BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013B11

Length=727
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598779.1|  PREDICTED: asparagine synthetase [glutamine-...    338   5e-111   
emb|CDP01451.1|  unnamed protein product                                334   1e-107   Coffea canephora [robusta coffee]
ref|XP_009759010.1|  PREDICTED: asparagine synthetase [glutamine-...    333   3e-107   Nicotiana sylvestris
ref|XP_008233969.1|  PREDICTED: asparagine synthetase [glutamine-...    322   5e-103   Prunus mume [ume]
ref|XP_007047958.1|  Asparagine synthetase 3 isoform 3                  322   8e-103   
ref|XP_002306310.2|  hypothetical protein POPTR_0005s07720g             318   2e-101   
gb|ABK95431.1|  unknown                                                 318   3e-101   Populus trichocarpa [western balsam poplar]
ref|XP_011031010.1|  PREDICTED: asparagine synthetase [glutamine-...    317   4e-101   Populus euphratica
ref|XP_007047956.1|  Asparagine synthetase 3 isoform 1                  317   5e-101   
ref|XP_010027848.1|  PREDICTED: asparagine synthetase [glutamine-...    317   7e-101   
gb|KDO56575.1|  hypothetical protein CISIN_1g012773mg                   312   1e-100   Citrus sinensis [apfelsine]
ref|XP_004143467.1|  PREDICTED: asparagine synthetase [glutamine-...    314   8e-100   Cucumis sativus [cucumbers]
ref|XP_004288204.2|  PREDICTED: asparagine synthetase [glutamine-...    315   1e-99    Fragaria vesca subsp. vesca
ref|XP_011097578.1|  PREDICTED: asparagine synthetase [glutamine-...    312   2e-99    Sesamum indicum [beniseed]
ref|XP_006428190.1|  hypothetical protein CICLE_v10025269mg             312   2e-99    Citrus clementina [clementine]
ref|XP_002531258.1|  asparagine synthetase, putative                    312   4e-99    Ricinus communis
ref|XP_010087589.1|  Glutamine-dependent asparagine synthetase 2        313   5e-99    
ref|XP_008440595.1|  PREDICTED: asparagine synthetase [glutamine-...    311   1e-98    Cucumis melo [Oriental melon]
ref|XP_010453051.1|  PREDICTED: asparagine synthetase [glutamine-...    310   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_008369048.1|  PREDICTED: asparagine synthetase [glutamine-...    309   6e-98    
ref|XP_006394086.1|  hypothetical protein EUTSA_v10003890mg             309   8e-98    Eutrema salsugineum [saltwater cress]
gb|KDP46836.1|  hypothetical protein JCGZ_24045                         309   8e-98    Jatropha curcas
ref|XP_009364610.1|  PREDICTED: asparagine synthetase [glutamine-...    309   8e-98    Pyrus x bretschneideri [bai li]
ref|XP_009343558.1|  PREDICTED: asparagine synthetase [glutamine-...    308   2e-97    Pyrus x bretschneideri [bai li]
gb|ACK44501.1|  AT5G10240-like protein                                  303   3e-97    Arabidopsis arenosa
gb|AAM94340.1|  asparagine synthetase                                   307   3e-97    Striga hermonthica [purple witchweed]
ref|XP_010917498.1|  PREDICTED: asparagine synthetase [glutamine-...    308   3e-97    Elaeis guineensis
gb|KFK25345.1|  hypothetical protein AALP_AA8G100600                    307   4e-97    Arabis alpina [alpine rockcress]
ref|XP_009417634.1|  PREDICTED: asparagine synthetase [glutamine-...    306   9e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010027849.1|  PREDICTED: asparagine synthetase [glutamine-...    306   9e-97    
ref|XP_002438207.1|  hypothetical protein SORBIDRAFT_10g009590          306   1e-96    Sorghum bicolor [broomcorn]
ref|XP_010519584.1|  PREDICTED: asparagine synthetase [glutamine-...    305   1e-96    Tarenaya hassleriana [spider flower]
ref|XP_008812468.1|  PREDICTED: asparagine synthetase [glutamine-...    306   1e-96    Phoenix dactylifera
ref|XP_004237391.1|  PREDICTED: asparagine synthetase [glutamine-...    304   2e-96    Solanum lycopersicum
emb|CAB92065.1|  asparagine synthetase (ASN3)(fragment)                 300   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484303.1|  PREDICTED: asparagine synthetase [glutamine-...    305   3e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010484304.1|  PREDICTED: asparagine synthetase [glutamine-...    305   3e-96    Camelina sativa [gold-of-pleasure]
gb|KFK28186.1|  hypothetical protein AALP_AA8G483400                    304   3e-96    Arabis alpina [alpine rockcress]
ref|XP_010462467.1|  PREDICTED: asparagine synthetase [glutamine-...    305   4e-96    Camelina sativa [gold-of-pleasure]
ref|XP_004984566.1|  PREDICTED: asparagine synthetase [glutamine-...    304   5e-96    Setaria italica
gb|EPS71106.1|  asparagine synthetase                                   303   6e-96    Genlisea aurea
ref|XP_009150576.1|  PREDICTED: asparagine synthetase [glutamine-...    303   7e-96    Brassica rapa
ref|XP_006655987.1|  PREDICTED: asparagine synthetase [glutamine-...    304   8e-96    Oryza brachyantha
ref|XP_006355345.1|  PREDICTED: asparagine synthetase [glutamine-...    303   9e-96    Solanum tuberosum [potatoes]
ref|XP_010266657.1|  PREDICTED: asparagine synthetase [glutamine-...    303   1e-95    Nelumbo nucifera [Indian lotus]
gb|KJB48986.1|  hypothetical protein B456_008G096300                    303   1e-95    Gossypium raimondii
gb|AAC72836.1|  asparagine synthetase                                   303   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399518.1|  hypothetical protein EUTSA_v10013088mg             303   2e-95    Eutrema salsugineum [saltwater cress]
ref|XP_010422870.1|  PREDICTED: asparagine synthetase [glutamine-...    302   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010491681.1|  PREDICTED: asparagine synthetase [glutamine-...    302   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_003601953.1|  Asparagine synthetase                              302   2e-95    Medicago truncatula
ref|XP_010547614.1|  PREDICTED: asparagine synthetase [glutamine-...    301   4e-95    Tarenaya hassleriana [spider flower]
ref|XP_002873446.1|  hypothetical protein ARALYDRAFT_908981             301   5e-95    Arabidopsis lyrata subsp. lyrata
ref|NP_001031864.1|  asparagine synthetase 3                            301   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196586.1|  asparagine synthetase 3                               301   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287293.1|  hypothetical protein CARUB_v10000487mg             302   7e-95    
ref|NP_001057340.1|  Os06g0265000                                       300   1e-94    
emb|CAN82675.1|  hypothetical protein VITISV_034450                     301   2e-94    Vitis vinifera
ref|XP_003538618.1|  PREDICTED: asparagine synthetase [glutamine-...    300   2e-94    Glycine max [soybeans]
ref|XP_010444467.1|  PREDICTED: asparagine synthetase [glutamine-...    300   2e-94    
ref|XP_006280142.1|  hypothetical protein CARUB_v10026039mg             302   2e-94    
emb|CDY14529.1|  BnaC03g49300D                                          299   4e-94    Brassica napus [oilseed rape]
gb|AAF02776.1|AF190729_1  asparagine synthetase                         298   6e-94    Helianthus annuus
gb|KJB48987.1|  hypothetical protein B456_008G096300                    298   8e-94    Gossypium raimondii
ref|XP_004502424.1|  PREDICTED: asparagine synthetase [glutamine-...    298   1e-93    Cicer arietinum [garbanzo]
ref|XP_003552061.1|  PREDICTED: asparagine synthetase [glutamine-...    297   2e-93    
ref|XP_003568184.1|  PREDICTED: asparagine synthetase [glutamine-...    298   2e-93    Brachypodium distachyon [annual false brome]
ref|XP_007047957.1|  Asparagine synthetase 3 isoform 2                  296   3e-93    
ref|NP_001278720.1|  asparagine synthetase [glutamine-hydrolyzing]      295   2e-92    Zea mays [maize]
ref|XP_007163648.1|  hypothetical protein PHAVU_001G252200g             294   3e-92    Phaseolus vulgaris [French bean]
ref|XP_009131148.1|  PREDICTED: asparagine synthetase [glutamine-...    294   3e-92    Brassica rapa
ref|NP_851272.1|  asparagine synthetase 2                               293   5e-92    Arabidopsis thaliana [mouse-ear cress]
emb|CDX81165.1|  BnaC03g04190D                                          293   6e-92    
gb|AAZ66934.1|  117M18_15                                               294   6e-92    Brassica rapa
emb|CDX78372.1|  BnaA03g02840D                                          293   9e-92    
ref|XP_002864935.1|  hypothetical protein ARALYDRAFT_496723             292   2e-91    
gb|AAC72837.1|  asparagine synthetase                                   291   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|EMT31774.1|  Asparagine synthetase (glutamine-hydrolyzing)           291   4e-91    
ref|XP_010680552.1|  PREDICTED: asparagine synthetase [glutamine-...    291   5e-91    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ84981.1|  predicted protein                                      291   6e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFZ85291.1|  asparagine synthetase                                   290   2e-90    Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
dbj|BAK06280.1|  predicted protein                                      290   2e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_201306.2|  asparagine synthetase 2                               289   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207234.1|  hypothetical protein PRUPE_ppa015268mg             288   5e-90    
gb|ABQ58084.1|  asparagine synthetase                                   274   3e-89    Arachis diogoi
ref|XP_004169772.1|  PREDICTED: asparagine synthetase [glutamine-...    283   9e-89    
gb|ABR16560.1|  unknown                                                 284   3e-88    Picea sitchensis
ref|XP_004143163.1|  PREDICTED: asparagine synthetase [glutamine-...    284   4e-88    Cucumis sativus [cucumbers]
ref|XP_008465262.1|  PREDICTED: asparagine synthetase [glutamine-...    283   8e-88    Cucumis melo [Oriental melon]
ref|XP_006828491.1|  hypothetical protein AMTR_s00060p00168860          283   8e-88    Amborella trichopoda
gb|ADU02856.1|  asparagine synthetase                                   283   9e-88    Pinus pinaster [cluster pine]
gb|AAU89392.1|  glutamine-dependent asparagine synthetase               282   1e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003579059.1|  PREDICTED: asparagine synthetase [glutamine-...    282   1e-87    Brachypodium distachyon [annual false brome]
gb|ADK13052.1|  asparagine synthetase                                   282   1e-87    Pinus pinaster [cluster pine]
gb|EMT27682.1|  Asparagine glutamine-hydrolyzing synthetase             281   3e-87    
ref|XP_010907409.1|  PREDICTED: asparagine synthetase [glutamine-...    281   4e-87    Elaeis guineensis
ref|XP_009402383.1|  PREDICTED: asparagine synthetase [glutamine-...    281   7e-87    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT24348.1|  Asparagine synthetase (glutamine-hydrolyzing)           280   8e-87    
gb|ABR16980.1|  unknown                                                 280   1e-86    Picea sitchensis
ref|XP_008805175.1|  PREDICTED: asparagine synthetase [glutamine-...    279   3e-86    Phoenix dactylifera
ref|NP_001131013.1|  asparagine synthetase2                             280   3e-86    Zea mays [maize]
gb|AAO39048.1|  asparagine synthetase 2                                 279   3e-86    Hordeum vulgare [barley]
dbj|BAJ87368.1|  predicted protein                                      278   4e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ88564.1|  predicted protein                                      278   4e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008352597.1|  PREDICTED: asparagine synthetase [glutamine-...    265   4e-86    
ref|XP_004962101.1|  PREDICTED: asparagine synthetase [glutamine-...    279   5e-86    Setaria italica
ref|XP_009622719.1|  PREDICTED: asparagine synthetase [glutamine-...    278   9e-86    Nicotiana tomentosiformis
gb|AAK49456.1|AF307145_1  glutamine-dependent asparagine syntheta...    278   1e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHA44834.1|  asparagine synthetase                                   277   1e-85    Larix kaempferi [karamatsu]
ref|XP_009766230.1|  PREDICTED: asparagine synthetase [glutamine-...    275   7e-85    Nicotiana sylvestris
ref|NP_001241726.1|  asparagine synthetase                              275   9e-85    
ref|XP_010264605.1|  PREDICTED: asparagine synthetase [glutamine-...    275   1e-84    Nelumbo nucifera [Indian lotus]
