALKRVVGDPFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VK+DM IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID 
Sbjct  413  YYIQPTVFSNVKDDMRIATDEIFGPVQSILKFKDLGEVVQRANNSQYGLAAGVFTKNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNP
Sbjct  473  ANILTRALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>gb|EYU22484.1| hypothetical protein MIMGU_mgv1a004342mg [Erythranthe guttata]
Length=532

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAK RA++R VGDPFK G+EQGPQID EQF+K+L+YI+SG ESGATLE GGDR G+KG
Sbjct  350  VEKAKERALKRAVGDPFKAGMEQGPQIDGEQFKKILKYIKSGVESGATLEAGGDRFGTKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VK+DM+IA+DEIFGPVQ VLKFK++ EVI+RANN+ +GLAAGV+T ++D 
Sbjct  410  YYIQPTVFSNVKDDMLIAKDEIFGPVQTVLKFKELGEVIRRANNSPFGLAAGVFTQNLDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LK+P
Sbjct  470  ANTLTRALRAGTVWINCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTALKDP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>emb|CDP00179.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA ARA++R VGDPF++ +EQGPQ+DSEQFEK+LRYIR+G +SGATLE GGDR+G KG
Sbjct  356  VEKATARALKRSVGDPFRQEIEQGPQVDSEQFEKILRYIRAGVDSGATLETGGDRLGEKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+V++DM IA++EIFGPVQ +LK+KD+DEVI+RAN+T YGLAAGV+T ++D 
Sbjct  416  YYIKPTVFSNVQDDMPIAKEEIFGPVQTILKYKDLDEVIRRANSTRYGLAAGVFTQNLDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  476  ANTLMRALRAGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_007153639.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
 gb|ESW25633.1| hypothetical protein PHAVU_003G052500g [Phaseolus vulgaris]
Length=535

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQIDSEQFEK+LRY+R G ESGATLE GGDR+G KG
Sbjct  353  VEKAKARALKRVVGDPFKGGIEQGPQIDSEQFEKILRYVRLGVESGATLETGGDRLGDKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+VK+DM IA DEIFGPVQ +LKFKD+ EV++RANN+ YGLAAGV+T +ID 
Sbjct  413  YYIQPTVFSNVKDDMRIATDEIFGPVQSILKFKDLGEVVQRANNSRYGLAAGVFTKNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVV  LKNP
Sbjct  473  ANILTRALRVGTVWINCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVNSLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>ref|XP_006594290.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Glycine max]
Length=537

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKG
Sbjct  355  VEKAKARALKRVVGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V+++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D 
Sbjct  415  YYIQPTVFSNVQDNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+AGTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNP
Sbjct  475  ANTLMRALQAGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>dbj|BAB92019.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=547

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIRSG +SGA L  GGDR+G KG
Sbjct  365  VEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGANLVTGGDRLGEKG  424

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D 
Sbjct  425  YYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASPYGLAAGVFTNSLDT  484

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVWINC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVTP+KN 
Sbjct  485  ANTLTRALRAGTVWINCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTPIKNA  544

Query  213  AWI  205
            AW+
Sbjct  545  AWL  547



>ref|XP_003542700.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Glycine max]
Length=540

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKG
Sbjct  358  VEKAKARALKRVVGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V+++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D 
Sbjct  418  YYIQPTVFSNVQDNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+AGTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNP
Sbjct  478  ANTLMRALQAGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>gb|KEH19981.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=509

 Score =   302 bits (774),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKG
Sbjct  327  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKG  386

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++ M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID 
Sbjct  387  YYIQPTVFSNVQDGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDT  446

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  447  ANTLTRALKVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNP  506

Query  213  AWI  205
            AW+
Sbjct  507  AWL  509



>ref|XP_010271955.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Nelumbo nucifera]
Length=534

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RRVVGDPF+KGVEQGPQID++QF K+L YIRSG E+GATLE GG+R+GSKG
Sbjct  352  VEKAKARALRRVVGDPFEKGVEQGPQIDADQFVKILNYIRSGTENGATLETGGERLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+V+++M+IA DEIFGPVQ +LKFKDI+EVI+R+N + +GLAAGV+T++++ 
Sbjct  412  YFIRPTVFSNVEDNMLIATDEIFGPVQSILKFKDINEVIRRSNKSRFGLAAGVFTNNLET  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVV+PLKN 
Sbjct  472  ANTLMRALRVGTVWINCFDVFDAAIPFGGYKMSGNGREKGIYSLDNYLQVKAVVSPLKNA  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KJB11461.1| hypothetical protein B456_001G261100 [Gossypium raimondii]
Length=530

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKG
Sbjct  348  VEKAKARALKRVVGDPFKTGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKG  407

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ 
Sbjct  408  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIET  467

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNP
Sbjct  468  ANTLTRALRVGTVWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNP  527

Query  213  AWI  205
            AW+
Sbjct  528  AWL  530



>gb|KCW56067.1| hypothetical protein EUGRSUZ_I01824, partial [Eucalyptus grandis]
Length=511

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARAM+RVVGDPFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG
Sbjct  329  VEKARARAMKRVVGDPFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKG  388

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V+++M+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID 
Sbjct  389  FFVQPTVFSNVQDNMLIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDT  448

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR L+AG+V INCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNP
Sbjct  449  ANTLARALQAGSVCINCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNP  508

Query  213  AWI  205
            AW+
Sbjct  509  AWL  511



>gb|AFK40600.1| unknown [Medicago truncatula]
Length=392

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKG
Sbjct  210  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKG  269

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++ M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YG AAGV+  +ID 
Sbjct  270  YYIQPTVFSNVQDGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGFAAGVFPKNIDT  329

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+D FDA IPFGGYKMSG GRE+G YSL NYLQVKAVVTPLKNP
Sbjct  330  ANTLTRALKVGTVWVNCFDTFDAAIPFGGYKMSGQGRERGEYSLKNYLQVKAVVTPLKNP  389

Query  213  AWI  205
            AW+
Sbjct  390  AWL  392



>ref|XP_007221800.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
 gb|EMJ22999.1| hypothetical protein PRUPE_ppa004036mg [Prunus persica]
Length=534

 Score =   302 bits (774),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKA+ARA +R+VGDPFK GVEQGPQIDS+QFEK+LRYI  G +SGATLE GG R+G+KG
Sbjct  352  IEKARARAEKRIVGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PT+FS+VK+DM IAQDEIFGPVQ +LK+KD+DEVI+RAN T YGLAAGV+T +ID 
Sbjct  412  FYIKPTVFSNVKDDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+Y L+NYLQVKA+VTPLKNP
Sbjct  472  ANTLTRALRVGSVWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAIVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KEH19980.1| NAD-dependent aldehyde dehydrogenase family protein [Medicago 
truncatula]
Length=541

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YIRSG E+GATLE GG+R+GSKG
Sbjct  359  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIRSGVENGATLETGGERLGSKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++ M IA++EIFGPVQ +LKFKD+ EVI+RANN+ YGLAAGV+T +ID 
Sbjct  419  YYIQPTVFSNVQDGMQIAKEEIFGPVQTILKFKDLGEVIQRANNSKYGLAAGVFTKNIDT  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ GTVW+NC+D FDA IPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNP
Sbjct  479  ANTLTRALKVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>gb|KHG06517.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Gossypium 
arboreum]
Length=531

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G+EQGPQID+EQF+K+L+YIRSG ESGATLE GG++ GSKG
Sbjct  349  VEKAKARALKRVVGDPFKMGIEQGPQIDNEQFKKILKYIRSGIESGATLESGGEQFGSKG  408

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM+IA+DEIFGPVQ + KFKD++EV++RAN + YGLAAGV+T +I+ 
Sbjct  409  YYIQPTVFSNVQDDMLIAKDEIFGPVQSISKFKDLEEVVQRANASSYGLAAGVFTQNIET  468

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCYD+FDA +PFGG+KMSG GREKG+Y L++YLQVKAVVTPLKNP
Sbjct  469  ANTLTRALRVGTVWINCYDIFDAAVPFGGFKMSGQGREKGIYGLSSYLQVKAVVTPLKNP  528

