BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013B15

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABM53874.1|  IAA6                                                    239   7e-76   Cestrum elegans
emb|CBI26357.3|  unnamed protein product                                241   2e-75   Vitis vinifera
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          241   2e-75   Vitis vinifera
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      239   5e-75   Nicotiana tomentosiformis
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     240   6e-75   Cucumis melo [Oriental melon]
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     240   7e-75   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            237   1e-74   
emb|CDO99148.1|  unnamed protein product                                239   1e-74   Coffea canephora [robusta coffee]
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          239   1e-74   Sesamum indicum [beniseed]
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         237   5e-74   Jatropha curcas
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    237   8e-74   Populus euphratica
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     236   9e-74   Tarenaya hassleriana [spider flower]
ref|XP_002311658.1|  aux/IAA family protein                             237   1e-73   Populus trichocarpa [western balsam poplar]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          236   1e-73   Nicotiana tomentosiformis
gb|AFZ78617.1|  hypothetical protein                                    236   2e-73   Populus tomentosa [Chinese white poplar]
ref|XP_002315736.1|  aux/IAA family protein                             237   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    236   3e-73   Populus euphratica
ref|NP_001266070.1|  IAA14                                              235   3e-73   Solanum lycopersicum
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     234   3e-73   Nicotiana sylvestris
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             235   4e-73   Phaseolus vulgaris [French bean]
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     234   1e-72   Solanum tuberosum [potatoes]
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             234   1e-72   
gb|AFK37379.1|  unknown                                                 233   2e-72   Medicago truncatula
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          233   3e-72   Prunus mume [ume]
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     233   3e-72   Nicotiana sylvestris
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             233   3e-72   Medicago truncatula
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    233   5e-72   Populus euphratica
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   232   8e-72   
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             231   9e-72   Citrus clementina [clementine]
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                230   1e-71   Solanum tuberosum [potatoes]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                231   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     231   2e-71   Fragaria vesca subsp. vesca
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    231   2e-71   Populus euphratica
emb|CAC84710.1|  aux/IAA protein                                        231   3e-71   Populus tremula x Populus tremuloides
gb|KHN05057.1|  Auxin-responsive protein IAA14                          229   5e-71   Glycine soja [wild soybean]
ref|NP_001266039.1|  IAA7 protein                                       229   6e-71   Solanum lycopersicum
gb|KJB28413.1|  hypothetical protein B456_005G046500                    229   8e-71   Gossypium raimondii
gb|ADJ68049.1|  auxin responsive protein                                229   8e-71   Catharanthus roseus [chatas]
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    229   9e-71   Cucumis sativus [cucumbers]
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                229   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     228   1e-70   Cucumis melo [Oriental melon]
gb|AFK44393.1|  unknown                                                 228   1e-70   Lotus japonicus
ref|NP_001240213.1|  auxin-induced protein ali50                        228   2e-70   Glycine max [soybeans]
gb|AFS44507.1|  auxin repressor                                         228   2e-70   Fragaria x ananassa
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    228   2e-70   Gossypium arboreum [tree cotton]
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          228   3e-70   Sesamum indicum [beniseed]
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          227   3e-70   Tarenaya hassleriana [spider flower]
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    227   3e-70   Arabis alpina [alpine rockcress]
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     229   7e-70   
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    227   7e-70   Gossypium arboreum [tree cotton]
gb|AEE25653.1|  auxin-responsive protein                                227   7e-70   Gossypium hirsutum [American cotton]
gb|KJB38280.1|  hypothetical protein B456_006G246000                    227   8e-70   Gossypium raimondii
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          226   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     226   1e-69   Eucalyptus grandis [rose gum]
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     226   1e-69   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    226   2e-69   Cicer arietinum [garbanzo]
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               225   2e-69   Arabis alpina [alpine rockcress]
gb|KJB38278.1|  hypothetical protein B456_006G246000                    227   2e-69   Gossypium raimondii
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      225   3e-69   Malus prunifolia
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     225   3e-69   Populus euphratica
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      224   4e-69   Camelina sativa [gold-of-pleasure]
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           224   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           224   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          224   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      224   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     224   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             224   6e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             224   6e-69   Capsella rubella
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     224   7e-69   Nelumbo nucifera [Indian lotus]
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             224   8e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             225   8e-69   
gb|KJB82525.1|  hypothetical protein B456_013G200700                    224   8e-69   Gossypium raimondii
gb|AEE25654.1|  auxin-responsive protein                                224   9e-69   Gossypium hirsutum [American cotton]
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             224   9e-69   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             224   1e-68   Populus trichocarpa [western balsam poplar]
ref|NP_188945.1|  auxin-responsive protein IAA7                         224   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     224   1e-68   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                223   1e-68   Malus domestica [apple tree]
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     223   2e-68   Morus notabilis
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               223   3e-68   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    223   3e-68   Gossypium arboreum [tree cotton]
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         223   3e-68   Jatropha curcas
gb|AAC49055.1|  IAA14                                                   219   5e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CDY10694.1|  BnaA05g16680D                                          219   5e-68   Brassica napus [oilseed rape]
emb|CDY10349.1|  BnaC05g29300D                                          222   6e-68   Brassica napus [oilseed rape]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     221   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      221   7e-68   Brassica rapa
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           222   8e-68   Ricinus communis
ref|NP_001288823.1|  auxin-responsive protein IAA7                      221   9e-68   Brassica rapa
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     221   1e-67   Nelumbo nucifera [Indian lotus]
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       221   1e-67   Solanum tuberosum [potatoes]
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     222   1e-67   
emb|CBI35213.3|  unnamed protein product                                218   1e-67   Vitis vinifera
ref|NP_193191.2|  auxin-responsive protein IAA14                        220   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     221   2e-67   Populus euphratica
emb|CDY47148.1|  BnaA08g05350D                                          220   2e-67   Brassica napus [oilseed rape]
ref|NP_001280973.1|  auxin-responsive protein IAA16                     221   2e-67   Malus domestica [apple tree]
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          220   2e-67   Brassica rapa
ref|NP_001266049.1|  IAA9 protein                                       221   2e-67   Solanum lycopersicum
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       220   3e-67   Populus tremula x Populus tremuloides
ref|NP_001268036.1|  uncharacterized protein LOC100250231               220   3e-67   Vitis vinifera
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             220   4e-67   Citrus clementina [clementine]
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     219   4e-67   Nicotiana tabacum [American tobacco]
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   219   4e-67   Citrus sinensis [apfelsine]
gb|AAM96891.1|  auxin-responsive protein IAA1                           218   5e-67   Mirabilis jalapa
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             219   5e-67   Populus trichocarpa [western balsam poplar]
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             219   6e-67   
emb|CDY62130.1|  BnaC08g47390D                                          219   7e-67   Brassica napus [oilseed rape]
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      219   7e-67   Nicotiana tabacum [American tobacco]
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             221   9e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    218   9e-67   Arabis alpina [alpine rockcress]
gb|ACL81167.1|  auxin-responsive protein IAA1                           219   1e-66   Mirabilis jalapa
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          218   1e-66   Nicotiana sylvestris
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     219   1e-66   Eucalyptus grandis [rose gum]
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             218   1e-66   Eutrema salsugineum [saltwater cress]
dbj|BAJ34138.1|  unnamed protein product                                218   1e-66   Eutrema halophilum
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          218   1e-66   Nicotiana tomentosiformis
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          218   1e-66   Tarenaya hassleriana [spider flower]
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                218   2e-66   Erythranthe guttata [common monkey flower]
gb|ADL70670.1|  indole-3-acetic acid inducible 16                       215   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ABH01143.1|  auxin-regulated protein                                 218   2e-66   Populus tomentosa [Chinese white poplar]
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      219   2e-66   
gb|ADL70680.1|  indole-3-acetic acid inducible 16                       214   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93631.2|  indole-3-acetic acid inducible 16                       214   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70678.1|  indole-3-acetic acid inducible 16                       214   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        217   4e-66   Fragaria vesca subsp. vesca
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          216   4e-66   Camelina sativa [gold-of-pleasure]
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       214   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       214   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187124.1|  auxin-responsive protein IAA16                        216   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       214   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     217   5e-66   Cicer arietinum [garbanzo]
ref|NP_001288939.1|  auxin-responsive protein IAA16                     216   6e-66   Brassica rapa
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16          216   8e-66   Fragaria vesca subsp. vesca
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     216   1e-65   Camelina sativa [gold-of-pleasure]
gb|EPS64756.1|  hypothetical protein M569_10024                         215   1e-65   Genlisea aurea
gb|KJB42200.1|  hypothetical protein B456_007G141900                    216   1e-65   Gossypium raimondii
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     216   1e-65   Vitis vinifera
gb|ABM53872.1|  IAA4                                                    212   2e-65   Cestrum elegans
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             217   2e-65   
gb|KJB44871.1|  hypothetical protein B456_007G276900                    212   2e-65   Gossypium raimondii
emb|CAN63268.1|  hypothetical protein VITISV_013635                     215   2e-65   Vitis vinifera
emb|CDY50750.1|  BnaAnng10570D                                          216   2e-65   Brassica napus [oilseed rape]
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          215   4e-65   Prunus mume [ume]
ref|NP_001241599.1|  uncharacterized protein LOC100803065               214   6e-65   Glycine max [soybeans]
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        214   6e-65   Malus domestica [apple tree]
gb|ABI36487.1|  AUX/IAA7 A                                              211   6e-65   Malus domestica [apple tree]
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             214   7e-65   Capsella rubella
gb|KJB11141.1|  hypothetical protein B456_001G242900                    214   7e-65   Gossypium raimondii
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     214   7e-65   Brassica rapa
gb|ADL36587.1|  ARF domain class transcription factor                   211   8e-65   Malus domestica [apple tree]
emb|CDP06818.1|  unnamed protein product                                214   8e-65   Coffea canephora [robusta coffee]
gb|ABI36493.1|  AUX/IAA16 A                                             210   9e-65   Malus domestica [apple tree]
gb|KJB44873.1|  hypothetical protein B456_007G276900                    214   9e-65   Gossypium raimondii
gb|AFK36086.1|  unknown                                                 214   1e-64   Lotus japonicus
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          213   1e-64   Pyrus x bretschneideri [bai li]
dbj|BAI94494.1|  Aux/IAA protein                                        213   1e-64   Dianthus caryophyllus [carnation]
ref|NP_001239753.1|  uncharacterized protein LOC100781847               213   1e-64   Glycine max [soybeans]
gb|KHN18836.1|  Auxin-induced protein AUX28                             213   1e-64   Glycine soja [wild soybean]
gb|KHN22078.1|  Auxin-responsive protein IAA16                          213   2e-64   Glycine soja [wild soybean]
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     213   2e-64   Camelina sativa [gold-of-pleasure]
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               213   2e-64   
gb|AFK44192.1|  unknown                                                 213   2e-64   Medicago truncatula
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    211   2e-64   Tarenaya hassleriana [spider flower]
gb|AFK42876.1|  unknown                                                 213   2e-64   Medicago truncatula
emb|CDY63910.1|  BnaC01g43640D                                          212   4e-64   Brassica napus [oilseed rape]
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        214   4e-64   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 212   5e-64   Medicago truncatula
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     212   5e-64   Elaeis guineensis
gb|KHG04941.1|  Auxin-induced AUX28                                     211   5e-64   Gossypium arboreum [tree cotton]
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     211   6e-64   Glycine max [soybeans]
gb|KHN31465.1|  Auxin-responsive protein IAA16                          211   7e-64   Glycine soja [wild soybean]
gb|ACU18407.1|  unknown                                                 211   8e-64   Glycine max [soybeans]
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     210   9e-64   Sesamum indicum [beniseed]
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        211   9e-64   Pyrus x bretschneideri [bai li]
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        209   1e-63   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        211   1e-63   Prunus mume [ume]
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        211   1e-63   Cicer arietinum [garbanzo]
gb|ACJ83896.1|  unknown                                                 211   1e-63   Medicago truncatula
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        211   1e-63   
gb|AEE25650.1|  auxin-responsive protein                                211   1e-63   Gossypium hirsutum [American cotton]
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            210   1e-63   Ipomoea nil [qian niu]
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    209   2e-63   Cucumis melo [Oriental melon]
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              210   2e-63   Ricinus communis
emb|CAH59413.1|  auxin resistance protein                               209   2e-63   Plantago major [cart-track plant]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     210   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     210   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY41894.1|  BnaC05g47100D                                          209   3e-63   Brassica napus [oilseed rape]
gb|ACJ84642.1|  unknown                                                 210   3e-63   Medicago truncatula
ref|XP_002302075.1|  auxin-induced protein aux28                        209   4e-63   Populus trichocarpa [western balsam poplar]
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 209   4e-63   Medicago truncatula
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        209   4e-63   Sesamum indicum [beniseed]
ref|XP_006383686.1|  auxin-induced protein aux28                        209   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        209   4e-63   Pyrus x bretschneideri [bai li]
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             209   5e-63   Prunus persica
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             209   5e-63   Phaseolus vulgaris [French bean]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     209   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     208   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY30017.1|  BnaC01g39910D                                          208   1e-62   Brassica napus [oilseed rape]
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     207   2e-62   Cucumis sativus [cucumbers]
gb|KHN30563.1|  Auxin-responsive protein IAA14                          207   2e-62   Glycine soja [wild soybean]
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             207   2e-62   Citrus clementina [clementine]
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     206   2e-62   Solanum tuberosum [potatoes]
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   207   3e-62   Cucumis sativus [cucumbers]
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   206   4e-62   Citrus sinensis [apfelsine]
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             207   5e-62   Phaseolus vulgaris [French bean]
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     207   5e-62   Setaria italica
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          206   5e-62   Amborella trichopoda
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          207   5e-62   Sorghum bicolor [broomcorn]
dbj|BAJ84870.1|  predicted protein                                      207   5e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB11145.1|  hypothetical protein B456_001G242900                    207   6e-62   Gossypium raimondii
dbj|BAK01326.1|  predicted protein                                      206   6e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    206   7e-62   Elaeis guineensis
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             206   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             206   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     206   7e-62   Phoenix dactylifera
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        205   9e-62   Cucumis melo [Oriental melon]
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     206   9e-62   Phoenix dactylifera
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             206   9e-62   Phaseolus vulgaris [French bean]
gb|AGV54230.1|  auxin-induced protein AUX28                             206   9e-62   Phaseolus vulgaris [French bean]
gb|ACU19136.1|  unknown                                                 206   1e-61   Glycine max [soybeans]
gb|ACF88333.1|  unknown                                                 206   1e-61   Zea mays [maize]
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     205   2e-61   Brachypodium distachyon [annual false brome]
gb|ACF87179.1|  unknown                                                 206   2e-61   Zea mays [maize]
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     203   2e-61   Nicotiana sylvestris
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        204   3e-61   Populus euphratica
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     206   3e-61   Zea mays [maize]