ref|XP_008445538.1|  PREDICTED: asparagine synthetase [glutamine-...    271   1e-84    
ref|XP_010922574.1|  PREDICTED: asparagine synthetase [glutamine-...    275   2e-84    Elaeis guineensis
emb|CAD43058.1|  putative asparagine synthetase                         275   2e-84    Pinus sylvestris [Scotch pine]
ref|NP_001268166.1|  asparagine synthetase [glutamine-hydrolyzing...    274   2e-84    Vitis vinifera
emb|CBI15932.3|  unnamed protein product                                274   2e-84    Vitis vinifera
gb|KJB55712.1|  hypothetical protein B456_009G0905001                   266   2e-84    Gossypium raimondii
ref|XP_006843600.1|  hypothetical protein AMTR_s00007p00134530          274   3e-84    Amborella trichopoda
ref|XP_004294298.1|  PREDICTED: asparagine synthetase [glutamine-...    273   4e-84    Fragaria vesca subsp. vesca
gb|AFK47234.1|  unknown                                                 266   1e-83    Medicago truncatula
ref|XP_004240406.1|  PREDICTED: asparagine synthetase [glutamine-...    272   1e-83    
ref|XP_008445536.1|  PREDICTED: asparagine synthetase [glutamine-...    272   1e-83    
ref|XP_006344055.1|  PREDICTED: asparagine synthetase [glutamine-...    272   1e-83    Solanum tuberosum [potatoes]
ref|XP_008805038.1|  PREDICTED: asparagine synthetase [glutamine-...    272   3e-83    
ref|XP_010253782.1|  PREDICTED: asparagine synthetase [glutamine-...    271   3e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010102790.1|  Glutamine-dependent asparagine synthetase 2        271   4e-83    
gb|KHG22055.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    268   4e-83    Gossypium arboreum [tree cotton]
gb|KHG07877.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    268   4e-83    Gossypium arboreum [tree cotton]
ref|XP_008349663.1|  PREDICTED: asparagine synthetase, nodule [gl...    258   4e-83    
dbj|BAA96251.1|  asparagine synthetase                                  270   5e-83    Astragalus sinicus
ref|XP_004144212.1|  PREDICTED: asparagine synthetase [glutamine-...    270   7e-83    
gb|KDO66932.1|  hypothetical protein CISIN_1g007799mg                   267   8e-83    Citrus sinensis [apfelsine]
ref|XP_010043416.1|  PREDICTED: asparagine synthetase [glutamine-...    270   8e-83    Eucalyptus grandis [rose gum]
gb|AFH57273.1|  asparagine synthetase                                   270   9e-83    Gossypium hirsutum [American cotton]
gb|KJB35221.1|  hypothetical protein B456_006G105200                    270   1e-82    Gossypium raimondii
gb|KJB35224.1|  hypothetical protein B456_006G105200                    270   1e-82    Gossypium raimondii
sp|O24661.3|ASNS_TRIVS  RecName: Full=Asparagine synthetase [glut...    269   1e-82    Triphysaria versicolor
ref|XP_009416293.1|  PREDICTED: asparagine synthetase [glutamine-...    269   1e-82    
ref|XP_009416291.1|  PREDICTED: asparagine synthetase [glutamine-...    269   2e-82    
ref|XP_009416292.1|  PREDICTED: asparagine synthetase [glutamine-...    269   2e-82    
emb|CAA67889.1|  asparagine synthetase                                  269   2e-82    Asparagus officinalis
gb|KHG11690.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    268   2e-82    Gossypium arboreum [tree cotton]
ref|XP_011080785.1|  PREDICTED: asparagine synthetase [glutamine-...    269   2e-82    Sesamum indicum [beniseed]
ref|XP_008792949.1|  PREDICTED: asparagine synthetase [glutamine-...    269   2e-82    Phoenix dactylifera
ref|XP_004500279.1|  PREDICTED: asparagine synthetase, nodule [gl...    269   2e-82    Cicer arietinum [garbanzo]
sp|P31752.2|ASNS_ASPOF  RecName: Full=Asparagine synthetase [glut...    269   2e-82    Asparagus officinalis
ref|XP_007146780.1|  hypothetical protein PHAVU_006G069300g             268   2e-82    Phaseolus vulgaris [French bean]
gb|AAO38524.1|  asparagine synthetase                                   268   3e-82    Securigera parviflora
gb|KCW85423.1|  hypothetical protein EUGRSUZ_B02239                     270   5e-82    Eucalyptus grandis [rose gum]
ref|XP_003615711.1|  Asparagine synthetase                              268   5e-82    Medicago truncatula
gb|AEE81749.1|  asparagine synthetase                                   268   6e-82    Morus alba var. multicaulis
dbj|BAM93579.1|  asparagine synthase                                    267   7e-82    Vigna unguiculata
ref|NP_001235492.1|  asparagine synthetase                              267   9e-82    Glycine max [soybeans]
gb|KHN05227.1|  Asparagine synthetase [glutamine-hydrolyzing] 2         267   1e-81    Glycine soja [wild soybean]
emb|CDY71298.1|  BnaCnng72260D                                          266   1e-81    Brassica napus [oilseed rape]
gb|KDO66931.1|  hypothetical protein CISIN_1g007799mg                   267   1e-81    Citrus sinensis [apfelsine]
ref|XP_006425094.1|  hypothetical protein CICLE_v10028078mg             267   1e-81    Citrus clementina [clementine]
emb|CDX99060.1|  BnaA06g17510D                                          267   1e-81    
ref|XP_009149924.1|  PREDICTED: asparagine synthetase [glutamine-...    266   1e-81    Brassica rapa
gb|KDP45791.1|  hypothetical protein JCGZ_17398                         267   1e-81    Jatropha curcas
emb|CAA96526.1|  asparagine synthetase                                  266   2e-81    Vicia faba [broad bean]
gb|KJB35226.1|  hypothetical protein B456_006G105400                    266   2e-81    Gossypium raimondii
gb|AAB48058.1|  asparagine synthetase                                   266   2e-81    Medicago sativa [alfalfa]
ref|XP_009616367.1|  PREDICTED: asparagine synthetase [glutamine-...    266   2e-81    Nicotiana tomentosiformis
ref|XP_006488550.1|  PREDICTED: asparagine synthetase [glutamine-...    266   2e-81    Citrus sinensis [apfelsine]
ref|XP_006290806.1|  hypothetical protein CARUB_v10016913mg             266   2e-81    Capsella rubella
ref|XP_003519256.1|  PREDICTED: asparagine synthetase, root [glut...    266   2e-81    
ref|XP_002877554.1|  hypothetical protein ARALYDRAFT_905953             266   2e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_010535370.1|  PREDICTED: asparagine synthetase [glutamine-...    266   2e-81    Tarenaya hassleriana [spider flower]
gb|KFK32648.1|  hypothetical protein AALP_AA6G270400                    266   2e-81    Arabis alpina [alpine rockcress]
ref|XP_002299991.2|  asparagine synthetase family protein               266   2e-81    
dbj|BAA96252.1|  asparagine synthetase                                  266   3e-81    Astragalus sinicus
gb|EPS60769.1|  hypothetical protein M569_14030                         263   3e-81    Genlisea aurea
ref|XP_010685525.1|  PREDICTED: asparagine synthetase [glutamine-...    266   3e-81    Beta vulgaris subsp. vulgaris [field beet]
sp|P19251.3|ASNS1_PEA  RecName: Full=Asparagine synthetase, nodul...    266   3e-81    Pisum sativum [garden pea]
ref|XP_007016070.1|  Glutamine-dependent asparagine synthase 1          266   3e-81    
ref|XP_003538303.1|  PREDICTED: asparagine synthetase [glutamine-...    266   3e-81    
ref|XP_006602084.1|  PREDICTED: asparagine synthetase [glutamine-...    265   4e-81    
ref|NP_190318.1|  asparagine synthetase [glutamine-hydrolyzing]         265   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KHG11567.1|  Asparagine synthetase [glutamine-hydrolyzing] 1         265   5e-81    Gossypium arboreum [tree cotton]
gb|KHN02080.1|  Asparagine synthetase [glutamine-hydrolyzing] 2         265   5e-81    Glycine soja [wild soybean]
dbj|BAB17726.1|  asparagine synthetase                                  265   6e-81    Raphanus sativus
dbj|BAO45866.1|  asparagine synthetase                                  265   6e-81    Acacia mangium
gb|AAB81011.1|  asparagine synthetase                                   265   6e-81    Medicago sativa [alfalfa]
gb|KEH34317.1|  asparagine synthetase [glutamine-hydrolyzing] pro...    265   7e-81    Medicago truncatula
emb|CDP09210.1|  unnamed protein product                                265   8e-81    Coffea canephora [robusta coffee]
gb|KHN40086.1|  Asparagine synthetase [glutamine-hydrolyzing] 1         265   1e-80    Glycine soja [wild soybean]
ref|XP_011003961.1|  PREDICTED: asparagine synthetase [glutamine-...    265   1e-80    Populus euphratica
sp|P49093.2|ASNS2_LOTJA  RecName: Full=Asparagine synthetase [glu...    264   1e-80    Lotus japonicus
sp|P49091.2|ASNS_BRAOL  RecName: Full=Asparagine synthetase [glut...    264   1e-80    Brassica oleracea
ref|XP_006404395.1|  hypothetical protein EUTSA_v10010235mg             264   1e-80    Eutrema salsugineum [saltwater cress]
ref|XP_010426174.1|  PREDICTED: asparagine synthetase [glutamine-...    264   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010515041.1|  PREDICTED: asparagine synthetase [glutamine-...    264   1e-80    Camelina sativa [gold-of-pleasure]
gb|KJB08974.1|  hypothetical protein B456_001G117000                    259   1e-80    Gossypium raimondii
ref|XP_010690144.1|  PREDICTED: asparagine synthetase [glutamine-...    264   1e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009792170.1|  PREDICTED: asparagine synthetase [glutamine-...    264   2e-80    Nicotiana sylvestris
ref|XP_011024933.1|  PREDICTED: asparagine synthetase [glutamine-...    263   2e-80    Populus euphratica
gb|AAC16325.1|  asparagine synthetase                                   263   2e-80    Elaeagnus umbellata [aki-gumi]
gb|ABB04097.1|  asparagine synthetase                                   263   2e-80    Glycine max [soybeans]
ref|XP_007142192.1|  hypothetical protein PHAVU_008G259900g             263   3e-80    Phaseolus vulgaris [French bean]
gb|ABU95104.1|  asparagine synthetase                                   263   3e-80    Phaseolus vulgaris [French bean]
emb|CAA08913.1|  asparagine synthetase type II                          263   3e-80    Phaseolus vulgaris [French bean]
ref|XP_010503333.1|  PREDICTED: asparagine synthetase [glutamine-...    263   3e-80    Camelina sativa [gold-of-pleasure]
sp|P49092.2|ASNS1_LOTJA  RecName: Full=Asparagine synthetase [glu...    263   4e-80    Lotus japonicus
gb|KJB83674.1|  hypothetical protein B456_013G259500                    263   4e-80    Gossypium raimondii
emb|CAB57292.1|  asparagine synthetase (type-I)                         263   4e-80    Phaseolus vulgaris [French bean]
gb|KJB08975.1|  hypothetical protein B456_001G117000                    259   6e-80    Gossypium raimondii
gb|AAL91002.1|  asparagine synthetase                                   262   7e-80    Securigera parviflora
ref|XP_002313246.2|  asparagine synthetase family protein               262   1e-79    
sp|P19252.3|ASNS2_PEA  RecName: Full=Asparagine synthetase, root ...    261   1e-79    Pisum sativum [garden pea]
ref|XP_008221198.1|  PREDICTED: asparagine synthetase [glutamine-...    261   2e-79    Prunus mume [ume]
gb|EYU45708.1|  hypothetical protein MIMGU_mgv1a003412mg                261   3e-79    Erythranthe guttata [common monkey flower]
ref|XP_004490613.1|  PREDICTED: asparagine synthetase, root [glut...    261   3e-79    Cicer arietinum [garbanzo]
ref|NP_001235738.1|  asparagine synthetase 1                            260   3e-79    
gb|KJB08981.1|  hypothetical protein B456_001G117000                    260   5e-79    Gossypium raimondii
gb|KHG19876.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    259   5e-79    Gossypium arboreum [tree cotton]
ref|XP_007208013.1|  hypothetical protein PRUPE_ppa003265mg             260   6e-79    Prunus persica
ref|XP_009338945.1|  PREDICTED: asparagine synthetase [glutamine-...    259   7e-79    Pyrus x bretschneideri [bai li]
ref|XP_008384782.1|  PREDICTED: asparagine synthetase [glutamine-...    259   9e-79    
gb|KHG15500.1|  Asparagine synthetase [glutamine-hydrolyzing] -li...    259   1e-78    Gossypium arboreum [tree cotton]
gb|AAF74755.1|  asparagine synthetase                                   259   1e-78    Helianthus annuus
gb|KHN46143.1|  Asparagine synthetase, root [glutamine-hydrolyzing]     259   1e-78    Glycine soja [wild soybean]
emb|CDY21785.1|  BnaA06g20540D                                          259   1e-78    Brassica napus [oilseed rape]
ref|XP_009150235.1|  PREDICTED: asparagine synthetase [glutamine-...    259   2e-78    
ref|XP_002526709.1|  asparagine synthetase, putative                    258   3e-78    Ricinus communis
ref|NP_001235721.1|  asparagine synthetase 2                            258   4e-78    
emb|CDX77846.1|  BnaC03g53730D                                          258   5e-78    