Query  213  AWI  205
            AW+
Sbjct  529  AWL  531



>ref|XP_010029207.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Eucalyptus grandis]
Length=532

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARAM+RVVGDPFK GVEQGPQID +QFEK+  YI+SG ESGATLECGG++ GSKG
Sbjct  350  VEKARARAMKRVVGDPFKPGVEQGPQIDIKQFEKIRTYIKSGIESGATLECGGEQYGSKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +F+QPT+FS+V+++M+IA+DEIFGPVQ + KFKD+DEVI+RAN + YGLAAGV+T +ID 
Sbjct  410  FFVQPTVFSNVQDNMLIAKDEIFGPVQTISKFKDLDEVIRRANKSRYGLAAGVFTQNIDT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR L+AG+V INCY VFDA IPFGGYKMSGIGREKGVY LNNYLQVKAVV PLKNP
Sbjct  470  ANTLARALQAGSVCINCYHVFDAAIPFGGYKMSGIGREKGVYGLNNYLQVKAVVNPLKNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>emb|CBI32134.3| unnamed protein product [Vitis vinifera]
Length=571

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK G EQGPQIDSE+FEK+LRYIRSG ++GATLE GG+R G+ G
Sbjct  389  VEKAKARALKRVVGDPFKAGTEQGPQIDSEKFEKILRYIRSGVDNGATLETGGERFGTGG  448

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFI+PT+FS+V++DM+ AQDEIFGPVQ +LKFKD+DEVI+RAN ++ GLAAGV+T +ID 
Sbjct  449  YFIKPTVFSNVQDDMLKAQDEIFGPVQSILKFKDLDEVIRRANASNCGLAAGVFTQNIDT  508

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+DVFDA IPFGGYKMSG GREKG+Y L NYLQVKAVV+PLKNP
Sbjct  509  ANTLTRALRVGTVWINCFDVFDAAIPFGGYKMSGNGREKGIYCLQNYLQVKAVVSPLKNP  568

Query  213  AWI  205
            AW+
Sbjct  569  AWL  571


 Score =   101 bits (251),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 60/74 (81%), Gaps = 1/74 (1%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA+RR VGDPFK G+EQGPQIDS+QFEK++RYIRSG ESGATLE GG+R G + 
Sbjct  84   VEKAKARALRRTVGDPFKAGIEQGPQIDSKQFEKIMRYIRSGVESGATLESGGERFGKER  143

Query  573  YFIQPTIFSDVKED  532
              +    F+D+ ED
Sbjct  144  SRVMWR-FADLLED  156


 Score = 26.9 bits (58),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 13/18 (72%), Gaps = 0/18 (0%)
 Frame = -2

Query  791  SRTYVHERIYDEL*RKQR  738
            SRT+VHE +YDE   K +
Sbjct  71   SRTFVHESVYDEFVEKAK  88



>dbj|BAB62757.1| mitochondrial aldehyde dehydrogenase ALDH2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ90704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KG
Sbjct  367  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++DM IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D 
Sbjct  427  YYIQPTIFSDVQDDMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGT+W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNP
Sbjct  487  ANTLTRALRAGTIWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNP  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>dbj|BAB92018.1| mitochondrial aldehyde dehydrogenase [Sorghum bicolor]
Length=551

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+ GVEQGPQID +QF K+LRY++SG +SGATL  GGDR+GS+G
Sbjct  369  VEKSKARALKRVVGDPFRNGVEQGPQIDGDQFNKILRYVQSGVDSGATLVTGGDRVGSRG  428

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K+DM IA++EIFGPVQ +LKF  ++EVI+RAN THYGLAAGV+T  +D 
Sbjct  429  FYIQPTVFADAKDDMKIAREEIFGPVQTILKFSGMEEVIRRANATHYGLAAGVFTRSLDA  488

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDATIPFGGYKMSG+GREKGVY+L NYLQ KAVVTP+K+P
Sbjct  489  ANTLSRALRAGTVWVNCYDVFDATIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIKDP  548

Query  213  AWI  205
            AW+
Sbjct  549  AWL  551



>ref|XP_004297642.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=535

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA ARA +RVVGDPFK G+EQGPQIDS+QFEK+L+YI  G + GATLE GG+R GSKG
Sbjct  353  VEKATARAEKRVVGDPFKGGIEQGPQIDSDQFEKILKYIDYGIKGGATLETGGERFGSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM IA+DEIFGPVQ VLK+K++DEVIKRANN+ YGLAAGV+T +ID 
Sbjct  413  YYIKPTVFSNVKDDMQIAKDEIFGPVQTVLKYKELDEVIKRANNSRYGLAAGVFTQNIDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA+IPFGGYKMSG GREKG+Y L NYLQVKAVVTPLKNP
Sbjct  473  ANTLTRALRVGSVWINCFDVFDASIPFGGYKMSGNGREKGIYGLQNYLQVKAVVTPLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>gb|ABK24267.1| unknown [Picea sitchensis]
Length=544

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKAR + RVVGDPF+KGVEQGPQID EQF K+LRYI++GKESGA L  GGD+IG+KG
Sbjct  362  VEKAKARCLSRVVGDPFRKGVEQGPQIDQEQFNKILRYIKAGKESGAKLVTGGDQIGTKG  421

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I PTIFS+V++DM IA DEIFGPVQ ++KFK +DEVIKRAN + YGLAAGV+T +I+ 
Sbjct  422  FYIMPTIFSEVQDDMAIATDEIFGPVQSIIKFKTLDEVIKRANASRYGLAAGVFTQNIET  481

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D+FDA IPFGGYKMSG GREKG+YSL NYLQVKAVVTPLKNP
Sbjct  482  ANTLTRALRVGTVWVNCFDIFDAGIPFGGYKMSGTGREKGIYSLQNYLQVKAVVTPLKNP  541

Query  213  AWI  205
            AW+
Sbjct  542  AWL  544



>gb|KDO82491.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=328

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  144  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  203

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  204  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  263

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  264  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  323

Query  219  NPAWI  205
            NPAW+
Sbjct  324  NPAWL  328



>ref|XP_011003158.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Populus euphratica]
Length=540

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ G
Sbjct  358  VEKAKARAIQRTVGDPFREGIEQGPQVDSDQFEKILRLIRSGVESGANLKAGGDRFGTTG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDV++DM+IA++EIFGPVQ + KFKD+DEVI+R+NN+ YGLAAG++T ++D 
Sbjct  418  YYIQPTVFSDVQDDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGLAAGIFTHNLDT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R L+ GTVWINCYDVFDA IPFGGYKMSG GREKG+YSL+NYLQVKAVVT L NP
Sbjct  478  ANTLSRALKVGTVWINCYDVFDAGIPFGGYKMSGNGREKGIYSLSNYLQVKAVVTSLNNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>ref|NP_001105891.1| mitochondrial aldehyde dehydrogenase 2 [Zea mays]
 gb|AAG43988.1|AF215823_1 T cytoplasm male sterility restorer factor 2 [Zea mays]
 gb|AAC49371.1| RF2 [Zea mays]
 gb|ACG38026.1| aldehyde dehydrogenase [Zea mays]
 gb|ACN28554.1| unknown [Zea mays]
 gb|AFW86312.1| restorer of fertility2 [Zea mays]
Length=549

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D 
Sbjct  427  FYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSGIGREKGV SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGVDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>ref|XP_002274863.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Vitis vinifera]
 emb|CBI34947.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKG
Sbjct  353  IEKAKARALKRVVGDPFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKG  412

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V ++M+IA++EIFGPVQ +LKFKD+DEVI+RAN THYGLAAG++T ++D 
Sbjct  413  YYIQPTVFSNVHDNMLIAKEEIFGPVQSILKFKDLDEVIRRANATHYGLAAGIFTQNLDT  472

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPLKNP
Sbjct  473  ANTLTRALRVGTVWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNP  532

Query  213  AWI  205
            AW+
Sbjct  533  AWL  535



>ref|XP_011071082.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Sesamum indicum]
Length=525