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    204   3e-61   Elaeis guineensis
gb|ADL70676.1|  indole-3-acetic acid inducible 16                       201   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|KHN02537.1|  Auxin-induced protein AUX28                             204   4e-61   Glycine soja [wild soybean]
ref|NP_001236693.1|  auxin-induced protein AUX28                        204   4e-61   
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     203   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          203   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        203   7e-61   Populus euphratica
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             203   8e-61   Capsella rubella
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    203   9e-61   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                202   1e-60   Erythranthe guttata [common monkey flower]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     202   1e-60   Camelina sativa [gold-of-pleasure]
gb|ACU21378.1|  unknown                                                 203   1e-60   Glycine max [soybeans]
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             202   1e-60   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          201   1e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            202   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    202   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171921.1|  auxin-responsive protein IAA17                        202   2e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CAB46059.1|  IAA7 like protein                                      202   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        202   5e-60   Glycine max [soybeans]
emb|CDY15493.1|  BnaA08g27770D                                          200   1e-59   Brassica napus [oilseed rape]
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          200   1e-59   Brassica rapa
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    200   1e-59   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    200   1e-59   Glycine max [soybeans]
ref|NP_001067209.1|  Os12g0601300                                       201   1e-59   
gb|ADB93633.2|  indole-3-acetic acid inducible 16                       196   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        201   3e-59   Eucalyptus grandis [rose gum]
gb|ABI36490.1|  AUX/IAA7 C                                              196   3e-59   Malus domestica [apple tree]
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     199   5e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       196   5e-59   Arabidopsis thaliana [mouse-ear cress]
gb|ABD98055.1|  auxin-regulated protein                                 199   6e-59   Striga asiatica [witchweed]
ref|NP_001266055.1|  IAA10 protein                                      197   1e-58   Solanum lycopersicum
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    198   2e-58   Setaria italica
gb|ADB93630.2|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70677.1|  indole-3-acetic acid inducible 16                       194   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    197   2e-58   
emb|CAN72026.1|  hypothetical protein VITISV_014421                     198   2e-58   Vitis vinifera
emb|CDY63072.1|  BnaCnng41350D                                          201   3e-58   Brassica napus [oilseed rape]
ref|XP_004153443.1|  PREDICTED: auxin-responsive protein IAA16-like     193   3e-58   
emb|CDY18214.1|  BnaC05g02370D                                          196   3e-58   Brassica napus [oilseed rape]
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       196   6e-58   Cucumis sativus [cucumbers]
emb|CDX89832.1|  BnaA10g02500D                                          195   8e-58   
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             195   9e-58   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    195   1e-57   
gb|ADB93634.2|  indole-3-acetic acid inducible 16                       192   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70679.1|  indole-3-acetic acid inducible 16                       192   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93632.2|  indole-3-acetic acid inducible 16                       192   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    194   2e-57   Cucumis melo [Oriental melon]
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     194   3e-57   Brassica rapa
emb|CDY32537.1|  BnaA09g50590D                                          194   3e-57   Brassica napus [oilseed rape]
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             194   3e-57   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    193   4e-57   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    194   5e-57   Setaria italica
gb|ACU19616.1|  unknown                                                 193   5e-57   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    192   5e-57   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             192   1e-56   
gb|KJB11146.1|  hypothetical protein B456_001G242900                    194   1e-56   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     192   2e-56   
emb|CDY10068.1|  BnaC08g43830D                                          192   2e-56   
gb|AAV50046.1|  auxin-induced protein                                   190   2e-56   
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     191   4e-56   
gb|ABK24636.1|  unknown                                                 195   8e-56   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               189   3e-55   
dbj|BAJ97201.1|  predicted protein                                      188   6e-55   
gb|AFK43673.1|  unknown                                                 189   6e-55   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 188   7e-55   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      191   1e-54   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 191   1e-54   
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             186   2e-54   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     186   4e-54   
ref|XP_004150437.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    186   5e-54   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     188   5e-54   
ref|XP_004150556.1|  PREDICTED: auxin-responsive protein IAA27-like     187   9e-54   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         189   1e-53   
gb|ADL70548.1|  indole-3-acetic acid inducible 7                        180   1e-53   
gb|AAN16886.1|  Aux/IAA1                                                180   1e-53   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     187   2e-53   
gb|ABR17764.1|  unknown                                                 187   2e-53   
gb|ADL70558.1|  indole-3-acetic acid inducible 7                        179   2e-53   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          189   2e-53   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     187   2e-53   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         184   2e-53   
emb|CAC84711.1|  aux/IAA protein                                        184   2e-53   
gb|ADL70552.1|  indole-3-acetic acid inducible 7                        179   3e-53   
gb|ABR16302.1|  unknown                                                 186   3e-53   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     186   4e-53   
gb|ABM53871.1|  IAA3                                                    181   4e-53   
gb|AEQ94167.1|  auxin induced family protein                            179   5e-53   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     186   6e-53   
gb|ABB55368.1|  Aux/IAA protein-like                                    186   6e-53   
ref|NP_001275473.1|  Aux/IAA protein                                    186   7e-53   
gb|ADL70554.1|  indole-3-acetic acid inducible 7                        178   7e-53   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    186   8e-53   
gb|ABI36491.1|  AUX/IAA8A                                               180   8e-53   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      186   9e-53   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      186   1e-52   
gb|KJB64033.1|  hypothetical protein B456_010G031600                    185   1e-52   
gb|AAP44405.1|  auxin-induced protein 2                                 184   2e-52   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     184   2e-52   
gb|ABR16139.1|  unknown                                                 187   2e-52   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      185   2e-52   
emb|CAI77628.1|  Aux/IAA protein                                        184   2e-52   
emb|CBI28036.3|  unnamed protein product                                179   2e-52   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         184   2e-52   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         184   2e-52   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     185   3e-52   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      185   3e-52   
gb|AFZ78618.1|  hypothetical protein                                    185   3e-52   
emb|CBI36106.3|  unnamed protein product                                183   3e-52   
gb|AEI70507.1|  auxin-responsive protein                                184   3e-52   
ref|XP_002302351.1|  auxin-responsive family protein                    185   3e-52   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    183   3e-52   
emb|CAC84706.1|  aux/IAA protein                                        185   3e-52   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    184   3e-52   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 184   3e-52   
emb|CBI19314.3|  unnamed protein product                                183   4e-52   
gb|KJB64027.1|  hypothetical protein B456_010G031600                    184   4e-52   
ref|XP_008462746.1|  PREDICTED: auxin-responsive protein IAA27          183   4e-52   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    183   4e-52   
gb|KJB54240.1|  hypothetical protein B456_009G026700                    183   4e-52   
emb|CDP03299.1|  unnamed protein product                                184   5e-52   
pdb|2MUK|X  Chain X, 1h, 13c, And 15n Chemical Shift Assignments ...    176   5e-52   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             184   5e-52   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           184   5e-52   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             184   6e-52   
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    183   6e-52   
gb|KJB18638.1|  hypothetical protein B456_003G064200                    180   6e-52   
ref|NP_001268170.1|  Aux/IAA protein                                    184   7e-52   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              184   7e-52   
gb|AAL92850.1|  Aux/IAA protein                                         184   8e-52   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    180   9e-52   
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   184   9e-52   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          184   9e-52   
gb|AEI70506.1|  auxin-responsive protein                                182   1e-51   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    182   1e-51   
gb|KJB56779.1|  hypothetical protein B456_009G135900                    182   1e-51   
gb|KJB58777.1|  hypothetical protein B456_009G226000                    183   1e-51   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    181   1e-51   
gb|KJB58781.1|  hypothetical protein B456_009G226000                    183   1e-51   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     182   1e-51   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     182   1e-51   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    179   2e-51   
ref|XP_002464208.1|  hypothetical protein SORBIDRAFT_01g014130          180   2e-51   
ref|XP_006833393.1|  hypothetical protein AMTR_s00109p00120700          182   2e-51   
gb|AEV89263.1|  IAA9                                                    181   2e-51   
emb|CAD10639.1|  IAA9 protein                                           182   2e-51   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         182   2e-51   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    183   2e-51   
gb|KJB18635.1|  hypothetical protein B456_003G064200                    181   2e-51   
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           182   2e-51   
gb|ADL36578.1|  ARF domain class transcription factor                   182   3e-51   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    183   3e-51   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    183   3e-51   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          181   4e-51   
gb|KJB18637.1|  hypothetical protein B456_003G064200                    181   4e-51   
gb|KEH27147.1|  auxin response factor                                   178   6e-51   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           179   6e-51   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          181   8e-51   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      181   8e-51   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           181   1e-50   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 180   1e-50   
gb|ABY48132.1|  GH1 protein                                             180   1e-50   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             180   2e-50   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      180   2e-50   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    180   2e-50   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      180   2e-50   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 179   3e-50   
ref|XP_009381047.1|  PREDICTED: auxin-responsive protein IAA17-like     178   3e-50   
ref|XP_010526458.1|  PREDICTED: auxin-responsive protein IAA27          177   3e-50   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             180   3e-50   
gb|ABW24025.1|  aux/IAA protein                                         173   4e-50   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     177   4e-50   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             179   4e-50   
gb|AAM12952.1|  auxin-regulated protein                                 179   5e-50   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      179   5e-50   
emb|CDP00957.1|  unnamed protein product                                179   5e-50   
gb|KDO56957.1|  hypothetical protein CISIN_1g019236mg                   178   6e-50   
gb|EPS60474.1|  hypothetical protein M569_14329                         174   6e-50   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     176   6e-50   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           179   6e-50   
gb|AGV54485.1|  auxin-responsive protein                                178   7e-50   
ref|XP_006465643.1|  PREDICTED: auxin-responsive protein IAA8-lik...    178   7e-50   
ref|XP_002303297.1|  auxin-responsive protein IAA27                     178   8e-50   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     177   1e-49   
emb|CDP02673.1|  unnamed protein product                                178   1e-49   
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                177   1e-49   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          177   1e-49   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             176   1e-49   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      178   1e-49   
ref|XP_006426926.1|  hypothetical protein CICLE_v10025988mg             177   1e-49   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          176   1e-49   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               177   1e-49   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     176   1e-49   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           178   2e-49   
gb|KHN46011.1|  Auxin-responsive protein IAA9                           177   2e-49   
ref|NP_001280937.1|  auxin-responsive protein IAA27                     176   2e-49   
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...    177   2e-49   
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...    176   2e-49   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             175   2e-49   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     176   2e-49   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     174   3e-49   
gb|AFK45766.1|  unknown                                                 174   3e-49   
ref|XP_009409066.1|  PREDICTED: auxin-responsive protein IAA17-like     176   3e-49   
gb|ABI36495.1|  AUX/IAA27 A                                             169   3e-49   
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             176   3e-49   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...    176   3e-49   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                175   3e-49   
gb|KEH42779.1|  auxin-responsive AUX/IAA family protein                 172   3e-49   
ref|XP_009612337.1|  PREDICTED: auxin-responsive protein IAA27-like     176   4e-49   
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    176   4e-49   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             175   4e-49   
gb|KHN22187.1|  Auxin-responsive protein IAA9                           176   4e-49   
ref|XP_008793078.1|  PREDICTED: auxin-responsive protein IAA27-li...    175   4e-49   
ref|XP_011010527.1|  PREDICTED: auxin-responsive protein IAA27-li...    176   5e-49   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      176   5e-49   
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     175   6e-49   
ref|XP_010924571.1|  PREDICTED: auxin-responsive protein IAA27-like     175   6e-49   
gb|KDO53919.1|  hypothetical protein CISIN_1g026811mg                   171   6e-49   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    176   7e-49   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             174   8e-49   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           175   8e-49   
gb|KHN04889.1|  Auxin-responsive protein IAA8                           174   8e-49   
gb|ABI36497.1|  AUX/IAA27 B                                             168   9e-49   
gb|AFK38538.1|  unknown                                                 174   1e-48   
ref|XP_006432922.1|  hypothetical protein CICLE_v10002290mg             171   1e-48   
gb|KDO48904.1|  hypothetical protein CISIN_1g026005mg                   171   1e-48   
gb|ADL70559.1|  indole-3-acetic acid inducible 7                        166   1e-48   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           175   2e-48   
gb|KFK29453.1|  hypothetical protein AALP_AA7G136400                    173   2e-48   
ref|XP_004287443.1|  PREDICTED: auxin-responsive protein IAA27          173   2e-48   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      175   2e-48   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          174   2e-48   
gb|KDP37265.1|  hypothetical protein JCGZ_06321                         174   2e-48   
ref|NP_194637.1|  phytochrome-associated protein 2                      173   2e-48   
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      174   2e-48   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     172   3e-48   
ref|XP_010098105.1|  Auxin-responsive protein IAA27                     174   3e-48   
gb|AAB70005.1|  GH1 protein                                             174   3e-48   
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    174   3e-48   
ref|XP_009398379.1|  PREDICTED: auxin-responsive protein IAA30-like     171   3e-48   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     172   3e-48   
ref|XP_002867425.1|  phytochrome-associated protein 2                   173   3e-48   
gb|AFK35603.1|  unknown                                                 167   3e-48   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             172   4e-48   
ref|XP_009771095.1|  PREDICTED: auxin-responsive protein IAA8-like      172   4e-48   
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      173   4e-48   
ref|XP_010447892.1|  PREDICTED: auxin-responsive protein IAA27          172   5e-48   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             174   5e-48   
ref|XP_010917562.1|  PREDICTED: auxin-responsive protein IAA27-like     172   6e-48   
ref|NP_001266034.1|  IAA6 protein                                       171   6e-48   
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like      174   6e-48   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...    173   8e-48   
gb|ABI36496.1|  AUX/IAA26                                               166   8e-48   
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          172   8e-48   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8                172   1e-47   
ref|XP_010433139.1|  PREDICTED: auxin-responsive protein IAA27-like     171   1e-47   
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     172   1e-47   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    173   1e-47   
gb|ACJ84551.1|  unknown                                                 172   1e-47   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    169   1e-47   
ref|XP_002516003.1|  Auxin-responsive protein IAA27, putative           173   1e-47   
gb|AFK38170.1|  unknown                                                 172   1e-47   
ref|XP_007047689.1|  Transcription factor, putative isoform 3           172   1e-47   
gb|KJB71166.1|  hypothetical protein B456_011G109000                    172   1e-47   
ref|XP_008342663.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    172   1e-47   
gb|KJB71165.1|  hypothetical protein B456_011G109000                    172   2e-47   
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    171   2e-47   
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           172   2e-47   
ref|XP_009416499.1|  PREDICTED: auxin-responsive protein IAA21-like     170   2e-47   
ref|XP_008228477.1|  PREDICTED: auxin-responsive protein IAA27-like     172   2e-47   
ref|NP_001240013.1|  uncharacterized protein LOC100804423               171   2e-47   
ref|XP_009129008.1|  PREDICTED: auxin-responsive protein IAA27          170   2e-47   
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             172   2e-47   
emb|CBW30571.1|  auxin-responsive protein iaa27                         168   2e-47   