ref|XP_001760709.1|  predicted protein                                  257   1e-77    
ref|XP_009353891.1|  PREDICTED: asparagine synthetase [glutamine-...    255   4e-77    Pyrus x bretschneideri [bai li]
gb|AAF02775.1|AF190728_1  asparagine synthetase                         252   5e-76    Helianthus annuus
ref|XP_001783027.1|  predicted protein                                  251   1e-75    
ref|XP_002967970.1|  hypothetical protein SELMODRAFT_145135             251   1e-75    Selaginella moellendorffii
gb|AGV54350.1|  asparagine synthetase                                   247   5e-74    Phaseolus vulgaris [French bean]
gb|KJB08976.1|  hypothetical protein B456_001G117000                    247   7e-74    Gossypium raimondii
ref|XP_002450094.1|  hypothetical protein SORBIDRAFT_05g000440          246   1e-73    
ref|XP_001784562.1|  predicted protein                                  244   3e-73    
ref|XP_002963950.1|  hypothetical protein SELMODRAFT_81509              244   4e-73    
ref|XP_008666000.1|  PREDICTED: asparagine synthetase [glutamine-...    233   2e-70    Zea mays [maize]
gb|KGN47585.1|  hypothetical protein Csa_6G362920                       233   3e-69    Cucumis sativus [cucumbers]
ref|XP_010422871.1|  PREDICTED: asparagine synthetase [glutamine-...    230   5e-68    Camelina sativa [gold-of-pleasure]
tpg|DAA44867.1|  TPA: hypothetical protein ZEAMMB73_793002              234   7e-68    
tpg|DAA59148.1|  TPA: hypothetical protein ZEAMMB73_422165              231   1e-67    
gb|EEC75023.1|  hypothetical protein OsI_11112                          224   2e-65    Oryza sativa Indica Group [Indian rice]
sp|Q10MX3.1|ASNS1_ORYSJ  RecName: Full=Asparagine synthetase [glu...    224   2e-65    Oryza sativa Japonica Group [Japonica rice]
pir||S49846  asparagine synthase (glutamine-hydrolysing) (EC 6.3....    213   2e-65 
ref|XP_006651276.1|  PREDICTED: asparagine synthetase [glutamine-...    224   4e-65    
ref|XP_003558155.1|  PREDICTED: asparagine synthetase [glutamine-...    220   1e-63    Brachypodium distachyon [annual false brome]
ref|XP_002955283.1|  hypothetical protein VOLCADRAFT_65699              218   3e-63    Volvox carteri f. nagariensis
gb|KJB48988.1|  hypothetical protein B456_008G096300                    217   3e-63    Gossypium raimondii
dbj|BAJ97133.1|  predicted protein                                      218   5e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009759011.1|  PREDICTED: asparagine synthetase [glutamine-...    215   3e-62    Nicotiana sylvestris
ref|XP_004984856.1|  PREDICTED: asparagine synthetase [glutamine-...    217   3e-62    
emb|CAR70074.1|  asparagine synthetase                                  215   6e-62    Zea mays [maize]
ref|NP_001131014.1|  asparagine synthetase3                             215   6e-62    Zea mays [maize]
sp|P49094.2|ASNS_MAIZE  RecName: Full=Asparagine synthetase [glut...    214   1e-61    Zea mays [maize]
ref|NP_001131015.1|  asparagine synthetase4                             212   7e-61    Zea mays [maize]
gb|KHG05830.1|  hypothetical protein F383_10738                         209   2e-60    Gossypium arboreum [tree cotton]
emb|CAR70075.1|  asparagine synthetase                                  211   3e-60    Zea mays [maize]
ref|XP_001702113.1|  asparagine synthase                                210   5e-60    Chlamydomonas reinhardtii
emb|CBU30418.1|  asparagine synthase                                    209   5e-60    Polytomella sp. Pringsheim 198.80
gb|AFW88704.1|  asparagine synthetase                                   209   3e-59    
gb|EWM23351.1|  asparagine synthetase                                   201   1e-56    Nannochloropsis gaditana
emb|CCI46614.1|  unnamed protein product                                198   1e-55    Albugo candida
ref|XP_003615538.1|  Asparagine synthetase                              185   3e-55    
ref|WP_017445751.1|  asparagine synthetase B                            196   4e-55    Gayadomonas joobiniege
emb|CCA24853.1|  unnamed protein product                                196   4e-55    Albugo laibachii Nc14
sp|O24338.3|ASNS_SANAU  RecName: Full=Asparagine synthetase [glut...    194   2e-54    Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_002177778.1|  predicted protein                                  195   2e-54    Phaeodactylum tricornutum CCAP 1055/1
gb|EGI72486.1|  asparagine synthetase                                   183   6e-54    Pseudoalteromonas distincta
ref|WP_038641566.1|  asparagine synthetase B                            193   7e-54    Pseudoalteromonas piratica
ref|WP_010560122.1|  asparagine synthetase B                            192   9e-54    Pseudoalteromonas spongiae
ref|WP_017223547.1|  asparagine synthetase B                            192   1e-53    Moritella dasanensis
ref|WP_033021497.1|  asparagine synthetase B                            183   1e-53    
ref|XP_009840604.1|  asparagine synthase (glutamine-hydrolyzing)        192   1e-53    Aphanomyces astaci
ref|WP_010178404.1|  asparagine synthetase B                            188   2e-53    Glaciecola sp. HTCC2999
gb|KDO28545.1|  asparagine synthase                                     191   3e-53    Saprolegnia parasitica CBS 223.65
ref|XP_008612664.1|  asparagine synthase (glutamine-hydrolysing)        191   6e-53    Saprolegnia diclina VS20
gb|KJB35223.1|  hypothetical protein B456_006G105200                    189   6e-53    Gossypium raimondii
emb|CAD71256.1|  asparagine synthetase 3                                191   1e-52    
ref|XP_002289396.1|  asparagine synthase                                190   2e-52    
ref|XP_002786033.1|  conserved hypothetical protein                     188   4e-52    
ref|XP_009036781.1|  hypothetical protein AURANDRAFT_71545              189   6e-52    
ref|NP_850663.1|  asparagine synthetase [glutamine-hydrolyzing]         187   6e-52    
ref|WP_027501643.1|  hypothetical protein                               178   6e-52    
ref|XP_008868227.1|  asparagine synthase (glutamine-hydrolyzing)        188   7e-52    
gb|ETW20708.1|  asparagine synthase (glutamine-hydrolyzing), vari...    186   1e-51    
ref|WP_007989815.1|  MULTISPECIES: asparagine synthetase B              187   1e-51    
ref|WP_016904059.1|  hypothetical protein                               177   1e-51    
gb|KDO66933.1|  hypothetical protein CISIN_1g007799mg                   186   1e-51    
ref|WP_037439991.1|  asparagine synthetase B                            186   2e-51    
ref|WP_011575717.1|  asparagine synthetase B                            186   2e-51    
dbj|GAL32888.1|  asparagine synthetase                                  179   2e-51    
gb|EWC90794.1|  hypothetical protein PFNF54_00439                       186   2e-51    
ref|WP_002157440.1|  asparagine synthase family protein                 176   3e-51    
ref|WP_006993632.1|  MULTISPECIES: asparagine synthase                  186   3e-51    
ref|XP_001351168.1|  asparagine synthetase, putative                    186   4e-51    
emb|CDO62521.1|  asparagine synthetase, putative                        186   4e-51    
ref|WP_005493789.1|  Asparagine synthetase [glutamine-hydrolyzing]      186   4e-51    
ref|WP_033077015.1|  asparagine synthetase B                            185   5e-51    
ref|WP_034673274.1|  asparagine synthetase B                            185   5e-51    
ref|WP_018675088.1|  asparagine synthetase B                            185   5e-51    
gb|ETW32806.1|  asparagine synthase (glutamine-hydrolyzing)             186   5e-51    
ref|XP_009525551.1|  hypothetical protein PHYSODRAFT_330563             185   5e-51    
ref|WP_014109210.1|  asparagine synthetase B                            185   6e-51    
emb|CED60039.1|  asparagine synthetase B                                185   7e-51    
ref|WP_014978702.1|  asparagine synthetase B                            185   7e-51    
ref|WP_019440092.1|  asparagine synthetase B                            185   7e-51    
ref|WP_039216710.1|  asparagine synthetase B                            185   7e-51    
gb|ETI56902.1|  asparagine synthase (glutamine-hydrolyzing)             185   7e-51    
ref|WP_014948790.1|  asparagine synthetase B                            185   7e-51    
ref|WP_039233128.1|  asparagine synthetase B                            185   7e-51    
gb|KJB08980.1|  hypothetical protein B456_001G117000                    184   8e-51    
ref|WP_007618276.1|  asparagine synthase                                185   8e-51    
gb|EJK52637.1|  hypothetical protein THAOC_28062                        185   9e-51    
ref|XP_008890270.1|  asparagine synthase (glutamine-hydrolyzing)        184   1e-50    
ref|WP_033032304.1|  asparagine synthetase B                            184   1e-50    
ref|WP_033041196.1|  asparagine synthetase B                            184   1e-50    
ref|WP_007376585.1|  asparagine synthase                                184   1e-50    
ref|WP_039489762.1|  MULTISPECIES: asparagine synthetase B              184   1e-50    
ref|WP_035014194.1|  asparagine synthetase B                            184   1e-50    
ref|WP_004587888.1|  asparagine synthetase B                            184   2e-50    
ref|WP_025800668.1|  asparagine synthetase B                            184   2e-50    
ref|WP_008139235.1|  asparagine synthetase B                            184   2e-50    
ref|WP_024596146.1|  asparagine synthetase B                            184   2e-50    
ref|WP_010552851.1|  MULTISPECIES: asparagine synthetase B              184   2e-50    
ref|WP_028773797.1|  asparagine synthetase B                            184   2e-50    
ref|WP_040045679.1|  asparagine synthetase B                            184   2e-50    
ref|WP_020911951.1|  Asparagine synthase, glutamine-hydrolyzing         184   2e-50    
ref|WP_024034109.1|  MULTISPECIES: asparagine synthetase B              184   2e-50    
ref|WP_028764062.1|  asparagine synthetase B                            184   2e-50    
ref|WP_007107158.1|  asparagine synthase                                184   2e-50    
ref|WP_018984479.1|  asparagine synthetase B                            183   2e-50    
ref|WP_039187135.1|  asparagine synthetase B                            183   3e-50    
ref|WP_004096463.1|  asparagine synthetase B                            183   3e-50    
ref|WP_044734665.1|  asparagine synthetase B                            183   3e-50    
ref|WP_039035486.1|  asparagine synthetase B                            183   3e-50    
emb|CEJ70302.1|  Asparagine synthetase B [glutamine-hydrolyzing]        178   3e-50    
ref|WP_024612788.1|  asparagine synthetase B                            183   3e-50    
ref|WP_025011945.1|  asparagine synthetase B                            183   3e-50    
ref|WP_026375485.1|  asparagine synthetase B                            183   3e-50    
ref|WP_008167489.1|  asparagine synthetase B                            183   3e-50    
dbj|GAM73140.1|  asparagine synthetase                                  173   3e-50    
ref|XP_002900035.1|  asparagine synthetase                              183   4e-50    
ref|WP_032094512.1|  MULTISPECIES: asparagine synthetase B              183   4e-50    
ref|WP_007643801.1|  asparagine synthase                                183   4e-50    
ref|WP_028781649.1|  asparagine synthetase B                            183   4e-50    
ref|WP_025889387.1|  asparagine synthetase B                            183   4e-50    
ref|WP_006031926.1|  asparagine synthetase B                            183   4e-50    
ref|WP_041511698.1|  asparagine synthetase B                            182   4e-50    
ref|WP_019029056.1|  asparagine synthetase B                            182   4e-50    
ref|WP_025822520.1|  asparagine synthetase B                            182   6e-50    
ref|WP_024598933.1|  asparagine synthetase B                            182   6e-50    
ref|WP_011160943.1|  asparagine synthetase B                            182   7e-50    
ref|WP_014997773.1|  asparagine synthetase B                            182   7e-50    
ref|WP_008843771.1|  asparagine synthase                                182   7e-50    
ref|WP_006003144.1|  asparagine synthetase B                            182   8e-50    
ref|WP_032246537.1|  asparagine synthetase B                            172   8e-50    