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V KAK RAM+R VGDPFK G+EQGPQID+EQF K+L+YI+ GKE GATLE GGDR G+KG
Sbjct  343  VAKAKERAMKRSVGDPFKTGMEQGPQIDAEQFNKILKYIKYGKECGATLETGGDRFGTKG  402

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+V++DM IA+DEIFGPVQ VLKFKD +EVI+RANN+ YGLAAG++T D+D 
Sbjct  403  YYIQPTVFSNVQDDMPIAKDEIFGPVQTVLKFKDNEEVIRRANNSPYGLAAGIFTQDLDT  462

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+D FDA IPFGGYKMSGIGREKG YSL NYLQVKAVVT LKNP
Sbjct  463  ANTLTRALRVGTVWVNCFDTFDAAIPFGGYKMSGIGREKGEYSLKNYLQVKAVVTSLKNP  522

Query  213  AWI  205
            AW+
Sbjct  523  AWL  525



>ref|XP_006356663.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum tuberosum]
Length=537

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPF+ G EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++G
Sbjct  355  VEKAKARALKRTVGDPFESGNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTRG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID 
Sbjct  415  YYIKPTVFSNVKDDMLIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT  R LR GT+WINC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNP
Sbjct  475  ANTFMRALRVGTIWINCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>gb|AAK58370.1|AF269064_1 T-cytoplasm male sterility restorer factor 2 [Zea mays]
Length=549

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF+K+LRYIR G + GATL  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIRYGVDGGATLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D 
Sbjct  427  FYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGYKMSG+GREKGV SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYKMSGMGREKGVDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>gb|EMS51754.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Triticum 
urartu]
Length=550

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KG
Sbjct  368  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D 
Sbjct  428  YYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDT  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNP
Sbjct  488  ANTLTRALRAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>gb|AHM26656.1| aldehyde dehydrogenase 2-1 [Zea mays subsp. mays]
Length=549

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D 
Sbjct  427  FYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+DVFDA IPFGGY+MSGIGREKGV SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRAGTVWVNCFDVFDAAIPFGGYRMSGIGREKGVDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>gb|EMT04899.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=549

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KG
Sbjct  367  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D 
Sbjct  427  YYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNP
Sbjct  487  ANTLTRALRAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNP  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>dbj|BAB92017.1| mitochondrial aldehyde dehydrogenase [Secale cereale]
Length=549

 Score =   299 bits (766),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KG
Sbjct  367  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D 
Sbjct  427  YYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGT+W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNP
Sbjct  487  ANTLTRALRAGTIWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNP  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>ref|XP_006844236.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
 gb|ERN05911.1| hypothetical protein AMTR_s00006p00268060 [Amborella trichopoda]
Length=501

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARAM+RVVGDPFKKGVEQGPQID EQF K++ YI+SG +SGATLE GG+RIG+KG
Sbjct  319  LEKAKARAMKRVVGDPFKKGVEQGPQIDLEQFNKIMGYIKSGVDSGATLELGGERIGTKG  378

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFS+ K+ M IA DEIFGPVQ V KFKD++EVI+RAN + YGLAAGV+T +ID 
Sbjct  379  YYIQPTIFSNTKDSMPIATDEIFGPVQTVFKFKDLNEVIQRANASRYGLAAGVFTKNIDT  438

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LR GTVW+NC+DVFDA IPFGGYKMSG+GREKG+ SL+NYLQVKAVV  L+NP
Sbjct  439  ANTLSRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIQSLSNYLQVKAVVQHLRNP  498

Query  213  AWI  205
            AW+
Sbjct  499  AWL  501



>gb|KDO82489.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82490.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=378

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  194  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  253

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  254  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  313

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  314  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  373

Query  219  NPAWI  205
            NPAW+
Sbjct  374  NPAWL  378



>ref|NP_001105576.1| aldehyde dehydrogenase2 [Zea mays]
 gb|AAL99613.1|AF348417_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
Length=550

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G
Sbjct  368  VEKSKARALKRVVGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  428  FYIQPTVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDA  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNP
Sbjct  488  ANTLSRALRAGTVWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>ref|XP_004509835.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=538

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG
Sbjct  356  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+V++D +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID 
Sbjct  416  FYIQPTVFSNVQDDHLIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ G+VW+NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNP
Sbjct  476  ANTLTRALKVGSVWVNCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_004509834.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=539

 Score =   298 bits (764),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPFK G EQGPQIDS+QFEK+L+YI+SG E+GATLE GG+R+GSKG
Sbjct  357  VEKAKARALKRAVGDPFKSGTEQGPQIDSKQFEKILKYIKSGVENGATLETGGERLGSKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+FS+V++D +IA++EIFGPVQ +LKFKD+ EVI+RANNT YGLAAG++T +ID 
Sbjct  417  FYIQPTVFSNVQDDHLIAKEEIFGPVQSILKFKDLGEVIQRANNTEYGLAAGIFTKNIDT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+ G+VW+NC+D+ DA IPFGGYKMSG GREKG YSL NYLQVKAVV PLKNP
Sbjct  477  ANTLTRALKVGSVWVNCFDILDAAIPFGGYKMSGHGREKGEYSLKNYLQVKAVVIPLKNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>gb|ACG32898.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G
Sbjct  368  VEKSKARALKRVVGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGERG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  428  FYIQPTVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDA  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNP
Sbjct  488  ANTLSRALRAGTVWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>emb|CBI16844.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 162/197 (82%), Gaps = 5/197 (3%)
 Frame = -1

Query  780  CS*THIRR-----VVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESG  616
            CS T +        VEKAK RA+RR +G+PFK G+EQGPQIDS+QFEK+LRYIRSG E+ 
Sbjct  192  CSRTFVHESIYDEFVEKAKTRALRRTIGNPFKAGIEQGPQIDSDQFEKILRYIRSGVENA  251

Query  615  ATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTH  436
             TLE GG+R G++G+FI+PT+FS+V++ M+IAQDEIFGPVQ +LKFKD+DEVI+RAN   
Sbjct  252  GTLETGGERFGNEGFFIKPTVFSNVQDGMLIAQDEIFGPVQSILKFKDLDEVIRRANAAS  311

Query  435  YGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNN  256
            YGLAAGV+T ++D  NTL R LR GTVW+NC+DVFDA IPFGGY MSG GREKG+YSL N
Sbjct  312  YGLAAGVFTQNLDTTNTLTRALRVGTVWVNCFDVFDAAIPFGGYTMSGHGREKGMYSLQN  371

Query  255  YLQVKAVVTPLKNPAWI  205
            YLQVKAV+  LKNPAW+
Sbjct  372  YLQVKAVIASLKNPAWL  388



>ref|XP_006647839.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=551

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPF++GVEQGPQID EQF+K+LRY++SG ESGATL  GGDR GS+G
Sbjct  369  VEKAKARALQRVVGDPFRRGVEQGPQIDGEQFKKILRYVKSGVESGATLVAGGDRAGSRG  428

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV+++M IAQDEIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D 
Sbjct  429  FYIQPTVFADVEDEMTIAQDEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTRRLDA  488

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVVTP+K+ 
Sbjct  489  ANTLARALRVGTVWVNCYDVFDAAIPFGGYKMSGVGREKGFYSLRNYLQTKAVVTPVKDA  548

Query  213  AWI  205
            AW+
Sbjct  549  AWL  551



>gb|AAL99614.2|AF348418_1 mitochondrial aldehyde dehydrogenase RF2B [Zea mays]
 gb|AFW63789.1| aldehyde dehydrogenase [Zea mays]
Length=550

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G
Sbjct  368  VEKSKARALKRVVGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  428  FYIQPTVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDA  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNP
Sbjct  488  ANTLSRALRAGTVWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>ref|XP_004245256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Solanum lycopersicum]
Length=534