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   239 bits (609),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQKS+ ++   + S     AAFVKVCMDGAPYLRKVDLKMY+SY+QLSDALAKMFS
Sbjct  12   KNVMAQKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKSYKQLSDALAKMFS  71

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLN+SEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  72   SFTMGNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLR  131

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK+R
Sbjct  132  IMKGSEAIGLAPRAMEKCKSR  152



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQK+S EE     SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFS
Sbjct  100  KNIMAQKNSSEEGEKGSSGAA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFS  155

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  156  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  215

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCKNRC
Sbjct  216  IMKGSEAIGLAPRAMEKCKNRC  237



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQK+S EE     SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LSDAL KMFS
Sbjct  106  KNIMAQKNSSEEGEKGSSGAA----FVKVCMDGAPYLRKVDLKMYKSYQELSDALGKMFS  161

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  162  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  221

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCKNRC
Sbjct  222  IMKGSEAIGLAPRAMEKCKNRC  243



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 126/141 (89%), Gaps = 3/141 (2%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE     +       FVKVCMDGAPYLRKVDLKMY+SYQQLSDALAKMFS
Sbjct  87   KNVMAQKNNTEETEKSSATAVA---FVKVCMDGAPYLRKVDLKMYKSYQQLSDALAKMFS  143

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  144  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  203

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK R
Sbjct  204  IMKGSEAIGLAPRAMEKCKRR  224



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++      EK   G  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  115  KNVMAQKNTSGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDLKMYQSYQELSDALAKMFS  174

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMG YG QGMIDFMNERKLMDLLNSSE+VPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  175  SFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  234

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK+R
Sbjct  235  IMKGSEAIGLAPRAMEKCKSR  255



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++      EK  GG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  115  KNVMAQKNTSGGEGTEKGNGGSSAAFVKVCMDGAPYLRKVDLKMYQSYQELSDALAKMFS  174

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMG YG QGMIDFMNERKLMDLLNSSE+VPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  175  SFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  234

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK+R
Sbjct  235  IMKGSEAIGLAPRAMEKCKSR  255



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 5/142 (4%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQK++ EE     S       FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  45   KNIMAQKNTSEEGEKASSAA-----FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFS  99

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  100  SFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  159

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+R 
Sbjct  160  IMKGSEAIGLAPRAMEKCKSRT  181



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 131/142 (92%), Gaps = 2/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQKS+ EEAA EK+G      FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  100  KNIMAQKSNTEEAAAEKAGSSAA--FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFS  157

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  158  SFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  217

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+RC
Sbjct  218  IMKGSEAIGLAPRAMEKCKSRC  239



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMA + S +E A + +     AAFVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  100  KNIMAHQKSSDEEAEKAACSSPTAAFVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFS  159

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW+MFVDSCKRLR
Sbjct  160  SFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLR  219

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+RC
Sbjct  220  IMKGSEAIGLAPRAMEKCKSRC  241



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/117 (95%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  125  FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  185  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  241



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   237 bits (604),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN++AQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVLAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLR  226

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+R 
Sbjct  227  IMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   236 bits (603),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/116 (96%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  119  FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  178

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  179  NSSEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  234



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVMAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLR  226

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+R 
Sbjct  227  IMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspe-eaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIMAQK S   E +    GG   AAFVKV MDGAPYLRKVDLKMY+SYQQLSDALAKMF
Sbjct  101  KNIMAQKGSSICEESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKSYQQLSDALAKMF  160

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFTMGNYGAQGMIDFMNERKLMDLLNSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRL
Sbjct  161  SSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRL  220

Query  406  RIMKGSEAIGLAPRAVEKCKNR  341
            RIMKGSEAIGLAPRA+EKCK+R
Sbjct  221  RIMKGSEAIGLAPRAMEKCKSR  242



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVMAQKNASEEGEKTSTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLR  226

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+R 
Sbjct  227  IMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  161  FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  220

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  221  NSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  277



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVMAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLR  226

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            +MKGSEAIGLAPRA+EKCK+R 
Sbjct  227  LMKGSEAIGLAPRAMEKCKSRT  248



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   235 bits (599),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 6/141 (4%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQKS+ EE+    +       FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  101  KNVMAQKSNTEESEKTTAA------FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFS  154

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  155  SFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  214

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK+R
Sbjct  215  IMKGSEAIGLAPRAMEKCKSR  235



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   234 bits (598),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 123/141 (87%), Gaps = 4/141 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ E      +       FVKVCMDGAPYLRKVDLKMY+SYQQLSDALAKMFS
Sbjct  86   KNVMAQKNNTEAEKSNATAAA----FVKVCMDGAPYLRKVDLKMYKSYQQLSDALAKMFS  141

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRLR
Sbjct  142  SFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWVMFVDSCKRLR  201

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK R
Sbjct  202  IMKGSEAIGLAPRAMEKCKRR  222



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   235 bits (599),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+M QK S E+ A + +      AFVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFS
Sbjct  103  KNMMTQKVSTEDGAEKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFS  162

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  163  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  222

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCK+R 
Sbjct  223  IMKGSEAIGLAPRAMEKCKSRS  244



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 126/141 (89%), Gaps = 6/141 (4%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQKS+ EE+            FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFS
Sbjct  103  KNVMAQKSNTEESEKTTVA------FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFS  156

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT GNYG+QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  157  SFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  216

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCK+R
Sbjct  217  IMKGSEAIGLAPRAMEKCKSR  237



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 2/141 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQKSS EE+  + SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFS
Sbjct  100  KNIMAQKSSSEESTEKGSGCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFS  157

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMG YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  158  SFTMGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  217

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCKNR
Sbjct  218  IMKGSEAIGLAPRAMEKCKNR  238



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK +  E   + +     A FVKV MDGAPYLRKVDL MY++Y+ LSDALAKMFS
Sbjct  95   KNMMAQKVNNTEDTEKTTSNTTAAVFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFS  154

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLR
Sbjct  155  SFTIGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLR  214

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCKNR
Sbjct  215  IMKGSEAIGLAPRAMEKCKNR  235



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 128/141 (91%), Gaps = 2/141 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNIMAQKSS EE+  + SG      FVKVCMDGAPYLRKVDLKMY+SYQ+LS++LAKMFS
Sbjct  109  KNIMAQKSSSEESTEKGSGCSAA--FVKVCMDGAPYLRKVDLKMYKSYQELSNSLAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMG YG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  167  SFTMGYYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  226

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRA+EKCKNR
Sbjct  227  IMKGSEAIGLAPRAMEKCKNR  247



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQQLSDALA MFSSFTMGNYGAQGMIDFMNERKLMDLL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYKSYQQLSDALANMFSSFTMGNYGAQGMIDFMNERKLMDLL  187

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  188  NSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  243



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK +  E   + +     AAFVKV MDGAPYLRKVDL MY++Y+ LSDALAKMFS
Sbjct  95   KNMMAQKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFS  154

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLR
Sbjct  155  SFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLR  214

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEAIGLAPRA+EKCKNR 
Sbjct  215  IMKGSEAIGLAPRAMEKCKNRS  236



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN++AQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVLAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLR  226

Query  403  IMKGSEAIGL--APRAVEKCKNRC  338
            IMKGSEAIGL  APRA+EKCK+R 
Sbjct  227  IMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   232 bits (591),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  138  FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  197

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  198  NSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  254



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   231 bits (589),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKVCMDGAPYLRKVDLK Y+SYQ+LSDALAKMFSSFTMGNYG+QGMIDFMNE KLMDLL
Sbjct  116  FVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK+R
Sbjct  176  NSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRAMEKCKSR  231



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQQLSD+L KMFSSFTMGNYG+QGMIDFMNERKLMD+L
Sbjct  97   FVKVSMDGAPYLRKVDLKMYKSYQQLSDSLTKMFSSFTMGNYGSQGMIDFMNERKLMDVL  156

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  157  NSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  212



>gb|EYU32514.1| hypothetical protein MIMGU_mgv1a012542mg [Erythranthe guttata]
Length=247

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY +YQ+LSDALAKMFSSFTMGNYG++GMIDFMNE KLMDLL
Sbjct  131  FVKVSMDGAPYLRKVDLKMYGAYQELSDALAKMFSSFTMGNYGSEGMIDFMNEGKLMDLL  190

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCK+RC
Sbjct  191  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAMEKCKSRC  247



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 126/141 (89%), Gaps = 4/141 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSDAL+KMFS
Sbjct  101  KNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSDALSKMFS  156

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT G YGAQGMIDFMNE KLMDLLNS+EYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  157  SFTTGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  216

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAP+A+EKCKNR
Sbjct  217  IMKGSEAIGLAPKAMEKCKNR  237



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 3/144 (2%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE     +GG   A FVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMFS
Sbjct  108  KNVMAQKNASEEGEKASTGGSSAA-FVKVCMDGAPYLRKVDLKMYRSYQELSDALAKMFS  166

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  167  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLR  226