ref|WP_032182550.1|  asparagine synthetase B                            172   8e-50    
ref|WP_007583083.1|  MULTISPECIES: asparagine synthetase B              182   9e-50    
ref|WP_013051053.1|  asparagine synthetase B                            182   9e-50    
ref|WP_044613856.1|  asparagine synthetase B                            174   9e-50    
ref|WP_033539992.1|  asparagine synthetase B                            182   9e-50    
ref|WP_016955292.1|  asparagine synthetase B                            182   9e-50    
dbj|GAK86945.1|  asparagine synthetase                                  175   1e-49    
ref|WP_012517823.1|  asparagine synthetase B                            182   1e-49    
ref|WP_005501233.1|  asparagine synthetase B                            182   1e-49    
ref|WP_011637071.1|  asparagine synthetase B                            181   1e-49    
ref|WP_017053265.1|  asparagine synthetase B                            181   1e-49    
ref|WP_032221656.1|  asparagine synthetase B                            171   1e-49    
emb|CDL23906.1|  Asparagine synthetase [glutamine-hydrolyzing]          174   1e-49    
ref|WP_011865308.1|  asparagine synthetase B                            181   2e-49    
ref|WP_044056535.1|  asparagine synthetase B                            181   2e-49    
ref|WP_032172341.1|  asparagine synthetase B                            172   2e-49    
ref|WP_006014317.1|  asparagine synthase                                181   2e-49    
gb|KEL48225.1|  asparagine synthase family protein                      171   2e-49    
ref|WP_024205318.1|  hypothetical protein                               172   2e-49    
ref|WP_032202148.1|  asparagine synthetase B                            172   2e-49    
gb|END99455.1|  asparagine synthase family protein                      172   2e-49    
gb|KDY05430.1|  asparagine synthase family protein                      171   2e-49    
ref|WP_032179760.1|  asparagine synthetase B                            171   2e-49    
gb|EZJ64176.1|  asparagine synthase family protein                      172   2e-49    
ref|WP_032188866.1|  asparagine synthetase B                            171   2e-49    
ref|WP_032189201.1|  asparagine synthetase B                            172   2e-49    
ref|WP_032175066.1|  asparagine synthetase B                            172   2e-49    
ref|WP_032299041.1|  asparagine synthetase B                            171   2e-49    
ref|WP_033865279.1|  asparagine synthetase B                            171   2e-49    
gb|KEL42962.1|  asparagine synthase family protein                      171   2e-49    
ref|WP_014789951.1|  asparagine synthetase B                            181   2e-49    
ref|WP_024604095.1|  asparagine synthetase B                            181   2e-49    
ref|WP_032343534.1|  asparagine synthetase B                            171   2e-49    
ref|WP_024600983.1|  asparagine synthetase B                            181   2e-49    
ref|WP_008465707.1|  asparagine synthetase B                            181   2e-49    
ref|WP_013464888.1|  asparagine synthetase B                            181   2e-49    
ref|WP_033103477.1|  MULTISPECIES: asparagine synthetase B              181   2e-49    
ref|WP_016899940.1|  asparagine synthetase B                            181   2e-49    
ref|WP_036956461.1|  asparagine synthetase B                            181   3e-49    
ref|WP_025254533.1|  asparagine synthetase B                            181   3e-49    
ref|WP_028835272.1|  MULTISPECIES: asparagine synthetase B              181   3e-49    
ref|WP_012155809.1|  asparagine synthetase B                            181   3e-49    
ref|WP_028767322.1|  asparagine synthetase B                            181   3e-49    
ref|WP_010363149.1|  asparagine synthetase B                            180   3e-49    
ref|WP_036982757.1|  asparagine synthetase B                            180   3e-49    
ref|WP_032289528.1|  asparagine synthetase B                            171   3e-49    
ref|WP_034741884.1|  asparagine synthetase B                            180   3e-49    
ref|WP_011626527.1|  asparagine synthetase B                            180   3e-49    
ref|WP_032286361.1|  asparagine synthetase B                            171   3e-49    
gb|KEM66589.1|  asparagine synthase family protein                      171   3e-49    
ref|WP_034703242.1|  asparagine synthetase B                            180   4e-49    
ref|WP_032269403.1|  asparagine synthetase B                            171   4e-49    
ref|WP_011623143.1|  asparagine synthetase B                            180   4e-49    
ref|WP_009603210.1|  asparagine synthetase B                            180   4e-49    
ref|WP_021711991.1|  asparagine synthase B                              180   4e-49    
ref|WP_034756847.1|  asparagine synthetase B                            180   4e-49    
ref|WP_036795525.1|  asparagine synthetase B                            180   4e-49    
gb|EEE58857.1|  hypothetical protein OsJ_10452                          181   4e-49    
gb|KJG58698.1|  asparagine synthetase B                                 180   4e-49    
gb|KJG11207.1|  asparagine synthetase B                                 180   4e-49    
ref|WP_032173381.1|  asparagine synthetase B                            171   4e-49    
gb|EZK52793.1|  asparagine synthase family protein                      171   4e-49    
ref|WP_004395689.1|  asparagine synthetase B                            180   5e-49    
ref|WP_018691859.1|  asparagine synthetase B                            180   5e-49    
ref|WP_011072704.1|  asparagine synthetase B                            179   6e-49    
ref|WP_037419380.1|  asparagine synthetase B                            179   6e-49    
ref|WP_037427511.1|  asparagine synthetase B                            179   6e-49    
ref|WP_023403446.1|  asparagine synthase B                              179   6e-49    
ref|WP_017162889.1|  asparagine synthetase B                            173   6e-49    
ref|WP_032199713.1|  asparagine synthetase B                            172   6e-49    
ref|WP_024496355.1|  asparagine synthetase B                            179   7e-49    
ref|WP_011717455.1|  MULTISPECIES: asparagine synthetase B              179   7e-49    
ref|XP_003615712.1|  Asparagine synthetase                              179   7e-49    
dbj|GAL14843.1|  asparagine synthetase                                  179   8e-49    
ref|WP_024190560.1|  hypothetical protein                               171   8e-49    
ref|WP_001468672.1|  asparagine synthetase B                            171   8e-49    
ref|WP_025422961.1|  asparagine synthetase B                            179   9e-49    
ref|XP_003493953.1|  PREDICTED: asparagine synthetase B [glutamin...    179   9e-49    
ref|WP_025244313.1|  asparagine synthetase B                            179   9e-49    
dbj|GAL24941.1|  asparagine synthetase                                  179   1e-48    
ref|WP_042473650.1|  asparagine synthetase B                            179   1e-48    
ref|WP_032355677.1|  asparagine synthetase B                            171   1e-48    
ref|WP_019616287.1|  asparagine synthetase B                            179   1e-48    
ref|WP_011410676.1|  asparagine synthetase B                            179   1e-48    
ref|WP_032224937.1|  asparagine synthetase B                            172   1e-48    
ref|WP_006231092.1|  asparagine synthetase B                            179   1e-48    
ref|WP_010389941.1|  asparagine synthetase B                            179   1e-48    
ref|WP_039054590.1|  asparagine synthetase B                            179   1e-48    
gb|AIL34593.1|  AsnB                                                    171   1e-48    
ref|WP_004919316.1|  asparagine synthetase B                            179   1e-48    
gb|EKM30069.1|  asparagine synthetase B                                 176   1e-48    
ref|WP_032220443.1|  asparagine synthetase B                            172   1e-48    
gb|KEN59406.1|  asparagine synthase family protein                      171   1e-48    
gb|EYD79356.1|  asparagine synthase family protein                      171   1e-48    
ref|WP_039103179.1|  asparagine synthetase B                            179   1e-48    
gb|EZK35756.1|  asparagine synthase family protein                      170   1e-48    
ref|WP_006071905.1|  asparagine synthetase B                            179   1e-48    
ref|WP_039610104.1|  asparagine synthetase B                            179   1e-48    
ref|WP_032414293.1|  asparagine synthetase B                            173   1e-48    
gb|AAL32123.1|  asparagine synthetase                                   168   1e-48    
ref|WP_032220757.1|  asparagine synthetase B                            170   1e-48    
ref|WP_007647455.1|  asparagine synthetase B                            178   2e-48    
ref|WP_015806420.1|  asparagine synthetase B                            178   2e-48    
ref|WP_011328120.1|  asparagine synthetase B                            179   2e-48    
ref|WP_027071238.1|  asparagine synthetase B                            179   2e-48    
gb|KDY10568.1|  asparagine synthase family protein                      172   2e-48    
ref|WP_007843989.1|  MULTISPECIES: asparagine synthetase B              179   2e-48    
ref|WP_032210023.1|  asparagine synthetase B                            172   2e-48    
ref|WP_042719802.1|  asparagine synthetase B                            173   2e-48    
ref|WP_003567559.1|  asparagine synthase family protein                 172   2e-48    
ref|WP_031625652.1|  asparagine synthetase B                            169   2e-48    
ref|WP_000374645.1|  hypothetical protein                               169   2e-48    
ref|WP_038225444.1|  asparagine synthetase B                            178   2e-48    
ref|WP_025008260.1|  asparagine synthetase B                            178   2e-48    
ref|WP_011789716.1|  MULTISPECIES: asparagine synthetase B              178   2e-48    
ref|WP_015754059.1|  asparagine synthetase B                            178   2e-48    
ref|WP_038660902.1|  asparagine synthetase B                            178   2e-48    
ref|WP_008223812.1|  asparagine synthetase B                            178   2e-48    
ref|WP_034911264.1|  asparagine synthetase B                            178   2e-48    
gb|KEH34318.1|  asparagine synthetase [glutamine-hydrolyzing] pro...    177   2e-48    
ref|WP_017629612.1|  asparagine synthetase B                            178   3e-48    
ref|WP_022605736.1|  Asparagine synthetase B (glutamine-hydrolyzing)    178   3e-48    
ref|WP_016709676.1|  asparagine synthetase B                            178   3e-48    
ref|WP_004413171.1|  asparagine synthetase B                            178   3e-48    
ref|WP_010604910.1|  asparagine synthetase B                            178   3e-48    
ref|WP_017217519.1|  asparagine synthetase B                            178   3e-48    
ref|WP_043958910.1|  asparagine synthetase B                            178   3e-48    
ref|WP_017066007.1|  asparagine synthetase B                            178   3e-48    
ref|WP_017063405.1|  asparagine synthetase B                            178   3e-48    
ref|WP_019398600.1|  MULTISPECIES: asparagine synthetase B              178   3e-48    
ref|WP_034947849.1|  asparagine synthetase B                            178   3e-48    
ref|WP_033093860.1|  asparagine synthetase B                            177   3e-48    
ref|WP_032299733.1|  asparagine synthetase B                            172   3e-48    
gb|KDH16411.1|  asparagine synthetase B [glutamine-hydrolyzing]         172   3e-48    
ref|WP_027696988.1|  asparagine synthetase B                            177   3e-48    
ref|WP_002984397.1|  asparagine synthetase B                            177   4e-48    
ref|WP_000337020.1|  asparagine synthetase B                            177   4e-48    
gb|KJG40390.1|  asparagine synthetase B                                 177   4e-48    
gb|KFF73453.1|  asparagine synthetase B                                 177   4e-48    
ref|WP_043992831.1|  asparagine synthetase B                            169   4e-48    
ref|WP_011217772.1|  asparagine synthetase B                            177   4e-48    
ref|WP_008986525.1|  asparagine synthetase B                            177   4e-48    