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPF    EQGPQI SEQFEKVL+YIRSG ESGATLE GGDR+G++G
Sbjct  352  VEKAKARALKRTVGDPFDSSNEQGPQISSEQFEKVLKYIRSGIESGATLETGGDRLGTQG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+VK+DM+IA DEIFGPVQ +LKFKD DEVI+RAN T YGLAAGV+T +ID 
Sbjct  412  YYIKPTVFSNVKDDMLIATDEIFGPVQSILKFKDHDEVIRRANATKYGLAAGVFTKNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT  R LR GT+WINC+D+FDA IPFGGYKMSG GREKG YSL  YLQVKAVVT LKNP
Sbjct  472  ANTFMRALRVGTIWINCFDIFDAAIPFGGYKMSGQGREKGEYSLKQYLQVKAVVTSLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KDO82486.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82487.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
 gb|KDO82488.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=423

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  239  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  298

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  299  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  358

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  359  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  418

Query  219  NPAWI  205
            NPAW+
Sbjct  419  NPAWL  423



>ref|XP_006656871.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Oryza brachyantha]
Length=549

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARAM+RVVGDPFK GVEQGPQID +QF K+LRYI+ G ESGA L  GGDR+G KG
Sbjct  367  VEKAKARAMKRVVGDPFKNGVEQGPQIDDDQFNKILRYIKYGVESGANLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDVK++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ 
Sbjct  427  YYIQPTIFSDVKDNMKIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTPLKN 
Sbjct  487  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPLKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>ref|XP_004965205.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Setaria italica]
Length=549

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF K+LRYIRSG +SGATL  GGDR+G KG
Sbjct  367  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGATLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPTIFSDV++ M IAQ+EIFGPVQ +LKFKD++EVI+RAN + YGLAAGV+T  +D 
Sbjct  427  FYIQPTIFSDVQDGMKIAQEEIFGPVQSILKFKDLNEVIERANASQYGLAAGVFTKSLDT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYK SGIGREKGV SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRVGTVWVNCFDVFDAGIPFGGYKQSGIGREKGVDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>gb|KHN47185.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Glycine 
soja]
Length=538

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 163/183 (89%), Gaps = 2/183 (1%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQIDS QFEK+++YIRSG ESGA LE GG RIGSKG
Sbjct  358  VEKAKARALKRVVGDPFKNGVEQGPQIDSVQFEKIMKYIRSGVESGAQLESGGQRIGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FS+  ++M+IA+DEIFGPVQ +LKFKD++EVI+RAN T YGLAAGV+T ++D 
Sbjct  418  YYIQPTVFSN--DNMLIAKDEIFGPVQSILKFKDLEEVIRRANATSYGLAAGVFTKNMDT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R L+AGTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKAVVT LKNP
Sbjct  476  ANTLMRALQAGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKAVVTALKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>gb|AHM26657.1| aldehyde dehydrogenase 2-2 [Zea mays subsp. mays]
Length=550

 Score =   296 bits (759),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G
Sbjct  368  VEKSKARALKRVVGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRG  427

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQP +F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  428  FYIQPMVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDA  487

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNP
Sbjct  488  ANTLSRALRAGTVWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNP  547

Query  213  AWI  205
            AW+
Sbjct  548  AWL  550



>ref|XP_008389628.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Malus domestica]
Length=534

 Score =   295 bits (756),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAK RA RR+VGDPFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG
Sbjct  352  LEKAKGRAERRLVGDPFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PT+FSDVK+DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID 
Sbjct  412  FYIKPTVFSDVKDDMRIASEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+V+INC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNP
Sbjct  472  ANTLTRALRVGSVFINCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|KDO82484.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=493

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  309  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  368

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  369  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  428

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  429  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  488

Query  219  NPAWI  205
            NPAW+
Sbjct  489  NPAWL  493



>ref|XP_004139235.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=538

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ RA  RVVGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKG
Sbjct  356  VEKARNRAANRVVGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y++QPT+FS+VK+DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ 
Sbjct  416  YYVQPTVFSNVKDDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NP
Sbjct  476  ANRLTRSLRVGSVWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>gb|KHN23562.1| Aldehyde dehydrogenase family 2 member B7, mitochondrial [Glycine 
soja]
Length=510

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 164/191 (86%), Gaps = 8/191 (4%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQIDS QFEK+++YIRSG E+GATLE GG RIGSKG
Sbjct  320  VEKAKARALKRVVGDPFKNGVEQGPQIDSAQFEKIMKYIRSGVENGATLESGGQRIGSKG  379

Query  573  YFIQPTIFSDVK--------EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAG  418
            Y+IQPT+FS+V+        ++M+IA+DEI GPVQ +LKFKD++EVI+RAN T YGLA+G
Sbjct  380  YYIQPTVFSNVQARYLQLTMDNMLIAKDEILGPVQSILKFKDLEEVIRRANATSYGLASG  439

Query  417  VYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKA  238
            V+T ++D ANTL R LR GTVWINCYDVFDA IPFGGYKMSG GR +G+YSL +YLQVKA
Sbjct  440  VFTQNMDTANTLMRALRVGTVWINCYDVFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKA  499

Query  237  VVTPLKNPAWI  205
            VVT LKNPAW+
Sbjct  500  VVTALKNPAWL  510



>ref|XP_004156463.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
[Cucumis sativus]
Length=540

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ RA  RVVGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKG
Sbjct  358  VEKARNRAANRVVGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y++QPT+FS+VK+DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ 
Sbjct  418  YYVQPTVFSNVKDDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINT  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NP
Sbjct  478  ANRLTRSLRVGSVWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>ref|XP_010498885.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Camelina sativa]
Length=534

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA  R VGDPFK G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARAANRAVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVEAGATLQTGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNP
Sbjct  472  ANRLMRALRVGTVWINCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_003563967.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Brachypodium distachyon]
Length=548

 Score =   294 bits (752),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQID EQF K+LRYI+SG +SGATL  GGD++G KG
Sbjct  366  VEKSKARALKRVVGDPFRKGVEQGPQIDDEQFNKILRYIKSGVDSGATLVTGGDKLGDKG  425

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV++ M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++  
Sbjct  426  YYIQPTIFSDVQDGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASRYGLAAGVFTNNLGT  485

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LRAGTVW+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQ KAVVTP+KN 
Sbjct  486  ANTLTRALRAGTVWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQTKAVVTPIKNA  545

Query  213  AWI  205
            AW+
Sbjct  546  AWL  548



>ref|XP_009363532.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+KARA RR+VGDPFK G+EQGPQIDS+QFEK+L+YI  G ++GA LE GG+R+G+KG
Sbjct  352  LEKSKARAERRLVGDPFKGGIEQGPQIDSDQFEKILKYIDYGVKAGAKLETGGERVGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PT+FSDV++DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID 
Sbjct  412  FYIKPTVFSDVQDDMRIACEEIFGPVQTILKYKDLNEVIQRANNSRYGLAAGVFTQNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+V+INC+DVFDA+IPFGGYKMSGIGREKG+Y L+NYLQVKAVVTPLKNP
Sbjct  472  ANTLTRALRVGSVFINCFDVFDASIPFGGYKMSGIGREKGIYGLSNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>gb|AAF73828.1|AF162665_1 aldehyde dehydrogenase [Oryza sativa]
Length=549

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV+++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ 
Sbjct  427  YYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>ref|NP_001057358.1| Os06g0270900 [Oryza sativa Japonica Group]
 dbj|BAB19052.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAD54414.1| aldehyde dehydrogenase ALDH2b [Oryza sativa Japonica Group]
 dbj|BAF19272.1| Os06g0270900 [Oryza sativa Japonica Group]
 gb|EAZ36586.1| hypothetical protein OsJ_20928 [Oryza sativa Japonica Group]
 dbj|BAG93278.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94020.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99957.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AJB98432.1| aldehyde dehydrogenase, partial [Oryza sativa]
Length=549

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV+++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ 
Sbjct  427  YYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>gb|EAZ00462.1| hypothetical protein OsI_22484 [Oryza sativa Indica Group]
Length=549

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++RVVGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KG
Sbjct  367  VEKAKARALKRVVGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKG  426

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDV+++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ 
Sbjct  427  YYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNT  486