Query  403  IMKGSEAIGL--APRAVEKCKNRC  338
            +MKGSEAIGL  APRA+EKCK+R 
Sbjct  227  LMKGSEAIGLVSAPRAMEKCKSRT  250



>emb|CAC84710.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=277

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKVCMDGAPYLRKVDLKMY+SYQ+LSDALAKMFSS TMGNYGAQGMIDFMNE KLMDLL
Sbjct  161  FVKVCMDGAPYLRKVDLKMYKSYQELSDALAKMFSSLTMGNYGAQGMIDFMNESKLMDLL  220

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKR RIMKGSEA+GLAPRA+EKCK+R
Sbjct  221  NSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRPRIMKGSEAVGLAPRAMEKCKSR  276



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  129  FVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  189  NSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSR  244



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   229 bits (583),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQQLS +L  MFSSFTMGNYG+QGMIDFMNERKLMD+L
Sbjct  102  FVKVSMDGAPYLRKVDLKMYKSYQQLSHSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVL  161

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  162  NSSDYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  218



>gb|KJB28413.1| hypothetical protein B456_005G046500 [Gossypium raimondii]
Length=248

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIMA QK++ +E +   S G G AAFVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMF
Sbjct  106  KNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDALAKMF  165

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFTMG+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRL
Sbjct  166  SSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  225

Query  406  RIMKGSEAIGLAPRAVEKCKNR  341
            RIMKGSEAIGLAPRA+EKCK+R
Sbjct  226  RIMKGSEAIGLAPRAMEKCKSR  247



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   229 bits (584),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLK+Y+SYQ+L+DALAKMFSSFTMGNYG Q GMIDFMNE KLMDL
Sbjct  125  FVKVSMDGAPYLRKVDLKIYKSYQELADALAKMFSSFTMGNYGTQQGMIDFMNESKLMDL  184

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  185  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  242



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 115/117 (98%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDL  512
            FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQGMIDFMNE KLMDL
Sbjct  120  FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDL  179

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  180  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  236



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+ SDALAKMFSSFTMG YG++GMIDFMNERKLMD+L
Sbjct  138  FVKVSMDGAPYLRKVDLKMYKSYQEFSDALAKMFSSFTMGKYGSEGMIDFMNERKLMDVL  197

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NS+EYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  198  NSTEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRC  254



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 115/117 (98%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDL  512
            FVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMFSSFTM G+YGAQGMIDFMNE KLMDL
Sbjct  120  FVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDL  179

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  180  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  236



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            F KV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  126  FAKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  185

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  186  NSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  242



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  123  FVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  182

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  183  NSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSRS  239



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQKS+ EE++           FVKVCMDGAPYLRKVDLKMY+SY++LSDAL+KMFS
Sbjct  94   KNVMAQKSTGEESSTTTEKAA----FVKVCMDGAPYLRKVDLKMYKSYKELSDALSKMFS  149

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT G YG QGMIDFMNE KLMDLLNS++YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  150  SFTTGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  209

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAP+A+EKCKNR
Sbjct  210  IMKGSEAIGLAPKAMEKCKNR  230



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIMA QK++ +E +   S G G AAFVKVCMDGAPYLRKVDLKMY SYQ+LSDALAKMF
Sbjct  106  KNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNSYQKLSDALAKMF  165

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFTMG+YG +GMIDFMNE KLMDLLNSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRL
Sbjct  166  SSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  225

Query  406  RIMKGSEAIGLAPRAVEKCKNR  341
            RIMKGSEAIGLAPRA+EKCK+R
Sbjct  226  RIMKGSEAIGLAPRAMEKCKSR  247



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM-GNYGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFS+FTM GNYG+QGMIDFMNE KLMDL
Sbjct  134  FVKVSMDGAPYLRKVDLKMYKSYQELSDALVKMFSAFTMAGNYGSQGMIDFMNEGKLMDL  193

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+RC
Sbjct  194  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRC  251



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKM++SYQ LSDALAKMFSSFTMG+YGAQGMIDFMNE KLMDLL
Sbjct  113  FVKVSMDGAPYLRKVDLKMHKSYQDLSDALAKMFSSFTMGSYGAQGMIDFMNESKLMDLL  172

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  173  NSSEYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  229



>gb|KFK39592.1| hypothetical protein AALP_AA3G264300 [Arabis alpina]
Length=235

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+M Q+ +           G  AA VKV MDGAPYLRKVDL MY+SYQ LSDALAKMFS
Sbjct  93   KNMMTQQKTTGSEEASSDKAGTGAALVKVSMDGAPYLRKVDLNMYKSYQDLSDALAKMFS  152

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFTMGNYGAQGMIDFMNE KLMDLLNSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  153  SFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLR  212

Query  403  IMKGSEAIGLAPRAVEK-CKNRC  338
            IMKGSEAIGLAPRA+EK CKNR 
Sbjct  213  IMKGSEAIGLAPRAMEKYCKNRS  235



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY+SY++LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  215  FVKVSMDGAPYLRKVDLTMYKSYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  274

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  275  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  331



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLL
Sbjct  133  LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  193  NSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLL
Sbjct  133  LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  193  NSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>gb|KJB38280.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=249

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLL
Sbjct  133  LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  193  NSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  249



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+ YQ LSDALAKMFSSFTMGNYG+QGMIDFMNE KLMDLL
Sbjct  118  FVKVSMDGAPYLRKVDLKIYQCYQDLSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLL  177

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPW+MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  178  NSSEYVPSYEDKDGDWMLVGDVPWQMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  233



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK Y SY+QLSDAL KMFSSFTMG+YGAQGMIDFMNE KLMDLL
Sbjct  127  FVKVSMDGAPYLRKVDLKNYSSYKQLSDALGKMFSSFTMGSYGAQGMIDFMNESKLMDLL  186

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  187  NSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksgggg--paAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  590
            KNIMAQK++ EE   + + GGG   AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKM
Sbjct  101  KNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKM  160

Query  589  FSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  410
            FSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKR
Sbjct  161  FSSFTTGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKR  220

Query  409  LRIMKGSEAIGLAPRAVEKCKNR  341
            LRIMKGSEAIGLAP+A EKCK R
Sbjct  221  LRIMKGSEAIGLAPKAXEKCKGR  243



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 120/144 (83%), Gaps = 2/144 (1%)
 Frame = -2

Query  763  KNIMAQksspeea--ageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  590
            KN+MAQK +  +     + +       FVKV MDGAPYLRKVDL MY +Y+ LSDALAKM
Sbjct  97   KNMMAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKM  156

Query  589  FSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  410
            FSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKR
Sbjct  157  FSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKR  216

Query  409  LRIMKGSEAIGLAPRAVEKCKNRC  338
            LRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  217  LRIMKGSEAIGLAPRAMEKCKNRS  240



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIMA QKSS E       GGGG  AFVKV MDGAPYLRKVDLKMY SY+ LSDALAKMF
Sbjct  88   KNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMF  147

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFTMG+YGAQGMIDFMNE K+MDLLNSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRL
Sbjct  148  SSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRL  207

Query  406  RIMKGSEAIGLAPRAVEKCKNRC  338
            RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  208  RIMKGSEAIGLAPRAMEKCKNRS  230



>gb|KJB38278.1| hypothetical protein B456_006G246000 [Gossypium raimondii]
Length=294

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYG QGMIDFMNE KLMDLL
Sbjct  178  LVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLL  237

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVP+YEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R 
Sbjct  238  NSSDYVPSYEDKDGDWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRA  294



>dbj|BAH15071.1| indole-3-acetic acid 14 transcription factor like [Malus prunifolia]
Length=243

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK++ EE   + S GG  AAFVKVCMDGAPYLRKVDLKMY SYQ+LS+ALAKMFS
Sbjct  102  KNVMAQKNTSEEKTKKASAGGCTAAFVKVCMDGAPYLRKVDLKMYRSYQELSNALAKMFS  161

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW M VDSCKRLR
Sbjct  162  SFTTGYYGDQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSCKRLR  221

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIG+AP+A+EKCK R
Sbjct  222  IMKGSEAIGIAPKAMEKCKGR  242



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MA + +  +   +   GG   AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFS
Sbjct  105  KNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFS  164

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GN G+QGM DFMNE KL+DLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  165  SFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  224

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRAVEKCKNR
Sbjct  225  IMKGSEAIGLAPRAVEKCKNR  245



>ref|XP_010466604.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   224 bits (572),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  185  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>gb|AAM65301.1| indoleacetic acid (IAA)-inducible gene (IAA7) [Arabidopsis thaliana]
Length=238

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  121  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  180

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  181  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  238



>ref|XP_010512022.1| PREDICTED: auxin-responsive protein IAA7 [Camelina sativa]
Length=242

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  185  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  112  FVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEA+GLAPRA+EKCKNR 
Sbjct  172  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAVGLAPRAMEKCKNRS  228



>ref|XP_010488346.1| PREDICTED: auxin-responsive protein IAA7-like [Camelina sativa]
Length=242

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  185  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  109  FVKVSMDGAPYLRKVDLKMYNSYKNLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  168

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSE+IGLAPRA+EKCKNR 
Sbjct  169  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSESIGLAPRAMEKCKNRS  225



>ref|XP_006406100.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
 dbj|BAJ33997.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47553.1| hypothetical protein EUTSA_v10021428mg [Eutrema salsugineum]
Length=239

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  122  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  181

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  182  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  239



>ref|XP_006284476.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
 gb|EOA17374.1| hypothetical protein CARUB_v10005662mg [Capsella rubella]
Length=228

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL+MY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  112  FVKVSMDGAPYLRKVDLRMYNSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  172  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  228



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   224 bits (572),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G QGM DFMNE KLMDLL
Sbjct  136  FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLL  195

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  196  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  251



>ref|XP_002883395.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59654.1| hypothetical protein ARALYDRAFT_319024 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  185  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNR  241



>ref|XP_006298251.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
 gb|EOA31149.1| hypothetical protein CARUB_v10014321mg [Capsella rubella]
Length=285

 Score =   225 bits (574),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  168  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  227

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  228  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCKNRS  285



>gb|KJB82525.1| hypothetical protein B456_013G200700 [Gossypium raimondii]
Length=246

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  130  FVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLL  189

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  190  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  130  FVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLL  189

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  190  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>ref|XP_006414696.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
 gb|ESQ56149.1| hypothetical protein EUTSA_v10026031mg [Eutrema salsugineum]
Length=257

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  141  FVKVSMDGAPYLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  201  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  256



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MA + +  +   +    G   AFVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFS
Sbjct  105  KNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFS  164

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GN G+QGM DFMNE KL+DLLN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  165  SFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  224

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRAVEKCKNR
Sbjct  225  IMKGSEAIGLAPRAVEKCKNR  245



>ref|NP_188945.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 sp|Q38825.1|IAA7_ARATH RecName: Full=Auxin-responsive protein IAA7; AltName: Full=Auxin 
resistant 2; AltName: Full=Indoleacetic acid-induced protein 
7 [Arabidopsis thaliana]
 gb|AAG48759.1|AF332395_1 indoleacetic acid-inducible protein IAA7 [Arabidopsis thaliana]
 gb|AAC49048.1| IAA7 [Arabidopsis thaliana]
 dbj|BAB02096.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAK96842.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AAL66876.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
 gb|AEE76710.1| auxin-responsive protein IAA7 [Arabidopsis thaliana]
Length=243

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  126  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  185

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEA+GLAPRA+EK CKNR 
Sbjct  186  NSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS  243



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksgggg-paAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIM+QK++ EE   + SGGGG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+AL+KMF
Sbjct  102  KNIMSQKNTSEEKTEKASGGGGCSAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALSKMF  161

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRL
Sbjct  162  SSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRL  221

Query  406  RIMKGSEAIGLAPRAVEKCKNR  341
            RIMKGSEAIGLAP+A+EKCK R
Sbjct  222  RIMKGSEAIGLAPKAMEKCKGR  243



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksgggg-paAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KNIMAQK++ EE   + SGGGG  AAFVKVCMDGAPYLRKVDLKMY+SYQ+LS+ALAKMF
Sbjct  102  KNIMAQKNTSEEKTKKASGGGGCTAAFVKVCMDGAPYLRKVDLKMYKSYQELSNALAKMF  161

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFT G YG QGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPW M VDSCKRL
Sbjct  162  SSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWGMLVDSCKRL  221

Query  406  RIMKGSEAIGLAPRAVEKCKNR  341
            RIMKGSEAIGLAP+A+EKCK R
Sbjct  222  RIMKGSEAIGLAPKAMEKCKGR  243



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  141  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  201  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRT  257



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  133  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  193  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQQLSDAL+KMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  130  FVKVSMDGAPYLRKVDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLL  189

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYED+DGDWMLVGDVPWEMFVD+CKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  190  NGSEYVPTYEDRDGDWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  132  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  191

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  192  NGSEYVPTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  248



>gb|AAC49055.1| IAA14, partial [Arabidopsis thaliana]
Length=164

 Score =   219 bits (558),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  48   FVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  107

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR 
Sbjct  108  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  164



>emb|CDY10694.1| BnaA05g16680D [Brassica napus]
Length=174

 Score =   219 bits (559),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY+  SDALAKMFSSFTMG YGAQGMIDFMNE KLMDLL
Sbjct  57   LVKVSMDGAPYLRKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLL  116