>ref|XP_009598779.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like, 
partial [Nicotiana tomentosiformis]
Length=428

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 175/184 (95%), Gaps = 1/184 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM+RPDLGRIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  246  LDKEFINVAMNIDPEWKMIRPDLGRIEKWVLRNAFDDDRNPYLPKHILYRQKEQFSDGVG  305

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+ LVSDSMLANASF+YP NTPTTKEGYYYRTIFE++FPKNAAR TVPGG
Sbjct  306  YSWIDGLKDHASSLVSDSMLANASFIYPHNTPTTKEGYYYRTIFERYFPKNAARETVPGG  365

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAYEDA + KTT +++T+ QKL+V+KA
Sbjct  366  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAYEDASEVKTTVATDTA-QKLDVDKA  424

Query  187  SVAV  176
            +VAV
Sbjct  425  AVAV  428



>emb|CDP01451.1| unnamed protein product [Coffea canephora]
Length=581

 Score =   334 bits (857),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM IDPEWKMVRPDLGRIEKWVLR AFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMGIDPEWKMVRPDLGRIEKWVLRCAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWID L+DHAN  V+D+MLANASF+YPENTPTTKEGYYYR IFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDSLRDHANQQVTDTMLANASFIYPENTPTTKEGYYYRAIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYEDA ++K  T+SETS+QKL+ EK 
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHLAAYEDAKESK-MTASETSLQKLQAEKT  577

Query  187  SVAV  176
            +VAV
Sbjct  578  TVAV  581



>ref|XP_009759010.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X1 [Nicotiana sylvestris]
Length=581

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 173/184 (94%), Gaps = 1/184 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AM++DPE KM+RPDLGRIEKWVLRNAFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFVNVAMNMDPESKMIRPDLGRIEKWVLRNAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+ LVSDSMLANASFVYP NTPTTKEGYYYRTIFE++FPKNAAR TVPGG
Sbjct  459  YSWIDGLKDHASRLVSDSMLANASFVYPHNTPTTKEGYYYRTIFERYFPKNAARETVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAYEDA + KTT +++T  QKLEV+KA
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAYEDASEVKTTVATDTP-QKLEVDKA  577

Query  187  SVAV  176
            +VAV
Sbjct  578  AVAV  581



>ref|XP_008233969.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Prunus 
mume]
Length=584

 Score =   322 bits (826),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 167/186 (90%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWVLRNAFDDVQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML +ASF+YPENTPTTKE Y YRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLTHASFIYPENTPTTKEAYCYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE--VE  194
            PSVACSTA+AVEWDA+WSKNLDPSGRAALGIH+AAYE+A DAK  +S   S +KL+   E
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGIHSAAYEEAVDAKNKSSLSGSPKKLQGVGE  578

Query  193  KASVAV  176
            KAS  V
Sbjct  579  KASAVV  584



>ref|XP_007047958.1| Asparagine synthetase 3 isoform 3 [Theobroma cacao]
 gb|EOX92115.1| Asparagine synthetase 3 isoform 3 [Theobroma cacao]
Length=585

 Score =   322 bits (825),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 169/187 (90%), Gaps = 4/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+ LV+D+ML NASF+YPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHADKLVTDAMLMNASFIYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE---V  197
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAYE+A D K    S    QK++   V
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYEEAVDVKPADLSNGPPQKIKKGIV  578

Query  196  EK-ASVA  179
            EK A+VA
Sbjct  579  EKTATVA  585



>ref|XP_002306310.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa]
 gb|EEE93306.2| hypothetical protein POPTR_0005s07720g [Populus trichocarpa]
Length=585

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINIAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NASF+YPENTPTTKE YYYRTIFEKFFPKN+ARSTVPGG
Sbjct  460  YSWIDGLKDHANKQVTDAMLMNASFIYPENTPTTKEAYYYRTIFEKFFPKNSARSTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK  206
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  D K  + +  S QK
Sbjct  520  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYEETVDTKAASQNNGSPQK  573



>gb|ABK95431.1| unknown [Populus trichocarpa]
 gb|ABK96003.1| unknown [Populus trichocarpa]
Length=584

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NASF+YPENTPTTKE YYYRTIFEKFFPKN+ARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMNASFIYPENTPTTKEAYYYRTIFEKFFPKNSARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK  206
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  D K  + +  S QK
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYEETVDTKAASQNNGSPQK  572



>ref|XP_011031010.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Populus 
euphratica]
Length=584

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NASF+YPENTPTTKE YYYRTIFEKFFPKN+ARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMNASFIYPENTPTTKEAYYYRTIFEKFFPKNSARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK  206
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  D K  + +  + QK
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHTAAYEETADTKAASQNNGAPQK  572



>ref|XP_007047956.1| Asparagine synthetase 3 isoform 1 [Theobroma cacao]
 gb|EOX92113.1| Asparagine synthetase 3 isoform 1 [Theobroma cacao]
Length=586

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 169/188 (90%), Gaps = 5/188 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK-NAARSTVPG  371
            YSWIDGLKDHA+ LV+D+ML NASF+YPENTPTTKEGYYYRTIFEKFFPK NAARSTVPG
Sbjct  459  YSWIDGLKDHADKLVTDAMLMNASFIYPENTPTTKEGYYYRTIFEKFFPKQNAARSTVPG  518

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE---  200
            GPSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAYE+A D K    S    QK++   
Sbjct  519  GPSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYEEAVDVKPADLSNGPPQKIKKGI  578

Query  199  VEK-ASVA  179
            VEK A+VA
Sbjct  579  VEKTATVA  586



>ref|XP_010027848.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X1 [Eucalyptus grandis]
 gb|KCW54483.1| hypothetical protein EUGRSUZ_I00431 [Eucalyptus grandis]
Length=577