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN 
Sbjct  487  ANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNA  546

Query  213  AWI  205
            AW+
Sbjct  547  AWL  549



>gb|KGN60807.1| hypothetical protein Csa_2G010420 [Cucumis sativus]
Length=592

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ RA  RVVGDPF  G+EQGPQ+D+EQF+K+L+YI+ G E GATLE GGDR GSKG
Sbjct  410  VEKARNRAANRVVGDPFLGGIEQGPQVDAEQFKKILKYIKYGIEGGATLEAGGDRFGSKG  469

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y++QPT+FS+VK+DM IA+DEIFGPVQ +LK+KDIDEVI+RAN + YGLAAGV+T +I+ 
Sbjct  470  YYVQPTVFSNVKDDMKIAEDEIFGPVQTILKYKDIDEVIRRANASRYGLAAGVFTQNINT  529

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+DVFDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NP
Sbjct  530  ANRLTRSLRVGSVWINCFDVFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENP  589

Query  213  AWI  205
            AW+
Sbjct  590  AWL  592



>ref|XP_006438422.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
 ref|XP_006483828.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Citrus sinensis]
 gb|ESR51662.1| hypothetical protein CICLE_v10031155mg [Citrus clementina]
Length=546

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  362  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  421

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  422  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  481

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  482  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  541

Query  219  NPAWI  205
            NPAW+
Sbjct  542  NPAWL  546



>gb|KDO82485.1| hypothetical protein CISIN_1g009035mg [Citrus sinensis]
Length=546

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -1

Query  759  RVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS  580
            + VEKA A AM+RVVGDPFK G++QGPQIDSEQFEK+L+YIRSG + GA LE GG+R+G+
Sbjct  362  QFVEKANALAMKRVVGDPFKGGIQQGPQIDSEQFEKILKYIRSGVDGGAKLETGGERLGA  421

Query  579  KGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDI  400
            KGY+I+PT+F+ VK+DM+IA+DEIFGPVQ +LK+KD+DEVI+R+N + YGLAAGV+T ++
Sbjct  422  KGYYIKPTVFTGVKDDMLIAKDEIFGPVQSILKYKDLDEVIQRSNASQYGLAAGVFTHNL  481

Query  399  DKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK  220
            D ANTL R LR G+VWINC+DVFDA IPFGGYK SG GREKG YSL+NYLQVKAVVT LK
Sbjct  482  DTANTLMRALRVGSVWINCFDVFDAAIPFGGYKQSGQGREKGSYSLSNYLQVKAVVTALK  541

Query  219  NPAWI  205
            NPAW+
Sbjct  542  NPAWL  546



>ref|XP_004953799.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X2 [Setaria italica]
Length=548

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA +RVVGDPF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G
Sbjct  366  VEKSKARAQKRVVGDPFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRG  425

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  426  FYIQPTVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDA  485

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N 
Sbjct  486  ANTLSRALRAGTVWVNCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNA  545

Query  213  AWI  205
            AW+
Sbjct  546  AWL  548



>dbj|BAJ85552.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA RRVVGDPFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GGDR+GS+G
Sbjct  241  VEKSKARAQRRVVGDPFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGDRLGSRG  300

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+F+DV+++M IA++EIFGP+Q +LKF+D+ EV++RAN T YGLAAGV+T  +D 
Sbjct  301  FYVQPTVFADVEDEMKIAKEEIFGPIQSILKFRDVGEVVRRANPTQYGLAAGVFTGSLDT  360

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN +AR LR GTVW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAVV PL++P
Sbjct  361  ANAVARALRVGTVWVNCYDVFDAAIPFGGYKMSGVGREKGPYSLGNYLQTKAVVAPLRDP  420

Query  213  AWI  205
            AW+
Sbjct  421  AWL  423



>ref|XP_002970420.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
 gb|EFJ28550.1| hypothetical protein SELMODRAFT_231526 [Selaginella moellendorffii]
Length=488

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KG
Sbjct  306  IEKAKARALKRVVGDPFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGARIGNKG  365

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDVK+DM I++DEIFGPVQ V KF+ + E I+RANN+ YGLAAGV+T DID 
Sbjct  366  YYIQPTIFSDVKDDMAISRDEIFGPVQAVTKFRTVQEAIERANNSPYGLAAGVFTKDIDT  425

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT +R LR G+VWINCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPLKNP
Sbjct  426  ANTFSRALRVGSVWINCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLKNP  485

Query  213  AWI  205
            AW+
Sbjct  486  AWL  488



>ref|XP_010460154.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial 
[Camelina sativa]
Length=534

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA  R VGDPF  G+EQGPQ+DSEQF+K+L+YI+ G E+GATL+ GGDR+GSKG
Sbjct  352  VEKAKARAANRAVGDPFNSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQTGGDRLGSKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDVK+DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLA+GV+T ++D 
Sbjct  412  YYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR GTVWINC+DV DATIPFGGYKMSGIGREKG+YSL+NYLQVKAVVT LKNP
Sbjct  472  ANRLMRALRVGTVWINCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_002978501.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
 gb|EFJ20487.1| hypothetical protein SELMODRAFT_233128 [Selaginella moellendorffii]
Length=497

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFK GVEQGPQ+D  QFEK+L YI  G+  GA L  GG RIG+KG
Sbjct  315  IEKAKARALKRVVGDPFKSGVEQGPQVDKAQFEKILSYIDVGRHEGANLVTGGTRIGNKG  374

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIFSDVK+DM I++DEIFGPVQ V KF+ + E I+RANNT YGLAAGV+T DID 
Sbjct  375  YYIQPTIFSDVKDDMAISRDEIFGPVQAVTKFRTVQEAIERANNTTYGLAAGVFTKDIDT  434

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANT +R LR G+VWINCYDVFDA IPFGGYKMSG GREKG Y L+NY QVKAVVTPL+NP
Sbjct  435  ANTFSRALRVGSVWINCYDVFDAAIPFGGYKMSGQGREKGEYVLHNYTQVKAVVTPLRNP  494

Query  213  AWI  205
            AW+
Sbjct  495  AWL  497



>ref|XP_008793866.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=538

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPFK GVEQGPQ+D +QF+K++ YI+SG +SGATL  GGDRIG KG
Sbjct  356  VEKSKARALKRVVGDPFKNGVEQGPQVDEKQFKKIMHYIKSGIDSGATLVAGGDRIGDKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FSDVK++M IA+++IFGPVQ +LKFKD+ EVI+RAN T YGLAAGV+T+D++ 
Sbjct  416  FYVQPTVFSDVKDEMAIAREDIFGPVQSILKFKDLHEVIQRANATEYGLAAGVFTNDMNT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW NC+ VFDATIPFGGYKMSG GREKG+ SL NYLQVKAVVT LKNP
Sbjct  476  ANTLMRALRVGTVWFNCFHVFDATIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTSLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_004953798.1| PREDICTED: aldehyde dehydrogenase family 2 member B4, mitochondrial-like 
isoform X1 [Setaria italica]
Length=555

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA +RVVGDPF+ GVEQGPQID EQF+K+LRY++SG +SGATL  GGDR GS+G
Sbjct  373  VEKSKARAQKRVVGDPFRNGVEQGPQIDEEQFKKILRYVQSGVDSGATLVAGGDRAGSRG  432

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+D K++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D 
Sbjct  433  FYIQPTVFADAKDEMKIAREEIFGPVQTILKFSGVEEVIRRANATQYGLAAGVFTRSLDA  492

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL+R LRAGTVW+NCYDVFDA IPFGGYKMSG+GREKGVY+L NYLQ KAVVTP++N 
Sbjct  493  ANTLSRALRAGTVWVNCYDVFDAGIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIRNA  552

Query  213  AWI  205
            AW+
Sbjct  553  AWL  555



>dbj|BAD15920.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16359.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAG99615.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARA++RVVGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G
Sbjct  239  VEKARARALQRVVGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRG  298

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV+++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D 
Sbjct  299  FYIQPTVFADVEDEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDA  358

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ 
Sbjct  359  ANTLARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDA  418