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  117  NSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  174



>emb|CDY10349.1| BnaC05g29300D [Brassica napus]
Length=246

 Score =   222 bits (565),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  129  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSS+YVP+YEDKD DWMLVGDVPWEMFVDSCKRLRIMKG+EAIGLAPRA+EK CKNR 
Sbjct  189  NSSDYVPSYEDKDSDWMLVGDVPWEMFVDSCKRLRIMKGAEAIGLAPRAMEKYCKNRS  246



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTM +YGAQGMIDFMNE K+MDLL
Sbjct  109  FVKVSMDGAPYLRKVDLKMYNSYKDLSDALAKMFSSFTMESYGAQGMIDFMNESKVMDLL  168

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  169  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  225



>ref|XP_009135842.1| PREDICTED: auxin-responsive protein IAA7-like [Brassica rapa]
 emb|CDX92973.1| BnaA03g36950D [Brassica napus]
Length=237

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 110/117 (94%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL MY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLM+LL
Sbjct  120  LVKVSMDGAPYLRKVDLTMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLL  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EK CKNR
Sbjct  180  NSSEYVPSYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAMEKYCKNR  236



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  141  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  201  NGSEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  257



>ref|NP_001288823.1| auxin-responsive protein IAA7 [Brassica rapa]
 dbj|BAF81520.1| auxin-responsive protein IAA [Brassica rapa]
Length=242

 Score =   221 bits (563),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY+  SDALAKMFSSFTMG YGAQGMIDFMNE KLMDLL
Sbjct  125  LVKVSMDGAPYLRKVDLKMYKSYKDFSDALAKMFSSFTMGKYGAQGMIDFMNESKLMDLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK CKNR 
Sbjct  185  NSSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKYCKNRS  242



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G QGM DFMNE KLMDLL
Sbjct  135  FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLL  194

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK R
Sbjct  195  NGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKKR  250



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G QG  DFMNE KL+DLL
Sbjct  133  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  193  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  248



>ref|XP_010679165.1| PREDICTED: auxin-responsive protein IAA14-like [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SYQ LSDAL KMFSSFT+GNYGAQGMIDFMNE KLMDLL
Sbjct  162  LVKVSMDGAPYLRKVDLKMYKSYQDLSDALGKMFSSFTLGNYGAQGMIDFMNESKLMDLL  221

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR 
Sbjct  222  NDSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNRS  278



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  54   FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  113

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  114  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  169



>ref|NP_193191.2| auxin-responsive protein IAA14 [Arabidopsis thaliana]
 sp|Q38832.2|IAA14_ARATH RecName: Full=Auxin-responsive protein IAA14; AltName: Full=Indoleacetic 
acid-induced protein 14; AltName: Full=Protein SOLITARY 
ROOT [Arabidopsis thaliana]
 gb|AAG50096.1|AF334718_1 IAA14 [Arabidopsis thaliana]
 dbj|BAF00338.1| IAA14 [Arabidopsis thaliana]
 dbj|BAH30518.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE83459.1| auxin-responsive protein IAA14 [Arabidopsis thaliana]
Length=228

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  112  FVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EK KNR 
Sbjct  172  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS  228



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KN+MA QK++ +E     S G   AAFVKV MDGAPYLRKVDLK+Y+SY++LSDAL KMF
Sbjct  107  KNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMF  166

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFT+GN G+QG  DFMNE KL+DLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRL
Sbjct  167  SSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRL  226

Query  406  RIMKGSEAIGLAPRAVEKCKNRC  338
            RIMKGSEAIGLAPRAVEKCKNR 
Sbjct  227  RIMKGSEAIGLAPRAVEKCKNRS  249



>emb|CDY47148.1| BnaA08g05350D [Brassica napus]
Length=233

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+
Sbjct  117  FVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLV  176

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVP+YEDKDGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA++KCKNR
Sbjct  177  NSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNR  232



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL KMFSSFT+G+YG+QGM DFMNE KL+DLL
Sbjct  135  FVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGSYGSQGMKDFMNESKLIDLL  194

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIM+GSEAIGLAPRAVEKCKNR 
Sbjct  195  NGSEYVPTYEDKDGDWMLVGDVPWEMFVNSCKRLRIMRGSEAIGLAPRAVEKCKNRS  251



>ref|XP_009107777.1| PREDICTED: auxin-responsive protein IAA14 [Brassica rapa]
Length=233

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+
Sbjct  117  FVKVSMDGAPYLRKVDLKMYKSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLV  176

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVP+YEDKDGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA++KCKNR
Sbjct  177  NSSDYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMQKCKNR  232



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G QG  DFMNE KL+DLL
Sbjct  135  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLL  194

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  195  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK+Y+SY++LSDAL KMF
Sbjct  107  KNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMF  166

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFT+GN G+QG  DFMNE KL+DLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRL
Sbjct  167  SSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRL  226

Query  406  RIMKGSEAIGLAPRAVEKCKNRC  338
            RIMKGSEAIGLAPRAVEKCKNR 
Sbjct  227  RIMKGSEAIGLAPRAVEKCKNRS  249



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  122  FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  181

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  182  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  237



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  129  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  189  NGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLL
Sbjct  104  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLL  163

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  164  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  220



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  129  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  189  NGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN++A + S      E          VKV MDGAPYLRKVDLK+Y+SYQ LSDAL KMFS
Sbjct  53   KNMLAVQKSTGAPESESEKPAANGGLVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFS  112

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GNYG+QGMIDFMNE KLMDL+N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLR
Sbjct  113  SFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  172

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKG EA GLAPRA+EKCKNR
Sbjct  173  IMKGKEAAGLAPRAMEKCKNR  193



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   219 bits (559),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SY++LSDAL KMFSSFT+GN G+QG  DFMNE KL+DLL
Sbjct  134  FVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  194  NSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  250



>ref|XP_002868277.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44536.1| hypothetical protein ARALYDRAFT_493451 [Arabidopsis lyrata subsp. 
lyrata]
Length=228

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  112  FVKVSMDGAPYLRKVDLKMYKSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKR+RIMKGSEAIGLAPRA+EK KNR 
Sbjct  172  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRMRIMKGSEAIGLAPRAMEKFKNRS  228



>emb|CDY62130.1| BnaC08g47390D [Brassica napus]
Length=233

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY++LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDL+
Sbjct  117  FVKVSMDGAPYLRKVDLKMYTSYKELSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLV  176

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSSEYVP+YEDKDGDWMLVGDVPW MF++SCKRLRIMKGSEAIGLAPRA+EK KNR
Sbjct  177  NSSEYVPSYEDKDGDWMLVGDVPWPMFIESCKRLRIMKGSEAIGLAPRAMEKYKNR  232



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   219 bits (557),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLL
Sbjct  124  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLL  183

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  184  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  181  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  240

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCK+R
Sbjct  241  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSR  296



>gb|KFK37887.1| hypothetical protein AALP_AA3G042100 [Arabis alpina]
Length=232

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  116  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>gb|ACL81167.1| auxin-responsive protein IAA1, partial [Mirabilis jalapa]
Length=263

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLK+Y+SYQ LSDAL KMFSSFT+GNYG+QGMIDFMNE KLMDL+
Sbjct  147  LVKVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLI  206

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA GLAPRA+EKCKNR
Sbjct  207  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR  262



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLL
Sbjct  124  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLL  183

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  184  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  239



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   219 bits (558),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ LSDALAKMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  154  FVKVSMDGAPYLRKVDLKLYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLL  213

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  214  NGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  270



>ref|XP_006408159.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
 gb|ESQ49612.1| hypothetical protein EUTSA_v10021441mg [Eutrema salsugineum]
Length=234

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  118  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  177

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  178  NGSDYVPTYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>dbj|BAJ34138.1| unnamed protein product [Thellungiella halophila]
Length=234

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  118  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  177

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  178  NGSDYVPTYEDKDGDWMLVGDVPWKMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  234



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+GN G  G  DFMNE KL+DLL
Sbjct  124  FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLL  183

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  184  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 110/119 (92%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM--GNYGAQGMIDFMNERKLMD  515
            FVKV MDGAPYLRKVDLKMY SY+ LS+ALAKMFSSFT   GNYGAQGMIDFMNE KLMD
Sbjct  120  FVKVSMDGAPYLRKVDLKMYNSYEDLSNALAKMFSSFTTEKGNYGAQGMIDFMNESKLMD  179

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LLNSS+YVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  180  LLNSSDYVPTYEDKDGDWMLVGDVPWLMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRA  238



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY SYQQLSDAL KMFSSFT+GN G++G+ D MNE KL+DLL
Sbjct  123  FVKVSLDGAPYLRKVDLKMYTSYQQLSDALGKMFSSFTIGNCGSEGIKDLMNESKLIDLL  182

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRAVEKCKNR
Sbjct  183  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAVEKCKNR  238



>gb|ADL70670.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=156

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  40   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  99

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  100  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  155



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -2

Query  763  KNIMA-QksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMF  587
            KN+MA QK+S +E     S G   AAFVKV MDGAPYLRKVDLK+Y+SY++LSDAL KMF
Sbjct  109  KNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMF  168

Query  586  SSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRL  407
            SSFT+GN G+QG  +FMNE KL+DLLNSSEYVPTYEDKDGDWMLVGDVPW MFVDSCKRL
Sbjct  169  SSFTIGNCGSQGTKEFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRL  228

Query  406  RIMKGSEAIGLAPRAVEKCKNRC  338
            RIMKGSEAIGLAPRAVEKCKNR 
Sbjct  229  RIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_010087762.1| Auxin-responsive protein IAA7 [Morus notabilis]
 gb|EXB29843.1| Auxin-responsive protein IAA7 [Morus notabilis]
Length=304

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 117/137 (85%), Gaps = 4/137 (3%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpa----AFVKVCMDGAPYLRKVDLKMYESYQQLSDALA  596
            KNIMAQK S  E +         +    AFVKVCMDGAPYLRKVDLKMY+SYQ+LSDALA
Sbjct  110  KNIMAQKMSTNEESSPHEKTSSSSNSAGAFVKVCMDGAPYLRKVDLKMYKSYQELSDALA  169

Query  595  KMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  416
            KMFSSFTMGNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC
Sbjct  170  KMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSC  229

Query  415  KRLRIMKGSEAIGLAPR  365
            KRLRIMKGSEAIGL  R
Sbjct  230  KRLRIMKGSEAIGLGLR  246



>gb|ADL70680.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  36   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  95

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  96   NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  151



>gb|ADB93631.2| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=152

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  37   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  96

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  97   NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  152



>gb|ADL70678.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=161

 Score =   214 bits (546),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  46   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  105

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  106  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  161



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL MY++Y QLSDALAKMFSSFT+GN G+QG IDFMNERKLMDLL
Sbjct  134  LVKVSMDGAPYLRKVDLNMYKTYPQLSDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  194  NDSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  249



>ref|XP_010418365.1| PREDICTED: auxin-responsive protein IAA16 [Camelina sativa]
Length=232

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  116  YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>gb|ADL70672.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70675.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=166

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  51   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  110

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  111  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>gb|ADL70671.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=167

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  51   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  110

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  111  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  166



>ref|NP_187124.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
 sp|O24407.1|IAA16_ARATH RecName: Full=Auxin-responsive protein IAA16; AltName: Full=Indoleacetic 
acid-induced protein 16 [Arabidopsis thaliana]
 gb|AAF04899.1|AC011437_14 auxin-induced protein [Arabidopsis thaliana]
 gb|AAG48764.1|AF332400_1 auxin-induced protein IAA16 [Arabidopsis thaliana]
 gb|AAK53004.1|AF375420_1 AT3g04730/F7O18_22 [Arabidopsis thaliana]
 gb|AAB84353.1| IAA16 [Arabidopsis thaliana]
 gb|AAM64751.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AAN38694.1| At3g04730/F7O18_22 [Arabidopsis thaliana]
 dbj|BAF01307.1| auxin-induced protein [Arabidopsis thaliana]
 gb|AEE74127.1| auxin-responsive protein IAA16 [Arabidopsis thaliana]
Length=236

 Score =   216 bits (551),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  120  YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  180  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  236



>gb|ADL70673.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
 gb|ADL70674.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=165

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  49   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  108

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  109  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  164



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+GN G+Q   DFMNE KL+DLL
Sbjct  136  FVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIGNCGSQVTKDFMNESKLIDLL  195

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  196  NGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   216 bits (550),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE +L+DLL
Sbjct  115  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTLGNYGPQGMKDFMNESRLIDLL  174

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  175  NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16 [Fragaria vesca subsp. 
vesca]
Length=254

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  138  FVKVSMDGAPYLRKVDLKLYQSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLL  197

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVP+YEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNR 
Sbjct  198  NGSEYVPSYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS  254



>ref|XP_010485858.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DF+NE KL+DLL
Sbjct  116  YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFLNESKLIDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>gb|EPS64756.1| hypothetical protein M569_10024, partial [Genlisea aurea]
Length=214