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDPEWKMVRPDLGRIEKW+LRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLDVAMSIDPEWKMVRPDLGRIEKWILRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NASFVYPENTPTTKE YYYR IFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMNASFVYPENTPTTKEAYYYRAIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE  200
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  ++K  +++  S  KL+
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYEEGAESKNASTTNGSSHKLQ  574



>gb|KDO56575.1| hypothetical protein CISIN_1g012773mg [Citrus sinensis]
 gb|KDO56576.1| hypothetical protein CISIN_1g012773mg [Citrus sinensis]
Length=456

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMSIDPEWKMVRPDLGRIEKW+LRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  284  LDKEFINTAMSIDPEWKMVRPDLGRIEKWILRNAFDDDKQPYLPKHILYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGL+DHAN  V+D+MLAN+SFVYPENTPTTKE YYYRTIFEKFFPKNAAR+TVPGG
Sbjct  344  YSWIDGLRDHANKQVTDAMLANSSFVYPENTPTTKEAYYYRTIFEKFFPKNAARATVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAYE+A D K
Sbjct  404  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYEEAVDTK  446



>ref|XP_004143467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Cucumis sativus]
 ref|XP_004162303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Cucumis sativus]
 gb|KGN48750.1| hypothetical protein Csa_6G500420 [Cucumis sativus]
Length=584

 Score =   314 bits (804),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 163/186 (88%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+R D+GRIEKW+LRNAFDDE+EPYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRRDIGRIEKWILRNAFDDEKEPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+D+ML NA+F+YPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHAEKQVTDAMLVNANFIYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQ--KLEVE  194
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAY++  +AK       S Q  K+ VE
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHVAAYDEKLNAKIANVPNDSPQEIKVTVE  578

Query  193  KASVAV  176
            KA+  V
Sbjct  579  KAAAVV  584



>ref|XP_004288204.2| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Fragaria 
vesca subsp. vesca]
Length=636

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI TAM IDPEWKM+RPDLGRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  450  LDKDFIKTAMDIDPEWKMIRPDLGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  509

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NA F+YPENTPTTKEGYYYRTIFEKFFPKN+ARSTVPGG
Sbjct  510  YSWIDGLKDHANKQVSDSMMMNAGFIYPENTPTTKEGYYYRTIFEKFFPKNSARSTVPGG  569

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA WSKN DPSGRAALGIHAAAYE++ D KT +    S QKL
Sbjct  570  PSVACSTAKAVEWDAEWSKNPDPSGRAALGIHAAAYEESKDVKTGSLVSDSPQKL  624



>ref|XP_011097578.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Sesamum 
indicum]
Length=568

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM IDPEWKM+RPDLGRIEKW+LRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMDIDPEWKMIRPDLGRIEKWILRNAFDDEQNPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+MLANASFVYPENTPTTKEGYYYRTIFE+FFPKNAARSTVPGG
Sbjct  458  YSWIDGLKDHANKQVTDAMLANASFVYPENTPTTKEGYYYRTIFERFFPKNAARSTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA  251
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAY++A
Sbjct  518  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHVAAYDEA  556



>ref|XP_006428190.1| hypothetical protein CICLE_v10025269mg [Citrus clementina]
 ref|XP_006464231.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Citrus sinensis]
 gb|ESR41430.1| hypothetical protein CICLE_v10025269mg [Citrus clementina]
Length=571

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMSIDPEWKMVRPDLGRIEKW+LRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSIDPEWKMVRPDLGRIEKWILRNAFDDDKQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGL+DHAN  V+D+MLAN+SFVYPENTPTTKE YYYRTIFEKFFPKNAAR+TVPGG
Sbjct  459  YSWIDGLRDHANKQVTDAMLANSSFVYPENTPTTKEAYYYRTIFEKFFPKNAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAYE+A D K
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYEEAVDTK  561



>ref|XP_002531258.1| asparagine synthetase, putative [Ricinus communis]
 gb|EEF31122.1| asparagine synthetase, putative [Ricinus communis]
Length=575

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 145/167 (87%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+R DLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRRDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTS  227
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  D   T S
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYEETVDTTKTAS  565



>ref|XP_010087589.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
 gb|EXB29444.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
Length=626

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML +ASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMHASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAYE++   K       S QKL
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYEESLGDKDANVLSGSPQKL  573



>ref|XP_008440595.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Cucumis 
melo]
Length=584

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKM+R D+GRIEKW+LRNAFDDE+EPYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPDWKMIRRDIGRIEKWILRNAFDDEKEPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+DSML NA+F+YPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHAEKQVTDSMLVNANFIYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQ--KLEVE  194
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAY++  + K       S Q  K+ VE
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHVAAYDEKLNGKIANVPNDSPQEIKVTVE  578

Query  193  KASVAV  176
            +A+  V
Sbjct  579  QAAAVV  584



>ref|XP_010453051.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Camelina sativa]
Length=579

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKEGYYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSDTMLMNASFVFPDNTPMTKEGYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE+  D          VQKL  + A
Sbjct  518  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYEEE-DKAEEIPRPGKVQKLAEKTA  576

Query  187  SVA  179
             V 
Sbjct  577  GVV  579



>ref|XP_008369048.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Malus 
domestica]
Length=582

 Score =   309 bits (791),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM+RP  GRIEKW+LRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMNIDPEWKMIRP--GRIEKWLLRNAFDDDQKPYLPKHILYRQKEQFSDGVG  456

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+DSML+NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  457  YSWIDGLKDHANSQVTDSMLSNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  516

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK--TTTSSETSVQKLEVE  194
            PSVACSTA+AVEWDA WSKN DPSGRAALGIH AAYE+A DA+     S    V++  VE
Sbjct  517  PSVACSTAKAVEWDAEWSKNPDPSGRAALGIHTAAYEEAGDAENGNVLSGSKKVREGIVE  576

Query  193  KASVAV  176
            K +  V
Sbjct  577  KXAAVV  582



>ref|XP_006394086.1| hypothetical protein EUTSA_v10003890mg [Eutrema salsugineum]
 gb|ESQ31372.1| hypothetical protein EUTSA_v10003890mg [Eutrema salsugineum]
Length=586

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV+PD+GRIEKWVLRNAFDDEQ+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMVKPDIGRIEKWVLRNAFDDEQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV-QKLE  200
            PS+ACSTA+A+EWDA+WSKNLDPSGRAALG+H AAYE+   A   + S  S+ QKL+
Sbjct  519  PSIACSTAKAIEWDATWSKNLDPSGRAALGVHVAAYEEEKAANVGSDSVDSLPQKLD  575



>gb|KDP46836.1| hypothetical protein JCGZ_24045 [Jatropha curcas]
Length=585

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPEWKM+R DLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMSIDPEWKMIRRDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGL+DHAN  V+D+ML NASF+YPENTPTTKE YYYR IFEKFFPKNAAR TVPGG
Sbjct  459  YSWIDGLRDHANKQVTDAMLMNASFIYPENTPTTKEAYYYRAIFEKFFPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE---V  197
            PSVACSTA+AVEWDA+WSKNLDPSGRAA+G+H AAYE+  + KT      S Q L+   V
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAAVGVHEAAYEETANTKTANLINGSPQTLKEGFV  578

Query  196  EKASVAV  176
            EK +  V
Sbjct  579  EKTATVV  585



>ref|XP_009364610.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Pyrus 
x bretschneideri]
Length=582

 Score =   309 bits (791),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+RP  GRIEKWVLRNAFDD+QEPYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINIAMNIDPEWKMIRP--GRIEKWVLRNAFDDDQEPYLPKHILYRQKEQFSDGVG  456

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+DSML+NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  457  YSWIDGLKDHANCQVTDSMLSNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  516

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK--TTTSSETSVQKLEVE  194
            PSVACSTA+AVEWDA WSKN DPSGRAALGIH AAY++A DA+          V++  VE
Sbjct  517  PSVACSTAKAVEWDAEWSKNPDPSGRAALGIHTAAYKEAGDAEKGNVVRGSKKVREGIVE  576

Query  193  KASVAV  176
            KA+  V
Sbjct  577  KAAAVV  582



>ref|XP_009343558.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Pyrus x bretschneideri]
Length=582

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+RP  GRIEKWVLRNAFDD+QEPYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINIAMNIDPEWKMIRP--GRIEKWVLRNAFDDDQEPYLPKHILYRQKEQFSDGVG  456

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+DSML+NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  457  YSWIDGLKDHANCQVTDSMLSNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  516

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK--TTTSSETSVQKLEVE  194
            PSVACSTA+AVEWDA WSKN DPSGRAALGIH AAY++A DA+          V++  VE
Sbjct  517  PSVACSTAKAVEWDAEWSKNPDPSGRAALGIHTAAYKEAGDAEKGNVVRGFKKVREGIVE  576

Query  193  KASVAV  176
            KA+  V
Sbjct  577  KAAAVV  582



>gb|ACK44501.1| AT5G10240-like protein [Arabidopsis arenosa]
Length=425

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  246  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  305

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  306  YSWIDGLKDHANKHVSDTMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  365

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  366  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  417



>gb|AAM94340.1| asparagine synthetase [Striga hermonthica]
Length=571

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AM IDPEWKM+RPDLGRIEKW+LRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFIDVAMGIDPEWKMIRPDLGRIEKWILRNAFDDEEKPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+MLANA+FVYPENTPTTKE YYYRT+FE+FFPKNAARSTVPGG
Sbjct  458  YSWIDGLKDHANQQVTDAMLANANFVYPENTPTTKEAYYYRTVFERFFPKNAARSTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA  242
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+H AAY++A  A
Sbjct  518  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHVAAYDEAKMA  559



>ref|XP_010917498.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Elaeis 
guineensis]
Length=629

 Score =   308 bits (790),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM+RPDLGRIEKWVLRNAFDD Q PYLPKHILYRQKEQFSDGVG
Sbjct  438  LDKNFINVAMDIDPEWKMIRPDLGRIEKWVLRNAFDDNQNPYLPKHILYRQKEQFSDGVG  497

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HAN  VSD+ML NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  498  YSWIDGLKHHANEHVSDAMLKNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  557

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV  212
            PSVACSTA+AVEWDA+WSKNLDPSGRAA+G+H AAY++ P+  + +   +SV
Sbjct  558  PSVACSTAKAVEWDAAWSKNLDPSGRAAVGVHTAAYKEVPEKVSASEHSSSV  609



>gb|KFK25345.1| hypothetical protein AALP_AA8G100600 [Arabis alpina]
Length=579

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSDTMLTNASFVFPDNTPVTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE   + KT       +QK+    A
Sbjct  519  PSVACSTAKAVEWDATWSQNLDPSGRAALGVHVAAYE---EDKTEDPRPEKLQKMTETTA  575

Query  187  SVAV  176
            +  V
Sbjct  576  AAIV  579



>ref|XP_009417634.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Musa 
acuminata subsp. malaccensis]
Length=591