Query  213  AWI  205
            AW+
Sbjct  419  AWL  421



>ref|XP_009391259.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KG
Sbjct  350  IEKAKARAIKRVVGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKG  409

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIF+DV++ M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  
Sbjct  410  YYIQPTIFTDVQDGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHT  469

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NP
Sbjct  470  ANTLMRALRVGSVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNP  529

Query  213  AWI  205
            AW+
Sbjct  530  AWL  532



>ref|XP_009391258.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KG
Sbjct  352  IEKAKARAIKRVVGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIF+DV++ M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  
Sbjct  412  YYIQPTIFTDVQDGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NP
Sbjct  472  ANTLMRALRVGSVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_009391257.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=539

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KG
Sbjct  357  IEKAKARAIKRVVGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKG  416

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIF+DV++ M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  
Sbjct  417  YYIQPTIFTDVQDGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHT  476

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NP
Sbjct  477  ANTLMRALRVGSVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNP  536

Query  213  AWI  205
            AW+
Sbjct  537  AWL  539



>ref|XP_009391256.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPF KGVEQGPQID EQF K+L YI+SG E GATL  GG R G+KG
Sbjct  359  IEKAKARAIKRVVGDPFIKGVEQGPQIDEEQFSKILHYIKSGVEDGATLVTGGTRAGTKG  418

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPTIF+DV++ M IAQ+EIFGPVQ +LKFKD++EVI+R+N T YGLAAGV+T+++  
Sbjct  419  YYIQPTIFTDVQDGMKIAQEEIFGPVQSILKFKDLNEVIQRSNKTRYGLAAGVFTNNLHT  478

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+VWINC+DVFDA IPFGGYKMSG GREKG+ SL NYLQ+KAVVTPL NP
Sbjct  479  ANTLMRALRVGSVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLNNP  538

Query  213  AWI  205
            AW+
Sbjct  539  AWL  541



>ref|XP_008456004.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Cucumis melo]
Length=537

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKA+ RA  RVVGDPF  G+EQGPQ+D EQF+K+L+YI+ G E GATLE GG+R GSKG
Sbjct  355  LEKARNRAANRVVGDPFLGGIEQGPQVDGEQFKKILKYIKYGIEGGATLEAGGERFGSKG  414

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y++QPT+FS+VK+DM IAQ+EIFGPVQ +LK+KD+DEVI+RAN + YGLAAGV+T +I+ 
Sbjct  415  YYVQPTVFSNVKDDMKIAQEEIFGPVQTILKYKDMDEVIRRANASRYGLAAGVFTQNINT  474

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L R LR G+VWINC+D+FDA +PFGGYKMSG GREKG+YSL+NYLQVKAVVTPL+NP
Sbjct  475  ANRLTRSLRVGSVWINCFDIFDAAVPFGGYKMSGHGREKGIYSLSNYLQVKAVVTPLENP  534

Query  213  AWI  205
            AW+
Sbjct  535  AWL  537



>gb|EEC73936.1| hypothetical protein OsI_08800 [Oryza sativa Indica Group]
Length=553

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARA++RVVGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G
Sbjct  371  VEKARARALQRVVGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRG  430

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV+++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D 
Sbjct  431  FYIQPTVFADVEDEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDA  490

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ 
Sbjct  491  ANTLARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDA  550

Query  213  AWI  205
            AW+
Sbjct  551  AWL  553



>ref|NP_001048010.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAA96793.1| mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa Japonica 
Group]
 dbj|BAD15919.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAD16358.1| putative mitochondrial aldehyde dehydrogenase ALDH2a [Oryza sativa 
Japonica Group]
 dbj|BAF09924.1| Os02g0730000 [Oryza sativa Japonica Group]
 dbj|BAH00573.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57740.1| hypothetical protein OsJ_08254 [Oryza sativa Japonica Group]
Length=553

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKA+ARA++RVVGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G
Sbjct  371  VEKARARALQRVVGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRG  430

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV+++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D 
Sbjct  431  FYIQPTVFADVEDEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDA  490

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTLAR LR GTVW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ 
Sbjct  491  ANTLARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDA  550

Query  213  AWI  205
            AW+
Sbjct  551  AWL  553



>ref|XP_010928601.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=543

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R+VGDPF++GVEQGPQID +QF K+L YI+SG +SGATL  GGDR+GSKG
Sbjct  361  VEKAKARALKRIVGDPFRQGVEQGPQIDEDQFRKILGYIKSGTDSGATLIAGGDRLGSKG  420

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+F+DVK++M IA++EIFGPVQ +LKF D++EVI+RAN +HYGLAAG++++++D 
Sbjct  421  YFIQPTVFADVKDEMKIAREEIFGPVQSILKFSDLNEVIRRANASHYGLAAGIFSNNMDT  480

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
             NTL R LRAG+V++NC+DVFDA IPFGGYKMSG GR+KG+ SL NY Q+KAVVT LKNP
Sbjct  481  VNTLMRALRAGSVFVNCFDVFDAAIPFGGYKMSGHGRDKGMDSLKNYSQIKAVVTALKNP  540

Query  213  AWI  205
            AW+
Sbjct  541  AWL  543



>ref|XP_010928603.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Elaeis guineensis]
Length=538

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KA A++R+VGDPFK GV+QGPQ+D +Q  K++ YI SG  SGATL  GG+RIG+KG
Sbjct  356  VEKSKAHALKRIVGDPFKNGVQQGPQVDEKQLNKIMHYIESGINSGATLVAGGNRIGNKG  415

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            +++QPT+FSDVK++M IA+++IFGPVQ +LKFKD+DE+I+RAN T YGLAAGV+T++++ 
Sbjct  416  FYVQPTVFSDVKDEMAIAREDIFGPVQSILKFKDLDEIIRRANATEYGLAAGVFTNNMNT  475

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVW NC+ VFD TIPFGGYKMSG GREKG+ SL NYLQVKAVVTPLKNP
Sbjct  476  ANTLMRALRVGTVWFNCFHVFDPTIPFGGYKMSGQGREKGIDSLKNYLQVKAVVTPLKNP  535

Query  213  AWI  205
            AW+
Sbjct  536  AWL  538



>ref|XP_008793883.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Phoenix dactylifera]
Length=540

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R+VGDPFK GVEQGPQID +QF+K+L YI+SG +SGATL  GGDR GSKG
Sbjct  358  VEKAKARALKRIVGDPFKHGVEQGPQIDEKQFDKILGYIKSGIDSGATLIAGGDRFGSKG  417

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            YFIQPT+F+DVK+ M IAQ+EIFGPVQ +LKF DI+EVI+RAN T YGLAAGV+++++D 
Sbjct  418  YFIQPTVFADVKDGMKIAQNEIFGPVQSILKFSDINEVIRRANATPYGLAAGVFSNNMDA  477

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
             +TL R LR G+V++NC++V DA IPFGGYKMSG GR+KGV+SL NYLQ KAVVT LKNP
Sbjct  478  VSTLMRALRVGSVFVNCFNVLDAAIPFGGYKMSGHGRDKGVHSLQNYLQTKAVVTALKNP  537

Query  213  AWI  205
            AW+
Sbjct  538  AWL  540



>ref|XP_009363534.1| PREDICTED: aldehyde dehydrogenase family 2 member B7, mitochondrial-like 
[Pyrus x bretschneideri]
Length=534

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EK+KARA RR+VGDPFK G+EQGPQIDS QFEK+L+YI  G ++GA LE GG+R+G+KG
Sbjct  352  LEKSKARAERRLVGDPFKGGIEQGPQIDSVQFEKILKYIDYGVKAGAKLETGGERVGTKG  411

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PT+FSDV++DM IA +EIFGPVQ +LK+KD++EVI+RANN+ YGLAAGV+T +ID 
Sbjct  412  FYIKPTVFSDVQDDMSIACEEIFGPVQTILKYKDLNEVIRRANNSRYGLAAGVFTQNIDT  471