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTM--GNYGAQGMIDFMNERKLMD  515
            +VKV MDGAPYLRKVDLK Y SYQQLSDALAKMFSSFTM  GNYG +GMIDFMNE K+M 
Sbjct  96   YVKVSMDGAPYLRKVDLKTYGSYQQLSDALAKMFSSFTMNEGNYGVEGMIDFMNESKVMH  155

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  156  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVCSCKRLRIMKGSEAIGLAPRAMEKCKSR  213



>gb|KJB42200.1| hypothetical protein B456_007G141900 [Gossypium raimondii]
Length=235

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI-DFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY++YQQLSDALAKMFSSFT+GN G+QG++ DFMNE KLMDL
Sbjct  118  FVKVSMDGAPYLRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDL  177

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LN S+YVPTYEDKDGDWMLVGDVPWEMF++SCKRLRIMKG+EAIGLAPRA+EKCKNR 
Sbjct  178  LNGSDYVPTYEDKDGDWMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   216 bits (549),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+GNYG+QGM DFMNE KLMDLL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLL  187

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N  ++VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  188  NGFDHVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR  243



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQQLSDAL KMFSSFT+ N G QG  DFMNE KL+DLL
Sbjct  33   FVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIENCGTQGFKDFMNESKLIDLL  92

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  93   NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  148



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  183  FVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLL  242

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC
Sbjct  243  NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  299



>gb|KJB44871.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=158

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYG-AQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN G +QGM DFMNE KL+DL
Sbjct  29   FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDL  88

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LN SEYVPTYEDKDGDWML+GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK +
Sbjct  89   LNGSEYVPTYEDKDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  145



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   215 bits (547),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SYQ+LS+AL  MFSSFT+GNYG+QGM DFMNE KLMDLL
Sbjct  119  FVKVSMDGAPYLRKVDLKMYTSYQELSNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLL  178

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N  ++VPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  179  NGFDHVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR  234



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GNYG QGM DFMNE +L+DLL
Sbjct  175  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESRLIDLL  234

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  235  NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  291



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL KMFSSFT+GN G+ GM DFMNE KL+DLL
Sbjct  140  FVKVSMDGAPYLRKVDLKLYKSYQELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLL  199

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 
Sbjct  200  NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  256



>ref|NP_001241599.1| uncharacterized protein LOC100803065 [Glycine max]
 gb|ACU20028.1| unknown [Glycine max]
 gb|KHN03840.1| Auxin-induced protein AUX28 [Glycine soja]
Length=248

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLL
Sbjct  132  FVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLL  191

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVPTYED+DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR 
Sbjct  192  NSSDYVPTYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNRS  248



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNERKLMD+L
Sbjct  141  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  201  NGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>gb|ABI36487.1| AUX/IAA7 A [Malus domestica]
 gb|ABI36488.1| AUX/IAA7 B [Malus domestica]
Length=154

 Score =   211 bits (537),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNERKLMD+L
Sbjct  38   LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVL  97

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  98   NGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  153



>ref|XP_006298436.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
 gb|EOA31334.1| hypothetical protein CARUB_v10014507mg [Capsella rubella]
Length=241

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GN G QGM DFMNE KL+DLL
Sbjct  125  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESKLIDLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  185  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  241



>gb|KJB11141.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
 gb|KJB11144.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=253

 Score =   214 bits (545),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL+MY SY QLSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLL
Sbjct  137  LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  197  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>ref|XP_009124981.1| PREDICTED: auxin-responsive protein IAA16-like [Brassica rapa]
 emb|CDY21111.1| BnaA01g33420D [Brassica napus]
Length=236

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+G+YG QGM D +NE KL+DLL
Sbjct  120  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGSYGPQGMKDIVNEGKLIDLL  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  180  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   211 bits (538),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  59   FVKVSMDGAPYLRKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLL  118

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            + SEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR 
Sbjct  119  SGSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNRS  175



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   214 bits (544),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNI++ + +    A +   G   AAFVKV +DGAPYLRKVDLK ++SYQ+LS AL+KMFS
Sbjct  104  KNILSVQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKSYQELSQALSKMFS  163

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            S T+G+YG+Q   DFMNERKL+DLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR
Sbjct  164  SSTIGSYGSQEFKDFMNERKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  223

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKGSEA+GLAPRAVEKCKNR 
Sbjct  224  IMKGSEAVGLAPRAVEKCKNRS  245



>gb|ABI36493.1| AUX/IAA16 A [Malus domestica]
Length=149

 Score =   210 bits (535),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DFMNE KL+DLL
Sbjct  33   FVKVSMDGAPYLRKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLL  92

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            + SEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR
Sbjct  93   SGSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKYKNR  148



>gb|KJB44873.1| hypothetical protein B456_007G276900 [Gossypium raimondii]
Length=254

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGN-YGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDAL KMFSSFT+GN  G+QGM DFMNE KL+DL
Sbjct  125  FVKVSMDGAPYLRKVDLKLYKSYQELSDALGKMFSSFTVGNCGGSQGMKDFMNEGKLIDL  184

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LN SEYVPTYEDKDGDWML+GDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK +
Sbjct  185  LNGSEYVPTYEDKDGDWMLIGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKEQ  241



>gb|AFK36086.1| unknown [Lotus japonicus]
Length=257

 Score =   214 bits (544),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY+ LSD+LAKMFSSFT+G   +QGM DFMNE KLMDLL
Sbjct  141  FVKVSMDGAPYLRKVDLKMYKSYRDLSDSLAKMFSSFTIGTCESQGMKDFMNESKLMDLL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR 
Sbjct  201  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  257



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLK+Y+SYQ+LS AL+KMFSSFT+GN G+QGM DF+NE KL+DLL
Sbjct  135  FVKVSVDGAPYLRKVDLKLYKSYQELSTALSKMFSSFTIGNCGSQGMKDFVNESKLIDLL  194

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            + SEYVP+YEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  195  SGSEYVPSYEDKDGDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNR  250



>dbj|BAI94494.1| Aux/IAA protein [Dianthus caryophyllus]
Length=238

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+M  +       GE          VKV MDGAPYLRKV LKMY+SYQ+LSDAL KMFS
Sbjct  97   KNVMTLQKGTAGEEGETVDKSSSGGLVKVSMDGAPYLRKVHLKMYKSYQELSDALGKMFS  156

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
             FT+GNYG QGMIDFMNERKLMDLLN S+YVPTYEDKDGDWMLVGDVPW MFV+SCKR+R
Sbjct  157  FFTLGNYGEQGMIDFMNERKLMDLLNDSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRIR  216

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKG EA GLAPRA+EKCKNR
Sbjct  217  IMKGKEAAGLAPRAMEKCKNR  237



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVD+K+Y+SYQ+LSDALAKMFSSFT+   G+QGM DFMNE KL+DLL
Sbjct  115  FVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLL  174

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTY+DKDGDWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  175  NGSDYVPTYQDKDGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>gb|KHN18836.1| Auxin-induced protein AUX28 [Glycine soja]
Length=246

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLL
Sbjct  130  FVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLL  189

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYED+DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  190  NSSDYVPTYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAVEKCKNR  245



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVD+K+Y+SYQ+LSDALAKMFSSFT+   G+QGM DFMNE KL+DLL
Sbjct  115  FVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNETKLIDLL  174

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTY+DKDGDWMLVGDVPWEMFV+SC+RLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  175  NGSDYVPTYQDKDGDWMLVGDVPWEMFVESCQRLRIMKGSEAIGLAPRAVEKCKNR  230



>ref|XP_010463960.1| PREDICTED: auxin-responsive protein IAA16-like [Camelina sativa]
Length=232

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  116  YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+ VPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  176  NGSDCVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  232



>ref|XP_002884465.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60724.1| indoleacetic acid-induced protein 16 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+G YG QGM DFMNE  L+DLL
Sbjct  120  YVKVSMDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGTYGPQGMKDFMNESILIDLL  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  180  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  235



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+ N G+Q   DFMNE KL+DLL
Sbjct  137  FVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  197  NGSDYVPTYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNR  252



>ref|XP_010550916.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA16 
[Tarenaya hassleriana]
Length=212

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNER-KLMDL  512
            FVKV MDGAPYLRKVDLK+Y SY +LSDAL KMFSSFT GN+  QGM DFMNE  KL+DL
Sbjct  95   FVKVSMDGAPYLRKVDLKLYNSYHELSDALGKMFSSFTSGNHEQQGMNDFMNENNKLIDL  154

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LN SEY PTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+ KCKNRC
Sbjct  155  LNGSEYAPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRALVKCKNRC  212



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLL
Sbjct  134  FVKVSMDGAPYLRKVDLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N+S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR 
Sbjct  194  NNSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>emb|CDY63910.1| BnaC01g43640D [Brassica napus]
 emb|CDY30781.1| BnaC07g16810D [Brassica napus]
Length=240

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 108/118 (92%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKV LKMY+SYQ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMD L
Sbjct  124  LVKVSMDGAPYLRKVHLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNETKLMD-L  182

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK-CKNRC  338
            NSSEYVP+YEDKDGDWM VGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK  KNR 
Sbjct  183  NSSEYVPSYEDKDGDWMPVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYSKNRS  240



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   214 bits (544),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL+MY++Y +LSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLL
Sbjct  189  FVKVSMDGAPYLRKVDLRMYKTYLELSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLL  248

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  249  NGSDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEAIGLAPRAMEKCKNR  304



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/116 (86%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSDALAKMFSSFT+ N G+Q   DFMNE KL+DLL
Sbjct  137  FVKVSMDGAPYLRKVDLKLYKSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  197  NGSDYVPTYEDKDGDWMLVGDVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNR  252



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   212 bits (539),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGM--IDFMNERKLMD  515
            FVKV MDGAPYLRKVDLKMY SY++LS AL KMFSSFT GN G+QGM   DFMNE KLMD
Sbjct  133  FVKVSMDGAPYLRKVDLKMYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMD  192

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  193  LLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  250



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI-DFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY++YQQLSDALAKMFSSFT+GN G+QG++ DFMNE KLMDL
Sbjct  118  FVKVSMDGAPYLRKVDLRMYKTYQQLSDALAKMFSSFTIGNCGSQGLLKDFMNESKLMDL  177

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LN S+YVPTYEDKDGD MLVGDVPWEMF++SCKRLRIMKG+EAIGLAPRA+EKCKNR 
Sbjct  178  LNGSDYVPTYEDKDGDLMLVGDVPWEMFIESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+DLL
Sbjct  127  FVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLL  186

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKD DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  187  NGSDYVPTYEDKDADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   211 bits (538),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+DLL
Sbjct  127  FVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLL  186

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKD DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  187  NGSDYVPTYEDKDADWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  242



>gb|ACU18407.1| unknown [Glycine max]
Length=246

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLL
Sbjct  130  FVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLL  189

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYED+DGDWMLVGDVPWEMFV+SCKRL IMKG EAIGLAPRAVEKCKNR
Sbjct  190  NSSDYVPTYEDRDGDWMLVGDVPWEMFVESCKRLHIMKGKEAIGLAPRAVEKCKNR  245



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRK+DLKMY++YQ+LSDAL KMFSSFTMG    QGM+DFMNE KLMDLL
Sbjct  99   FVKVSMDGAPYLRKIDLKMYKTYQELSDALGKMFSSFTMGKCDTQGMMDFMNESKLMDLL  158

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            NSSEYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR+MKG+EA GLAPRA+EKCK+R 
Sbjct  159  NSSEYVPTYEDKDGDWMLVGDVPWQMFVESCKRLRVMKGTEAKGLAPRAMEKCKSRS  215



>ref|XP_009367750.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=259

 Score =   211 bits (538),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+L
Sbjct  143  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVL  202

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  203  NGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  258



>ref|XP_007034957.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
 gb|EOY05883.1| Indole-3-acetic acid inducible 14 isoform 2, partial [Theobroma 
cacao]
Length=204

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/104 (95%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  101  FVKVSMDGAPYLRKVDLKMYKSYQELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  160

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  377
            NSS+YVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG
Sbjct  161  NSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIG  204



>ref|XP_008235328.1| PREDICTED: auxin-induced protein AUX28-like [Prunus mume]
Length=253

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+L
Sbjct  137  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
              S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  197  KGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  252



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLL
Sbjct  129  FVKVSMDGAPYLRKVDLKIYNSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N+S+YVPTYEDKDGDWM+VGDVPWEMFV+SCKRLRIMKG EAIG+APRA+EKCKNR 
Sbjct  189  NNSDYVPTYEDKDGDWMVVGDVPWEMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  245



>gb|ACJ83896.1| unknown [Medicago truncatula]
 gb|AFK48514.1| unknown [Medicago truncatula]
 gb|KEH42620.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=245

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNE-RKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SY +LSDALAKMF+SFT GN  +QG+ DFMNE  KLMDL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFNSFTTGNCESQGIKDFMNESNKLMDL  187