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 159/180 (88%), Gaps = 4/180 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI+ AM IDPEWKM+R DLGRIEKWVLRNAFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKQFIDIAMDIDPEWKMIRRDLGRIEKWVLRNAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLKDHAN  VSD+ML NASFVYPENTPTTKE YYYR+IFE+FFPKNAARSTVPGG
Sbjct  459  YGWIDGLKDHANEHVSDAMLMNASFVYPENTPTTKEAYYYRSIFERFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV----QKLE  200
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+H AAY++AP+    T + +SV    QKL+
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHDAAYQEAPEKTLATENSSSVDGHLQKLQ  578



>ref|XP_010027849.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X2 [Eucalyptus grandis]
Length=586

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDPEWKMVRPDLGRIEKW+LRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLDVAMSIDPEWKMVRPDLGRIEKWILRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKN-AARSTVPG  371
            YSWIDGLKDHAN  V+D+ML NASFVYPENTPTTKE YYYR IFEKFFPK  AARSTVPG
Sbjct  459  YSWIDGLKDHANKQVTDAMLMNASFVYPENTPTTKEAYYYRAIFEKFFPKQKAARSTVPG  518

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK  206
            GPSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+  ++K T ++     K
Sbjct  519  GPSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYEEGAESKNTGTTNGPSHK  573



>ref|XP_002438207.1| hypothetical protein SORBIDRAFT_10g009590 [Sorghum bicolor]
 gb|EER89574.1| hypothetical protein SORBIDRAFT_10g009590 [Sorghum bicolor]
Length=591

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM++ DLGRIEKWV+RNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKSFINVAMDIDPEWKMIKRDLGRIEKWVIRNAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+DSM+ NASFVYPENTPTTKEGYYYRTIFEKFFPK AARSTVPGG
Sbjct  459  YSWIDGLKDHANQHVTDSMMMNASFVYPENTPTTKEGYYYRTIFEKFFPKPAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAP  248
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+H AAYED P
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHDAAYEDTP  558



>ref|XP_010519584.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Tarenaya 
hassleriana]
Length=564

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKMVRPD+GRIEKWVLRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  401  LDKEFINVAMSIDPDWKMVRPDIGRIEKWVLRNAFDDEQCPYLPKHILYRQKEQFSDGVG  460

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFVYPENTP TKE YYYRTIFEKFFPKNAAR+TVPGG
Sbjct  461  YSWIDGLKDHANKHVSDTMLMNASFVYPENTPKTKEAYYYRTIFEKFFPKNAARATVPGG  520

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWD +WSKNLDPSGRAALG+H AAY+D    K
Sbjct  521  PSVACSTAKAVEWDDAWSKNLDPSGRAALGVHVAAYKDEKAVK  563



>ref|XP_008812468.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Phoenix 
dactylifera]
Length=590

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM+RPDLGRIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDIDPEWKMIRPDLGRIEKWVLRNAFDDDKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFVYPENTPTTKE YYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANEHVSDAMLKNASFVYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPD  245
            PSVACS+A+AVEWDA+WSKNLDPSGRAA+G+H AAY++ P+
Sbjct  519  PSVACSSAKAVEWDAAWSKNLDPSGRAAVGVHTAAYKEVPE  559



>ref|XP_004237391.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Solanum 
lycopersicum]
Length=559

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM+RPDLGRIEKWV+RNAFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMNIDPEWKMIRPDLGRIEKWVVRNAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSMLANASFVYP NTPTTKEGYYYRTIFE++FPK AAR TVPGG
Sbjct  459  YSWIDGLKDHANSQVSDSMLANASFVYPHNTPTTKEGYYYRTIFERYFPKAAARETVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHEAAYE  555



>emb|CAB92065.1| asparagine synthetase (ASN3)(fragment) [Arabidopsis thaliana]
Length=441

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  262  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  321

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VS++ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  322  YSWIDGLKDHANKHVSETMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  381

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  382  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  433



>ref|XP_010484303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
isoform X1 [Camelina sativa]
Length=589

 Score =   305 bits (781),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  403  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  462

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  463  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  522

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET  218
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+   A     S++
Sbjct  523  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHVAAYEEEIKAAAKVGSDS  572



>ref|XP_010484304.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
isoform X2 [Camelina sativa]
Length=584

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET  218
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+   A     S++
Sbjct  518  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHVAAYEEEIKAAAKVGSDS  567



>gb|KFK28186.1| hypothetical protein AALP_AA8G483400 [Arabis alpina]
Length=577

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 161/177 (91%), Gaps = 1/177 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV+P++GRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMVKPEMGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML+NA+FV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANTHVTDTMLSNANFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV-QKLE  200
            PS+ACSTA+A+EWDA+WSKNLDPSGRAALG+H AAYE+   A   + S  S+ QKL+
Sbjct  519  PSIACSTAKAIEWDATWSKNLDPSGRAALGVHVAAYEEGKAANVGSDSVESLPQKLD  575



>ref|XP_010462467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Camelina 
sativa]
Length=583

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKLEVEK  191
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H AAY E+   AK  + S  S+ K  +E+
Sbjct  518  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHVAAYEENKAAAKVGSDSVDSLPKNGLEE  577



>ref|XP_004984566.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Setaria italica]
Length=588

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM+R DLGRIEKWV+RNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKSFINIAMDIDPEWKMIRRDLGRIEKWVIRNAFDDEKRPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  VSDSM+ NASFVYPENTPTTKEGYYYR IFEK+FPK AARSTVPGG
Sbjct  459  YSWIDGLKDHASEHVSDSMMMNASFVYPENTPTTKEGYYYRMIFEKYFPKPAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQ  209
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYED P A     ++ S++
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHDAAYEDTPGAAPAAVTDNSLR  571



>gb|EPS71106.1| asparagine synthetase, partial [Genlisea aurea]
Length=553

 Score =   303 bits (776),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AMSIDPEWKM+RPDLGRIEKW+LRNAFDDEQ+PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFIEVAMSIDPEWKMIRPDLGRIEKWILRNAFDDEQDPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML+NA FVYPENTPTTKE YYYR+IFEK FPKNAARSTVPGG
Sbjct  458  YSWIDGLKDHANKQVTDAMLSNAKFVYPENTPTTKEAYYYRSIFEKAFPKNAARSTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAY
Sbjct  518  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAY  553



>ref|XP_009150576.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Brassica 
rapa]
 emb|CDY08829.1| BnaA06g23950D [Brassica napus]
Length=565

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFLNVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+A+EWDA+WSKNLDPSGRAALG+H AAYE+
Sbjct  518  PSIACSTAKAIEWDATWSKNLDPSGRAALGVHVAAYEE  555



>ref|XP_006655987.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Oryza brachyantha]
Length=591

 Score =   304 bits (778),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM+R DLGRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDIDPEWKMIRRDLGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NASFVYPENTP TKE YYYRTIFEKFFPKNAAR TVPGG
Sbjct  459  YSWIDGLKDHANEHVSDSMMMNASFVYPENTPATKEAYYYRTIFEKFFPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYED
Sbjct  519  PSVACSTAKAVEWDATWSKNLDPSGRAALGVHDAAYED  556



>ref|XP_006355345.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Solanum tuberosum]
Length=559

 Score =   303 bits (775),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/157 (89%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM+RPDLGRIEKWV+RNAFDD+Q PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMNIDPEWKMIRPDLGRIEKWVVRNAFDDDQNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSMLANASFVYP NTPTTKEGYYYRTIFE++FPK AAR TV GG
Sbjct  459  YSWIDGLKDHANSQVSDSMLANASFVYPHNTPTTKEGYYYRTIFERYFPKAAARETVQGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+H AAYE
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHEAAYE  555



>ref|XP_010266657.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
 ref|XP_010266658.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
 ref|XP_010266659.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Nelumbo 
nucifera]
Length=590

 Score =   303 bits (777),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKMVRPDL RIEKW+LRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPEWKMVRPDLCRIEKWILRNAFDDDKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASF+YPENTPTTKE YYYRTIFE+FFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANEHVSDAMLMNASFIYPENTPTTKEAYYYRTIFERFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSKN DPSGRAALG+HAAAY++
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALGVHAAAYDE  556



>gb|KJB48986.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=568

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKW+LRNAFD++++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWILRNAFDNDKKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML NA+F+YPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHANKQVTDAMLINANFIYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDA+WS+N DPSGRAALG+HA+AYE
Sbjct  519  PSVACSTAKAVEWDAAWSENPDPSGRAALGVHASAYE  555



>gb|AAC72836.1| asparagine synthetase [Arabidopsis thaliana]
Length=578

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSDTMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  519  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  570



>ref|XP_006399518.1| hypothetical protein EUTSA_v10013088mg [Eutrema salsugineum]
 gb|ESQ40971.1| hypothetical protein EUTSA_v10013088mg [Eutrema salsugineum]
Length=578

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMS+DPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSMDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NA+FV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANIHVSDTMLTNANFVFPDNTPVTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE   + K+       +QKL  + A
Sbjct  519  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYE---EDKSEDPRPEKLQKLAEKTA  575

Query  187  SVA  179
            ++ 
Sbjct  576  AIV  578



>ref|XP_010422870.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X1 [Camelina sativa]
Length=567

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSDTMLMNASFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE+   A+
Sbjct  518  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYEEEDKAE  560



>ref|XP_010491681.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Camelina sativa]
Length=580

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NAS+V+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKQVSDTMLMNASYVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAY +  D          VQKL  + A
Sbjct  519  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYGEE-DKAEEDPRPGKVQKLAEKTA  577

Query  187  SVA  179
             + 
Sbjct  578  GIV  580



>ref|XP_003601953.1| Asparagine synthetase [Medicago truncatula]
 gb|AES72204.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=570

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAM IDPEWKM++PD+ RIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMDIDPEWKMIKPDIERIEKWVLRNAFDDDENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ML +A+FVYPENTPTTKEGY+YRTIFEK FPK AARSTVPGG
Sbjct  459  YSWIDGLKDHANEQVTDAMLKHANFVYPENTPTTKEGYHYRTIFEKLFPKGAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAY+DA D K
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAYKDAVDIK  561



>ref|XP_010547614.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Tarenaya 
hassleriana]
 ref|XP_010547616.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Tarenaya 
hassleriana]
Length=563

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKMVRPD+GRIEKWVLRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  401  LDKEFLNVAMSIDPEWKMVRPDIGRIEKWVLRNAFDDEQHPYLPKHILYRQKEQFSDGVG  460

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+PENTP TKE Y YRTIFEKFFPK+AAR+TVPGG
Sbjct  461  YSWIDGLKDHANKHVSDTMLMNASFVFPENTPKTKEAYQYRTIFEKFFPKSAARATVPGG  520

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWD +WSKNLDPSGRAALGIH AAY+D
Sbjct  521  PSVACSTAKAVEWDEAWSKNLDPSGRAALGIHVAAYDD  558



>ref|XP_002873446.1| hypothetical protein ARALYDRAFT_908981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49705.1| hypothetical protein ARALYDRAFT_908981 [Arabidopsis lyrata subsp. 
lyrata]
Length=578

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKEHANKHVSDTMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  519  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  570