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR G+V+INCY VFDA+IPFGGYKMS  GREKG+  L+NYLQVKAVVTPLKNP
Sbjct  472  ANTLTRALRVGSVFINCYYVFDASIPFGGYKMSCCGREKGISGLSNYLQVKAVVTPLKNP  531

Query  213  AWI  205
            AW+
Sbjct  532  AWL  534



>ref|XP_001785650.1| predicted protein [Physcomitrella patens]
 gb|EDQ49530.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA++RVVGDPF+KGVEQGPQ+D +QF KVL Y+ SG E GA L  GG R+GSKG
Sbjct  348  VEKSKARALKRVVGDPFRKGVEQGPQVDKDQFHKVLGYVESGMEQGANLITGGGRLGSKG  407

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PTIF+DVKE M I  +EIFGPVQ + KFK +DEV++RANNT YGLAAG+++++I+ 
Sbjct  408  YYIKPTIFTDVKEGMKIFDEEIFGPVQSIAKFKTLDEVVQRANNTVYGLAAGIFSNNINT  467

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
             NTL+R LRAGT+W+NC+DVFDATIPFGGYK SGIGREKG Y L +Y QVKAVVTPL NP
Sbjct  468  VNTLSRALRAGTIWVNCFDVFDATIPFGGYKQSGIGREKGKYVLESYTQVKAVVTPLHNP  527

Query  213  AWI  205
            AW+
Sbjct  528  AWL  530



>gb|ABU96176.1| aldehyde dehydrogenase [Populus tremula x Populus alba]
Length=357

 Score =   272 bits (696),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAKARA++R VGDPF++G+EQGPQ+DS+QFEK+LR IRSG ESGA L+ GGDR G+ G
Sbjct  189  VEKAKARAIQRTVGDPFREGIEQGPQVDSDQFEKILRIIRSGVESGANLKAGGDRFGTTG  248

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+IQPT+FSDV++DM++A++EIFGPVQ + KFKD+DEVI+R+N+T YGLAAG++T ++D 
Sbjct  249  YYIQPTVFSDVQDDMLVAKEEIFGPVQSIFKFKDLDEVIQRSNSTRYGLAAGIFTHNLDT  308

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQ  247
            ANTL+R L+ GTVWINCYDVFDA IPFGG KMSG GREKG+YSL NYLQ
Sbjct  309  ANTLSRALKVGTVWINCYDVFDAAIPFGGSKMSGNGREKGIYSLRNYLQ  357



>gb|ADK98279.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98285.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10227.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10228.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10233.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10234.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   261 bits (666),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID EQF+K+L+YI SG ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPEQFQKILKYINSGIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10252.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   260 bits (664),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA+VT LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIVTLLKNPAWL  157



>gb|ADK98278.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98286.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98290.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98293.1| aldehyde dehydrogenase, partial [Schiedea adamantis]
 gb|ADW10207.1| putative aldehyde dehydrogenase, partial [Schiedea adamantis]
 gb|ADW10208.1| putative aldehyde dehydrogenase, partial [Schiedea adamantis]
 gb|ADW10216.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10230.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10235.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10236.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10237.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10239.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10241.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10242.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10243.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10251.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10253.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10254.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10258.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98289.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   258 bits (660),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID  QF+K+L+YI SG ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPXQFQKILKYINSGIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10232.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10238.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   258 bits (659),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID EQF+K+L+YI S  ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPEQFQKILKYINSXIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98288.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA+ T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIXTLLKNPAWL  157



>ref|XP_002961352.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
 gb|EFJ38891.1| hypothetical protein SELMODRAFT_266598 [Selaginella moellendorffii]
Length=491

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAK +A  RV+GDPF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG
Sbjct  309  VEKAKKKAENRVLGDPFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKG  368

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV + M I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D 
Sbjct  369  FYIQPTVFADVGDSMAISRDEIFGPVQCISKFKTLEEVVERANNTQYGLAAGVFTQSLDT  428

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L+R L+ GTVW+N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNP
Sbjct  429  ANFLSRALKVGTVWVNTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNP  488

Query  213  AWI  205
            AW+
Sbjct  489  AWL  491



>gb|ADK98275.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   258 bits (658),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DMVIA+DEIFGPV
Sbjct  1    IDPDQFQKILKYIBSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMVIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|EMT22926.1| Aldehyde dehydrogenase family 2 member B4, mitochondrial [Aegilops 
tauschii]
Length=678

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 152/173 (88%), Gaps = 0/173 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEK+KARA RRVVGDPFKKGVEQGPQID +QF+K+L Y++SG +SGATL  GG+R+GS+G
Sbjct  363  VEKSKARAQRRVVGDPFKKGVEQGPQIDGQQFKKILGYVKSGVDSGATLVTGGERVGSRG  422

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV+++M IAQ+EIFGP+Q +LKF+++ EV++RAN T YGLAAGV+T  +D 
Sbjct  423  FYIQPTVFADVEDEMKIAQEEIFGPIQSILKFREVGEVVRRANATQYGLAAGVFTRSLDT  482

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV  235
            AN +AR LR GTVW+NCYDVFDA IPFGGYKMSG+GREKG YSL NYLQ KAV
Sbjct  483  ANAVARALRVGTVWVNCYDVFDAAIPFGGYKMSGVGREKGAYSLGNYLQTKAV  535



>gb|ADK98272.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98273.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98282.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98283.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98287.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98291.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10212.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10217.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10218.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10219.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10220.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10221.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10225.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10229.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10244.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10247.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10248.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10249.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10250.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10255.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10256.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10257.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   257 bits (656),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10240.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID EQF+K+L+YI S  ESGA LE GGD+IG+ GY+I+PT+FSDVK++M+IA+DEIFGPV
Sbjct  1    IDPEQFQKILKYINSDIESGAKLETGGDKIGNTGYYIKPTVFSDVKDEMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98280.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98281.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADK98292.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10231.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGXKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98270.1| aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10211.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10213.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
 gb|ADW10215.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV+ RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVHRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98276.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLXNYLQVKAIITLLKNPAWL  157



>ref|XP_002983210.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
 gb|EFJ15552.1| hypothetical protein SELMODRAFT_234195 [Selaginella moellendorffii]
Length=483

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V+KAK +A  RV+GDPF+ GVE GPQ+D  QF KV++YI  GKE GATL  GG+R G KG
Sbjct  301  VDKAKKKAENRVLGDPFQSGVEHGPQVDISQFNKVMKYIGYGKEQGATLLTGGERHGDKG  360

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++IQPT+F+DV + M I++DEIFGPVQC+ KFK ++EV++RANNT YGLAAGV+T  +D 
Sbjct  361  FYIQPTVFADVGDSMAISRDEIFGPVQCISKFKTLEEVVERANNTPYGLAAGVFTQSLDT  420

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN L+R L+ GTVW+N Y  FDA IPFGGYKMSG GREKG Y L NYLQVKAVVTPLKNP
Sbjct  421  ANFLSRALKVGTVWVNTYYAFDAAIPFGGYKMSGFGREKGEYVLKNYLQVKAVVTPLKNP  480

Query  213  AWI  205
            AW+
Sbjct  481  AWL  483



>gb|ADK98284.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (654),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID  QF+K+L+YI S  ESGA LE GGD+IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPXQFQKILKYINSXIESGAKLETGGDKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10223.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DMVIA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMVIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+  +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYXSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98269.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV+ RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVXRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10209.1| putative aldehyde dehydrogenase, partial [Schiedea membranacea]
 gb|ADW10210.1| putative aldehyde dehydrogenase, partial [Schiedea membranacea]
Length=157

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GGD+IG+ GY+++PT+FS+V +DM+IA DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGVESGAKLETGGDKIGNSGYYVKPTVFSNVTDDMLIATDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q +LK+K +DEVI RANNT YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTILKYKSMDEVIGRANNTAYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVY L+NYLQVKA+VT LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYGLSNYLQVKAIVTLLKNPAWL  157



>gb|ADK98271.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGXKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV+ RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVXRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADW10226.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLINYLQVKAIITLLKNPAWL  157