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LNSS+YVPTYEDKDGDWMLVGDVPWEMF+DSCKRLRIMKG EAIGLAPRA+EKCKNR 
Sbjct  188  LNSSDYVPTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  245



>ref|XP_008372303.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+L
Sbjct  141  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+Y PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKNR
Sbjct  201  NGSDYTPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNR  256



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL+MY SY QLSDALAKMFSSFT+GN G+QGM DFMNE KLMDLL
Sbjct  137  LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDLL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGD MLVGDVPWEMFV+SCKRLRIMKG+EAIGLAP+AVEKCK R
Sbjct  197  NGSDYVPTYEDKDGDRMLVGDVPWEMFVESCKRLRIMKGTEAIGLAPKAVEKCKKR  252



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV +DGAPYLRKVDLKMY+SY +LS+AL KMFSSFT+GN G  G  DFMNE KL+DLL
Sbjct  109  LVKVSVDGAPYLRKVDLKMYKSYHELSEALGKMFSSFTIGNCGTHGFKDFMNESKLIDLL  168

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  169  NGSDYVPTYEDKDGDWMLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  224



>ref|XP_008462706.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Cucumis 
melo]
Length=232

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            F+KV M+GAPYLRKVDLKMYESYQQL DAL+KMF SFT GN GAQ M D+MNERKL D+L
Sbjct  116  FIKVSMEGAPYLRKVDLKMYESYQQLFDALSKMFGSFTTGNCGAQKMKDYMNERKLKDVL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWDMFVNSCKRLRIMKGSEAIGLAPRALEKCKNR  231



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+GN G+QGM DF+NE KL+DLL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGNCGSQGMKDFLNESKLIDLL  187

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EK KNR 
Sbjct  188  NGTDYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRIMKGTEATGLAPRAMEKRKNRS  244



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   209 bits (533),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY++Y++LSDAL KMFSSFTM    AQGM+DFMNE KLMDLL
Sbjct  111  FVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSSFTMSKCDAQGMMDFMNESKLMDLL  170

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+EAIGLAPRA+EKCK+R
Sbjct  171  NGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCKSR  226



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 117/143 (82%), Gaps = 2/143 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KNI++  S      G +  G   AAFVKV MDGAPYLRKVDLKMY SYQ+LS  L KMF 
Sbjct  100  KNILSAHSEKGSKEGGEKPGNPVAAFVKVSMDGAPYLRKVDLKMYRSYQELSMGLQKMFG  159

Query  583  SFTMGNYGAQGMI--DFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  410
            SFT GN G+QGM   DFMNER++MDLLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR
Sbjct  160  SFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  219

Query  409  LRIMKGSEAIGLAPRAVEKCKNR  341
            LRIMKGSEAIGLAPRA+EKCKNR
Sbjct  220  LRIMKGSEAIGLAPRAMEKCKNR  242



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGM--IDFMNERKLMD  515
            FVKVCMDGAPYLRKVDLKMY SYQ+LS AL KMFSSFT  N G+QGM   DF NE KLMD
Sbjct  130  FVKVCMDGAPYLRKVDLKMYRSYQELSMALEKMFSSFTSANCGSQGMNGRDFTNEGKLMD  189

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            L+N SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCK+R
Sbjct  190  LINGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSR  247



>emb|CDY41894.1| BnaC05g47100D [Brassica napus]
Length=231

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV +DGAPYLRK+DLK+Y++YQ LSDAL+KMFSSFT+GN G QGM DFMNE +L+DLL
Sbjct  115  YVKVSLDGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTIGNCGPQGMKDFMNESRLIDLL  174

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPW MFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR 
Sbjct  175  NGSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS  231



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY QLSD+L KMFSSFT+GN  +QGM DFMNE KLMDLL
Sbjct  134  FVKVSMDGAPYLRKVDLKMYTSYSQLSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N+S+YVPTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKG EAIG+APRA+EKCKNR 
Sbjct  194  NNSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY++YQ+LSDAL KMFSSFT+GN G+ G+ DF+NE KL+DLL
Sbjct  119  FVKVSMDGAPYLRKVDLKMYKTYQELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLL  178

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCKNR
Sbjct  179  NGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR  234



>gb|KEH42778.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=239

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN+MAQK +  E   + +     AAFVKV MDGAPYLRKVDL MY++Y+ LSDALAKMFS
Sbjct  95   KNMMAQKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTYKDLSDALAKMFS  154

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT GNYGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLR
Sbjct  155  SFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLR  214

Query  403  IMKGSEAIGLA  371
            IMKGSEAIGL 
Sbjct  215  IMKGSEAIGLG  225



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SYQ+LSDAL KMFSSFT+G   +QGM+DFMNE KLMDLL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYKSYQELSDALGKMFSSFTIGKCDSQGMMDFMNESKLMDLL  187

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+EA GLAPRA+EKCK+R
Sbjct  188  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAKGLAPRAMEKCKSR  243



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFS
Sbjct  94   KNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGKMFS  153

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GN G+ GM DF+NE KL+DLLN ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKG+EA GLAPRA+EKCKNR 
Sbjct  214  IMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_009354870.1| PREDICTED: auxin-induced protein AUX28-like [Pyrus x bretschneideri]
Length=257

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSFT+GN G+QGM DFMNE KLMD+L
Sbjct  141  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFTIGNCGSQGMKDFMNESKLMDVL  200

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKN  344
            N S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMK  EA+GLAPRA+EKCKN
Sbjct  201  NGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKN  255



>ref|XP_007201400.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
 gb|EMJ02599.1| hypothetical protein PRUPE_ppa010342mg [Prunus persica]
Length=253

 Score =   209 bits (533),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDLKMY+SY +LSDALAKMFSSF +GN G+QGM DFMNE KLMD+L
Sbjct  137  LVKVSMDGAPYLRKVDLKMYKSYPELSDALAKMFSSFAIGNCGSQGMKDFMNESKLMDVL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
              S+Y+PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EA+GLAPRA+EKCKNR
Sbjct  197  KGSDYIPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR  252



>ref|XP_007144686.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
 gb|ESW16680.1| hypothetical protein PHAVU_007G176600g [Phaseolus vulgaris]
Length=245

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY +LSDAL KMFSSFT+GN  +QG  DFMNE KLMDLL
Sbjct  129  FVKVSMDGAPYLRKVDLKMYKSYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDLL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+ VPTYED+DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  189  NSSDCVPTYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   209 bits (531),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMD  515
            FVKV MDGAPYLRKVDLKMY SY +LS AL KMFS+FT GN G+QGM   DFMNE K+MD
Sbjct  123  FVKVSMDGAPYLRKVDLKMYRSYHELSMALQKMFSTFTGGNCGSQGMSGRDFMNESKVMD  182

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  183  LLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR  240



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMD  515
            FVKV MDGAPYLRKVDLKMY SYQ+L  AL KMF SFT GNYG+QG+   DFMNE K+MD
Sbjct  126  FVKVSMDGAPYLRKVDLKMYRSYQELFMALQKMFISFTGGNYGSQGLSGRDFMNESKVMD  185

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            LLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+A+EKCKNR 
Sbjct  186  LLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  244



>emb|CDY30017.1| BnaC01g39910D [Brassica napus]
Length=237

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLM-DL  512
            +VK+ MDGAPYLRK+DLK+Y++YQ LSD L+KMFSSFT+G+YG QGM D +NE KLM DL
Sbjct  120  YVKISMDGAPYLRKIDLKLYKAYQDLSDTLSKMFSSFTIGSYGPQGMKDIVNEGKLMIDL  179

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LN S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EKCKNR
Sbjct  180  LNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNR  236



>ref|XP_004142529.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 ref|XP_004170021.1| PREDICTED: auxin-responsive protein IAA16-like [Cucumis sativus]
 gb|KGN66786.1| hypothetical protein Csa_1G690240 [Cucumis sativus]
Length=236

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            F+KV MDGAPYLRKVDLKMY SYQ+LSDAL KMF+SFT G  GAQ M D+MNERKL+D+ 
Sbjct  120  FIKVSMDGAPYLRKVDLKMYGSYQELSDALRKMFASFTAGQCGAQKMRDYMNERKLIDVS  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  180  NGSDYVPTYEDKDGDWMLVGDVPWDMFVDSCKRLRIMKGSEAIGLAPRALEKCKNR  235



>gb|KHN30563.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=233

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/106 (92%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY+SY+ LSDALAKMFSSFTMGNYGAQGMIDFMNE KLMDLL
Sbjct  120  FVKVSMDGAPYLRKVDLTMYKSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLL  179

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  371
            NSSEYVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGL 
Sbjct  180  NSSEYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGSEAIGLG  225



>ref|XP_006443921.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 ref|XP_006479598.1| PREDICTED: auxin-induced protein AUX28-like [Citrus sinensis]
 gb|ESR57161.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=232

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL+MY +Y+ L DAL KMFSSFT+GN G+QGM DFMNE KLMDLL
Sbjct  116  FVKVSMDGAPYLRKVDLRMYNTYKDLYDALGKMFSSFTIGNCGSQGMKDFMNESKLMDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPRA+EKCKNR
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 106/116 (91%), Gaps = 4/116 (3%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL MY+SYQ+LSDALAKMF+SFT+     QGM DFMNERKLMDLL
Sbjct  101  LVKVSMDGAPYLRKVDLNMYKSYQELSDALAKMFNSFTI----VQGMKDFMNERKLMDLL  156

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYEDKDGDWMLVGDVPW MFVDSCKRLRIMKG+EAIGLAPRA+EKCKNR
Sbjct  157  NSSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGTEAIGLAPRAMEKCKNR  212



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFT-MGNYGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SY+QLSDALA MF SFT +GN G+Q M DFMNE KLMDL
Sbjct  113  FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDL  172

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            L+ S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR 
Sbjct  173  LSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS  230



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL+MY +YQ L  AL KMFSSFT+GN G+QGM DFMNE KLMDLL
Sbjct  116  FVKVSMDGAPYLRKVDLRMYNTYQDLYHALGKMFSSFTIGNCGSQGMKDFMNESKLMDLL  175

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPW MFV+SCKRLRI+KG+EAIGLAPRA+EKCKNR
Sbjct  176  NGSDYVPTYEDKDGDWMLVGDVPWGMFVESCKRLRIVKGTEAIGLAPRAMEKCKNR  231



>ref|XP_007147174.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
 gb|ESW19168.1| hypothetical protein PHAVU_006G102100g [Phaseolus vulgaris]
Length=272

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+LSD+LAKMFSSFT+    +QGM DFMNE KL+D L
Sbjct  156  FVKVSMDGAPYLRKVDLKVYKSYQELSDSLAKMFSSFTIDKCESQGMKDFMNETKLIDFL  215

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNR 
Sbjct  216  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKRKNRS  272



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   207 bits (527),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQ+LS AL KMFSSFT+G+ G+QGM + MNE KL+DLL
Sbjct  149  FVKVSLDGAPYLRKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLL  207

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  208  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  264



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            +N++A +SS      E+      A +VKV MDGAPYLRKVDL MY+SYQ LS++L KMFS
Sbjct  98   RNMLATQSSKGNNRSEEGEKNAGATYVKVSMDGAPYLRKVDLNMYKSYQDLSNSLEKMFS  157

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
             FTMG  G+QG I+F+NE KLMDLLN SEYVPTYED+DGDWMLVGDVPWEMFVDSC+RLR
Sbjct  158  CFTMGQCGSQG-INFLNESKLMDLLNGSEYVPTYEDRDGDWMLVGDVPWEMFVDSCRRLR  216

Query  403  IMKGSEAIGLAPRAVEKCKNR  341
            IMKGSEAIGLAPRAVEKCKNR
Sbjct  217  IMKGSEAIGLAPRAVEKCKNR  237



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score =   207 bits (528),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY+SYQ+LS AL KMFSSFT+G+ G+QGM + MNE KL+DLL
Sbjct  166  FVKVSLDGAPYLRKVDLKMYKSYQELSKALEKMFSSFTIGSCGSQGM-NGMNESKLVDLL  224

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  225  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  281



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   207 bits (526),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY++YQ LS AL KMFSSFT+GN G QGM + MNE KLMDLL
Sbjct  137  FVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLL  195

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  196  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>gb|KJB11145.1| hypothetical protein B456_001G242900 [Gossypium raimondii]
Length=261

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/124 (80%), Positives = 107/124 (86%), Gaps = 8/124 (6%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL+MY SY QLSDALAKMFSSFT+GN G+QG+ DFMNE KLMDLL
Sbjct  137  LVKVSMDGAPYLRKVDLRMYTSYHQLSDALAKMFSSFTIGNCGSQGIKDFMNESKLMDLL  196

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGL--------APRAVEK  353
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG+EAIGL        AP+AVEK
Sbjct  197  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGTEAIGLENYMLIIAAPKAVEK  256

Query  352  CKNR  341
            CK R
Sbjct  257  CKKR  260



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   206 bits (525),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY++YQ LS AL KMFSSFT+GN G QGM + MNE KLMDLL
Sbjct  137  FVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMFSSFTIGNCGTQGM-NGMNESKLMDLL  195

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  196  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  251



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   206 bits (524),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMD  515
            FVKV MDGAPYLRK+DLKMY SYQ+LS AL KMFSSFT+GN  +QG+   DFMNE KLMD
Sbjct  120  FVKVSMDGAPYLRKIDLKMYRSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMD  179

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            L+N SEYVPTYEDKDGDWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAP+A+EKCKN+
Sbjct  180  LINGSEYVPTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNK  237



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R 
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA  229



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL
Sbjct  109  FVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDL  168

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R 
Sbjct  169  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA  226



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   206 bits (524),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMD  515
            FVKV MDGAPYLRK+DLKMY SYQ+LS AL KMFSSFT+GN  +QG+   DFMNE KLMD
Sbjct  123  FVKVSMDGAPYLRKIDLKMYSSYQELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMD  182

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAP+ +EKCKN+
Sbjct  183  LLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQ  240



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   205 bits (522),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFT-MGNYGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDLKMY+SY+QLSDALA MF SFT +GN G+Q M DFMNE KLMDL
Sbjct  113  FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDL  172

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            L+ S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKR+RIMKG EAIGLAPRA+EKCKNR 
Sbjct  173  LSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRVRIMKGKEAIGLAPRAMEKCKNRS  230



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 106/118 (90%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGM--IDFMNERKLMD  515
             VKV MDGAPYLRKVDLK+Y SY++LS AL KMFSSFT GN G+QGM   DFMNE KLMD
Sbjct  123  LVKVSMDGAPYLRKVDLKIYSSYKELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMD  182

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLN SEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR+MKGSEAIGLAPRA+EKCKNR
Sbjct  183  LLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNR  240



>ref|XP_007162490.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
 gb|ESW34484.1| hypothetical protein PHAVU_001G156600g [Phaseolus vulgaris]
Length=246

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 107/119 (90%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY++LSD+L KMFSSFT+GN  +QGM DFMNE KLMDLL
Sbjct  128  FVKVSMDGAPYLRKVDLKMYQSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLL  187

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ K KNR 
Sbjct  188  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  246



>gb|AGV54230.1| auxin-induced protein AUX28 [Phaseolus vulgaris]
Length=245

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY++Y +LSDAL KMFSSFT+GN  +QG  DFMNE KLMD L
Sbjct  129  FVKVSMDGAPYLRKVDLKMYKNYPELSDALGKMFSSFTIGNCESQGFKDFMNESKLMDFL  188

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+ VPTYED+DGDWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRA+EKCKNR
Sbjct  189  NSSDCVPTYEDRDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNR  244



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLK+Y+SYQ+L DALAKMFSSFT+   G+QGM DFMNE KL+D  
Sbjct  127  FVKVSMDGAPYLRKVDLKLYKSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFF  186

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKD DWMLVGDVPWEMFV+SCKRLRIMKG EAIGLAPRAVEKCKNR
Sbjct  187  NGSDYVPTYEDKDADWMLVGDVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNR  242



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLL
Sbjct  156  FVKVSLDGAPYLRKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLL  214

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  215  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  270



>ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium 
distachyon]
Length=249

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDL MY++YQ LS AL KMFSSFT+GN G+QGM + MNE KLMDLL
Sbjct  134  FVKVSMDGAPYLRKVDLNMYKTYQDLSMALHKMFSSFTIGNCGSQGM-NGMNESKLMDLL  192

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRC  338
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR 
Sbjct  193  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  249



>gb|ACF87179.1| unknown [Zea mays]
 gb|ADX60115.1| AUX/IAA transcription factor [Zea mays]
Length=276

 Score =   206 bits (524),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLL
Sbjct  161  FVKVSLDGAPYLRKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLL  219

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  220  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  275



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
             VKV MDGAPYLRKVDL MY++YQQLSDAL+ MFSSFT+GN   QGM DFMNERKLMDLL
Sbjct  79   LVKVSMDGAPYLRKVDLNMYKNYQQLSDALSNMFSSFTIGNCEVQGMKDFMNERKLMDLL  138

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NS ++VPT+EDKDGDWMLVGDVPW MFV+SCKRLRIMKG+EAIGLAP+ +EKCKNR
Sbjct  139  NSCDFVPTFEDKDGDWMLVGDVPWGMFVESCKRLRIMKGTEAIGLAPKTMEKCKNR  194



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY++YQ+LS AL +MFSSFT+GN G+ G+ DF+NE KL+DLL
Sbjct  119  FVKVSMDGAPYLRKVDLKMYKTYQELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLL  178

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRIMKG+EA GLAPRA+EKCKNR
Sbjct  179  NGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNR  234



>ref|NP_001150626.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG39802.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
Length=275

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/116 (84%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV +DGAPYLRKVDLKMY SYQQLS AL  MFSSFT+G+ G+QGM + MNE KL+DLL
Sbjct  160  FVKVSLDGAPYLRKVDLKMYRSYQQLSKALENMFSSFTIGSCGSQGM-NGMNESKLVDLL  218

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  219  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  274



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 105/118 (89%), Gaps = 2/118 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMI--DFMNERKLMD  515
             VKV MDGAPYLRKVDLKMY SYQ+LS AL KMFSSFT GN G+QGM   DFMNE KLMD
Sbjct  132  LVKVSMDGAPYLRKVDLKMYRSYQELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMD  191

Query  514  LLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            LLN SEYVPTYEDKDGD MLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  192  LLNGSEYVPTYEDKDGDLMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  249



>gb|ADL70676.1| indole-3-acetic acid inducible 16 [Arabidopsis thaliana]
Length=149

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            +VKV MDGAPYLRK+DLK+Y++YQ LS+AL+KMFSSFT+GNYG QGM DFMNE KL+DLL
Sbjct  40   YVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDFMNESKLIDLL  99

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAV  359
            N S+YVPTYEDKDGDWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+
Sbjct  100  NGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAL  149



>gb|KHN02537.1| Auxin-induced protein AUX28 [Glycine soja]
Length=252

 Score =   204 bits (520),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLL
Sbjct  134  FVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR 
Sbjct  194  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|NP_001236693.1| auxin-induced protein AUX28 [Glycine max]
 sp|P13089.1|AUX28_SOYBN RecName: Full=Auxin-induced protein AUX28 [Glycine max]
 gb|AAA33945.1| auxin-regulated protein (Aux28) [Glycine max]
Length=243

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLL
Sbjct  125  FVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLL  184

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR 
Sbjct  185  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  243



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL
Sbjct  113  FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDL  172

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  173  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  229



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY+SY +LS+AL+ MFSSFTMG YG + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKYGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -2

Query  763  KNIMAQksspeeaageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFS  584
            KN++A + S  +        GG A FVKV MDGAPYLRKVDLKMY++Y +LSDAL +MFS
Sbjct  94   KNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYHELSDALGEMFS  153

Query  583  SFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLR  404
            SFT+GN G+ GM DF+NE KL+DLL  ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKRLR
Sbjct  154  SFTIGNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDKDGDWMLVGDVPWDMFVESCKRLR  213

Query  403  IMKGSEAIGLAPRAVEKCKNRC  338
            IMKG+EA GLAPRA+EKCK+R 
Sbjct  214  IMKGTEATGLAPRAMEKCKSRS  235



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   203 bits (516),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY+SY +LS AL+ MFSSFTMG YG + GMIDFMNERKLMDL
Sbjct  107  FVKVSMDGAPYLRKVDLRMYKSYDELSTALSNMFSSFTMGKYGGEEGMIDFMNERKLMDL  166

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  167  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  223



>ref|XP_004495391.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Cicer 
arietinum]
Length=244

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = -2

Query  763  KNIMAQksspeea--ageksggggpaAFVKVCMDGAPYLRKVDLKMYESYQQLSDALAKM  590
            KN+MAQK +  +     + +       FVKV MDGAPYLRKVDL MY +Y+ LSDALAKM
Sbjct  97   KNMMAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYNTYKDLSDALAKM  156

Query  589  FSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKR  410
            FSSFT G YGAQGMIDFMNE KLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV+SCKR
Sbjct  157  FSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVESCKR  216

Query  409  LRIMKGSEAIGLA  371
            LRIMKGSEAIGL 
Sbjct  217  LRIMKGSEAIGLG  229



>gb|EYU46510.1| hypothetical protein MIMGU_mgv1a013084mg [Erythranthe guttata]
Length=231

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY++Y++LSDAL KMFSSFT+G   +QGM+DFM+E KLMDLL
Sbjct  115  FVKVSMDGAPYLRKVDLKMYKTYKELSDALGKMFSSFTIGKCDSQGMMDFMSESKLMDLL  174

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG+EA GLAP+A++KCK R
Sbjct  175  NSSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAKGLAPKAMDKCKTR  230



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY+SY +LS+AL+ MFSSFT+G YG + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTLGKYGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|ACU21378.1| unknown [Glycine max]
Length=252

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 105/119 (88%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDG PYLRKVDLKMY+SY++LSD+L KMFSSFT GN  +QGM DFMNE KL DLL
Sbjct  134  FVKVSMDGTPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDFMNESKLNDLL  193

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ KCKNR 
Sbjct  194  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS  252



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRKVDL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKVDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>gb|EEE53551.1| hypothetical protein OsJ_36765 [Oryza sativa Japonica Group]
Length=183

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY +LS AL KMFSSFT+GN G+ G ++ MNE K+ DLL
Sbjct  68   FVKVSMDGAPYLRKVDLKMYKSYLELSKALEKMFSSFTIGNCGSHG-VNGMNESKIADLL  126

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N SEYVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EKCKNR
Sbjct  127  NGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNR  182



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL
Sbjct  111  FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDL  170

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  171  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  227



>gb|AAC39440.1| IAA17/AXR3-1 protein [Arabidopsis thaliana]
Length=229

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 109/117 (93%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQ-GMIDFMNERKLMDL  512
            FVKV MDGAPYLRK+DL+MY+SY +LS+AL+ MFSSFTMG +G + GMIDFMNERKLMDL
Sbjct  112  FVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDL  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            +NS +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>emb|CAB46059.1| IAA7 like protein [Arabidopsis thaliana]
 emb|CAB78497.1| IAA7 like protein [Arabidopsis thaliana]
Length=234

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/106 (90%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY SY+ LSDALAKMFSSFTMG+YGAQGMIDFMNE K+MDLL
Sbjct  112  FVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLL  171

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA  371
            NSSEYVP+YEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEAIGL 
Sbjct  172  NSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLG  217



>ref|XP_003521268.1| PREDICTED: auxin-induced protein AUX28-like [Glycine max]
 gb|KHN10705.1| Auxin-induced protein AUX28 [Glycine soja]
Length=254

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 106/119 (89%), Gaps = 2/119 (2%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+SY++LSD+L KMFSSFT+GN  +QGM DFMNE KL DLL
Sbjct  136  FVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTIGNCESQGMKDFMNESKLNDLL  195

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAI--GLAPRAVEKCKNRC  338
            NSS+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKG EAI  GLAPRA+ K KNR 
Sbjct  196  NSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKSKNRS  254



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMG-NYGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTMG N G +GMIDFMNERK+MD 
Sbjct  112  FVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMDT  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            ++S +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VSSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMG-NYGAQGMIDFMNERKLMDL  512
            FVKV MDGAPYLRK+DLKMY+SY +LSDAL+ MFSSFTMG N G +GMIDFMNERK+MD 
Sbjct  112  FVKVSMDGAPYLRKIDLKMYKSYDELSDALSNMFSSFTMGKNGGEEGMIDFMNERKVMDT  171

Query  511  LNSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            ++S +YVP+YEDKDGDWMLVGDVPW MFVD+CKRLR+MKGS+AIGLAPRA+EKCK+R
Sbjct  172  VSSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSR  228



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 103/116 (89%), Gaps = 6/116 (5%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVD+K+Y+SYQ+LSDALAKMFSSFT+   G+QGM DFMNE       
Sbjct  117  FVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMFSSFTIEKCGSQGMKDFMNE------T  170

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEKCKNR
Sbjct  171  NGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNR  226



>ref|XP_003554705.1| PREDICTED: auxin-responsive protein IAA16-like isoform 1 [Glycine 
max]
 gb|KHN43187.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=230

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/116 (81%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  688  FVKVCMDGAPYLRKVDLKMYESYQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLL  509
            FVKV MDGAPYLRKVDLKMY+S+Q+L DALAKMFSSFT+    +QGM DFMNE KL+DLL
Sbjct  114  FVKVSMDGAPYLRKVDLKMYKSHQELLDALAKMFSSFTIDKCSSQGMKDFMNEGKLIDLL  173

Query  508  NSSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR  341
            N S+YVPT EDKDGDWMLVGDVPWE+ V+SCKRLRIMKGS AIGLAPRAV+KCKNR
Sbjct  174  NGSDYVPTCEDKDGDWMLVGDVPWEILVESCKRLRIMKGSAAIGLAPRAVQKCKNR  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680