>gb|ADW10224.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   255 bits (651),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI SG ESGA LE GG +IG+ GY+I+PT+FSDVK+DMVIA+DEIFGPV
Sbjct  1    IDPDQFQKILKYIDSGIESGAKLETGGHKIGNTGYYIKPTVFSDVKDDMVIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+  +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYXSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98277.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID  QF+K+L+YI S  ESGA LE GGD+IG+ GY+I+PT+FSDVK+ M+IA+DEIFGPV
Sbjct  1    IDPXQFQKILKYINSXIESGAKLETGGDKIGNTGYYIKPTVFSDVKDXMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>emb|CAN80790.1| hypothetical protein VITISV_020547 [Vitis vinifera]
Length=480

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 149/186 (80%), Gaps = 12/186 (6%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            +EKAKARA++RVVGDPFKKGVEQGPQIDS+QF K+L YI+SG E+GATLE GG++  SKG
Sbjct  304  IEKAKARALKRVVGDPFKKGVEQGPQIDSQQFNKILGYIKSGIEAGATLEAGGEKFSSKG  363

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKF---KDIDEVIKRANNTHYGLAAGVYTSD  403
            Y+IQPT+FS+V          IF P      F   +D+DEVI+RAN THYGLAAG++T +
Sbjct  364  YYIQPTVFSNV---------HIFPPFTXFYAFTNNRDLDEVIRRANATHYGLAAGIFTQN  414

Query  402  IDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  223
            +D ANTL R LR GTVWINC+ VFDA IPFGG KMSG GREKG+Y L+NY+QVKAVVTPL
Sbjct  415  LDTANTLTRALRVGTVWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPL  474

Query  222  KNPAWI  205
            KNPAW+
Sbjct  475  KNPAWL  480



>gb|ADW10222.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   253 bits (645),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI S  ESGA LE GG +IG+ GY+I+PT+FSDVK++M+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSDIESGAKLETGGHKIGNTGYYIKPTVFSDVKDEMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>gb|ADK98274.1| aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   252 bits (643),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            ID +QF+K+L+YI S  ESGA LE GG +IG+ GY+I+PT+FSDVK+ M+IA+DEIFGPV
Sbjct  1    IDPDQFQKILKYINSXIESGAKLETGGHKIGNTGYYIKPTVFSDVKDXMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>ref|XP_007151102.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
 gb|ESW23096.1| hypothetical protein PHAVU_004G018000g [Phaseolus vulgaris]
Length=522

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 7/183 (4%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            VEKAK RA++RVVGDPFK GVEQGPQID  QF+K+L+YIRSG ESGATLE GG R+GSKG
Sbjct  347  VEKAKTRAIKRVVGDPFKSGVEQGPQIDFTQFKKILKYIRSGIESGATLESGGQRVGSKG  406

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            Y+I+PT+FS+V       Q   F  +  +   KD++EVI+RAN T YGLAAGVYT +ID 
Sbjct  407  YYIEPTVFSNV-------QAWHFQLIMVLFLNKDLEEVIRRANATSYGLAAGVYTRNIDT  459

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            ANTL R LR GTVWINCYD+FDA IPFGGYKMSG GR +G+YSL +YLQVKA VT LKNP
Sbjct  460  ANTLMRALRVGTVWINCYDIFDAAIPFGGYKMSGQGRVRGIYSLRSYLQVKACVTALKNP  519

Query  213  AWI  205
            AW+
Sbjct  520  AWL  522



>gb|ADW10246.1| putative aldehyde dehydrogenase, partial [Schiedea globosa]
Length=157

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  675  IDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPV  496
            I  +QF+K+L+Y  SG  SGA LE GG   G+ GY+I+PT+FSDVK+DM+IA+DEIFGPV
Sbjct  1    IXPDQFQKILKYXNSGIXSGAKLETGGXXXGNTGYYIKPTVFSDVKDDMLIAKDEIFGPV  60

Query  495  QCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIP  316
            Q + K+K +DEV++RAN+T+YGL AGV+T +IDKANTLAR LRAG+VWINCYDVFDA IP
Sbjct  61   QTIFKYKSMDEVVRRANDTNYGLGAGVFTQNIDKANTLARALRAGSVWINCYDVFDAAIP  120

Query  315  FGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI  205
            FGGYKMSGIGREKGVYSL+NYLQVKA++T LKNPAW+
Sbjct  121  FGGYKMSGIGREKGVYSLSNYLQVKAIITLLKNPAWL  157



>ref|XP_007160345.1| hypothetical protein PHAVU_002G314000g [Phaseolus vulgaris]
 gb|ESW32339.1| hypothetical protein PHAVU_002G314000g [Phaseolus vulgaris]
Length=501

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 145/186 (78%), Gaps = 4/186 (2%)
 Frame = -1

Query  762  RRVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG  583
            +++VEKAKA     VVGDPF   V+QGPQ+D EQFEK+L YI  GK  GATL  GG  +G
Sbjct  320  KKLVEKAKAW----VVGDPFDPKVQQGPQVDKEQFEKILSYIEHGKREGATLLTGGKTVG  375

Query  582  SKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSD  403
            +KGYFI+PTIFSD+KEDM+IAQDEIFGPV  + KFK IDE IK ANNT YGLAAG+ T +
Sbjct  376  NKGYFIEPTIFSDIKEDMLIAQDEIFGPVMALKKFKTIDEAIKSANNTKYGLAAGIVTKN  435

Query  402  IDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  223
            +D ANTL+R +RAGTVWINCY  F   +PFGGYKMSG G++ G+ +L+ YLQVK+VVTPL
Sbjct  436  LDTANTLSRSIRAGTVWINCYLAFGDDVPFGGYKMSGFGKDHGLEALHKYLQVKSVVTPL  495

Query  222  KNPAWI  205
             N  W+
Sbjct  496  YNSPWL  501



>ref|XP_003525266.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine 
max]
Length=502

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = -1

Query  762  RRVVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG  583
            +++VEKAKA     VVGDPF   V+QGPQ+D EQFEKVL YI  GK+ GATL  GG  +G
Sbjct  321  KKLVEKAKAW----VVGDPFDPKVQQGPQVDKEQFEKVLSYIEHGKKEGATLLTGGKTVG  376

Query  582  SKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSD  403
            +KGYFI+PTIFS+++EDM+IAQDEIFGPV  + KFK I+E IK ANNT YGLAAG+ T +
Sbjct  377  NKGYFIEPTIFSNIREDMLIAQDEIFGPVMALKKFKTIEEAIKSANNTKYGLAAGIVTKN  436

Query  402  IDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL  223
            +D ANT++R +RAGT+WINCY  F   +PFGGYKMSG G++ G+ +L+ YLQVK+VVTPL
Sbjct  437  LDTANTVSRSIRAGTIWINCYFAFGDDVPFGGYKMSGFGKDHGLEALHKYLQVKSVVTPL  496

Query  222  KNPAWI  205
             N  W+
Sbjct  497  YNSPWL  502



>gb|ABR16485.1| unknown [Picea sitchensis]
Length=500

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -1

Query  753  VEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG  574
            V+KA ARA ++VVGDPF+ GV+ GPQID  QFEK+L+YI+ GK  GA L  GG+ +G+KG
Sbjct  318  VKKAVARAKQQVVGDPFQPGVQHGPQIDKMQFEKILKYIQYGKRDGANLVLGGNSLGNKG  377

Query  573  YFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDK  394
            ++I+PTIFSDV++DM IA++EIFGP+  +LKFK I+EVI+R N T YGL AG+ T DID 
Sbjct  378  FYIEPTIFSDVEDDMQIAKEEIFGPIMSILKFKTIEEVIERGNKTIYGLGAGIITKDIDI  437

Query  393  ANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP  214
            AN LAR LR GTVWINCY V  A +P GGYKMSGIGRE G Y L NYLQVK V++PL++ 
Sbjct  438  ANRLARSLRVGTVWINCYLVVGADVPLGGYKMSGIGREYGSYGLTNYLQVKCVISPLQHS  497

Query  213  AWI  205
             W+
Sbjct  498  PWL  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385