>ref|NP_001031864.1| asparagine synthetase 3 [Arabidopsis thaliana]
 gb|AED91512.1| asparagine synthetase 3 [Arabidopsis thaliana]
Length=577

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VS++ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSETMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  518  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  569



>ref|NP_196586.1| asparagine synthetase 3 [Arabidopsis thaliana]
 sp|Q9LFU1.1|ASNS3_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 3; 
AltName: Full=Glutamine-dependent asparagine synthetase 3 
[Arabidopsis thaliana]
 emb|CAB96680.1| asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AAO41976.1| putative asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AAO50547.1| putative asparagine synthetase ASN3 [Arabidopsis thaliana]
 gb|AED91511.1| asparagine synthetase 3 [Arabidopsis thaliana]
Length=578

 Score =   301 bits (771),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 157/176 (89%), Gaps = 5/176 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VS++ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSETMLMNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSVQKL  203
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H +AY ED    KT  S    +QKL
Sbjct  519  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVSAYGED----KTEDSRPEKLQKL  570



>ref|XP_006287293.1| hypothetical protein CARUB_v10000487mg, partial [Capsella rubella]
 gb|EOA20191.1| hypothetical protein CARUB_v10000487mg, partial [Capsella rubella]
Length=615

 Score =   302 bits (773),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  436  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEENPYLPKHILYRQKEQFSDGVG  495

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NASFV+P+NTP TKE YYYRTIFEKF+PK+AAR+TVPGG
Sbjct  496  YSWIDGLKDHANKHVSDTMLTNASFVFPDNTPMTKEAYYYRTIFEKFYPKSAARATVPGG  555

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE     KT       +QKL  + A
Sbjct  556  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYE---GDKTDDPRPEKLQKLGEKTA  612

Query  187  SVA  179
             + 
Sbjct  613  EIV  615



>ref|NP_001057340.1| Os06g0265000 [Oryza sativa Japonica Group]
 sp|Q43011.3|ASNS2_ORYSJ RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Oryza sativa Japonica Group]
 gb|AAB03991.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAA18951.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAD54377.1| asparagine synthetase [Oryza sativa Japonica Group]
 dbj|BAF19254.1| Os06g0265000 [Oryza sativa Japonica Group]
 dbj|BAG94512.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80360.1| hypothetical protein OsI_22459 [Oryza sativa Indica Group]
 gb|EEE65484.1| hypothetical protein OsJ_20899 [Oryza sativa Japonica Group]
 gb|AGT42317.1| asparagine synthetase [Oryza sativa Japonica Group]
Length=591

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPEWKM++ DLGRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDIDPEWKMIKRDLGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NASFVYPENTP TKE YYYRTIFEKFFPKNAAR TVPGG
Sbjct  459  YSWIDGLKDHANEHVSDSMMMNASFVYPENTPVTKEAYYYRTIFEKFFPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYED
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHDAAYED  556



>emb|CAN82675.1| hypothetical protein VITISV_034450 [Vitis vinifera]
Length=636

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 161/202 (80%), Gaps = 18/202 (9%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKM---------------VRPDLGRIEKWVLRNAFDDEQEPYLPK  593
            LDKEFIN AM+IDPEWKM               VRPDLGRIEKWVLRNAFDD+Q+PYLPK
Sbjct  435  LDKEFINIAMNIDPEWKMARSALAGCSSSGXVHVRPDLGRIEKWVLRNAFDDDQKPYLPK  494

Query  592  HILYRQKEQFSDGVGYSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFE  413
            HILYRQKEQFSDGVGY WIDGLKDHAN  V+D+ML NA+F+YPENTPTTKEGYYYR IFE
Sbjct  495  HILYRQKEQFSDGVGYRWIDGLKDHANEHVTDAMLLNANFIYPENTPTTKEGYYYRAIFE  554

Query  412  KFFPKNAARSTVPGGPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT  233
            KFFPKNAARSTVPGGPSVACSTA+AVEWD +W KN DPSGRAALG+H  AYE+A DAK  
Sbjct  555  KFFPKNAARSTVPGGPSVACSTAKAVEWDXAWXKNPDPSGRAALGVHECAYEEAVDAKNA  614

Query  232  TSSETSVQKLE---VEKASVAV  176
                 + QK +   +EK + A+
Sbjct  615  NLINGTTQKPQEGXLEKTTTAI  636



>ref|XP_003538618.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Glycine max]
 gb|KHN44342.1| Asparagine synthetase [glutamine-hydrolyzing] [Glycine soja]
Length=566

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ +  A+F+YPENTPTTKEGY YRTIFEKFFPKN+A++TVPGG
Sbjct  459  YSWIDGLKDHANKQVTDATMMAANFIYPENTPTTKEGYLYRTIFEKFFPKNSAKATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPD  245
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+HAAAY+ A D
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHAAAYDGAVD  559



>ref|XP_010444467.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Camelina sativa]
Length=581

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSI+PEWKM++P+LGRIEKWVLRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  413  LDKEFLNVAMSINPEWKMIKPELGRIEKWVLRNAFDDEQRPYLPKHILYRQKEQFSDGVG  472

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  473  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  532

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H AAYE+
Sbjct  533  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHVAAYEE  570



>ref|XP_006280142.1| hypothetical protein CARUB_v10026039mg [Capsella rubella]
 gb|EOA13040.1| hypothetical protein CARUB_v10026039mg [Capsella rubella]
Length=660

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  483  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEQRPYLPKHILYRQKEQFSDGVG  542

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  543  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  602

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H AAY++
Sbjct  603  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHVAAYDE  640



>emb|CDY14529.1| BnaC03g49300D [Brassica napus]
Length=565

 Score =   299 bits (765),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VS +ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  458  YSWIDGLKDHANKHVSATMLSNASFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+A+EWDA+WSKNLDPSGRAALG+H AAYE+
Sbjct  518  PSIACSTAKAIEWDATWSKNLDPSGRAALGVHVAAYEE  555



>gb|AAF02776.1|AF190729_1 asparagine synthetase [Helianthus annuus]
Length=558

 Score =   298 bits (763),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKM+  D GRIEKWVLRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPKWKMIDRDNGRIEKWVLRNAFDDDEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGL+DHAN  V+DSMLANA+FVYPENTP TKE YYYR IFEKFFPKNAAR TVPGG
Sbjct  459  YSWIDGLRDHANKQVTDSMLANANFVYPENTPATKEAYYYRKIFEKFFPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA  251
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+HAAAYEDA
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHAAAYEDA  557



>gb|KJB48987.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=569

 Score =   298 bits (763),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 152/158 (96%), Gaps = 1/158 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKW+LRNAFD++++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWILRNAFDNDKKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK-NAARSTVPG  371
            YSWIDGLKDHAN  V+D+ML NA+F+YPENTPTTKEGYYYRTIFEKFFPK NAARSTVPG
Sbjct  459  YSWIDGLKDHANKQVTDAMLINANFIYPENTPTTKEGYYYRTIFEKFFPKQNAARSTVPG  518

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            GPSVACSTA+AVEWDA+WS+N DPSGRAALG+HA+AYE
Sbjct  519  GPSVACSTAKAVEWDAAWSENPDPSGRAALGVHASAYE  556



>ref|XP_004502424.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Cicer arietinum]
Length=570

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAM++DPEWKM+RPDLGRIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMAMDPEWKMIRPDLGRIEKWVLRNAFDDDKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA+G V+D+ML +A+FVY +NTPTTKEGY+YRTIFEK FPK+AAR TVPGG
Sbjct  459  YSWIDGLKEHASGQVTDAMLKHANFVYTDNTPTTKEGYHYRTIFEKLFPKSAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV  212
            PSVACSTA+AVEWDA+WSKNLDPSGRAALG+HA AY+D+ D K       S+
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGVHADAYKDSADTKIAKPENGSL  570



>ref|XP_003552061.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 [Glycine 
max]
 emb|CAJ43590.1| asparagine synthetase, type III [Glycine max]
 gb|KHN31371.1| Asparagine synthetase [glutamine-hydrolyzing] [Glycine soja]
Length=569

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 151/163 (93%), Gaps = 1/163 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  V+D+ +  A+F+YPENTPTTKEGY YRTIFEKFFPKNAA++TVPGG
Sbjct  459  YSWIDGLKDHANKQVTDATMMAANFIYPENTPTTKEGYLYRTIFEKFFPKNAAKATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WSKNLDPSGRAALGIH AAY DA D K
Sbjct  519  PSVACSTAKAVEWDAAWSKNLDPSGRAALGIHDAAY-DAVDTK  560



>ref|XP_003568184.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Brachypodium 
distachyon]
Length=591

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM IDPE+KM+R DLGRIEKWVLRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDIDPEYKMIRRDLGRIEKWVLRNAFDDDEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  VSDSM+ NASFVYPENTPTTKE YYYRT+FEKF+PKNAARSTVPGG
Sbjct  459  YSWIDGLKDHASEHVSDSMMMNASFVYPENTPTTKEAYYYRTVFEKFYPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA  251
            PSVACSTA+AVEWDA+WSK+LDPSGRAALG+H AAYED+
Sbjct  519  PSVACSTAKAVEWDAAWSKHLDPSGRAALGVHDAAYEDS  557



>ref|XP_007047957.1| Asparagine synthetase 3 isoform 2 [Theobroma cacao]
 gb|EOX92114.1| Asparagine synthetase 3 isoform 2 [Theobroma cacao]
Length=554

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDD+Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDDQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+ LV+D+ML NASF+YPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG
Sbjct  459  YSWIDGLKDHADKLVTDAMLMNASFIYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGI  275
            PSVACSTA+AVEWDA+WSKN DPSGRAAL +
Sbjct  519  PSVACSTAKAVEWDAAWSKNPDPSGRAALAM  549



>ref|NP_001278720.1| asparagine synthetase [glutamine-hydrolyzing] [Zea mays]
 gb|ACF80883.1| unknown [Zea mays]
 emb|CAR70072.1| asparagine synthetase [Zea mays]
 emb|CAR82078.1| asparagine synthetase [Zea mays]
 gb|AFW87613.1| asparagine synthetase [Zea mays]
Length=591

 Score =   295 bits (755),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FI+ AM IDPEWKM++ DLGRIEKWV+RNAFDD++ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKSFISVAMDIDPEWKMIKRDLGRIEKWVIRNAFDDDERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  VSDSM+ NA FVYPENTPTTKEGYYYR IFEKFFPK AARSTVPGG
Sbjct  459  YSWIDGLKDHASQHVSDSMMMNAGFVYPENTPTTKEGYYYRMIFEKFFPKPAARSTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+H AAYED
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHDAAYED  556



>ref|XP_007163648.1| hypothetical protein PHAVU_001G252200g [Phaseolus vulgaris]
 emb|CAO91866.1| asparagine synthetase type III [Phaseolus vulgaris]
 emb|CAP04368.1| class II asparagine synthetase [Phaseolus vulgaris]
 gb|ESW35642.1| hypothetical protein PHAVU_001G252200g [Phaseolus vulgaris]
Length=570

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM+R DLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDVAMSIDPEWKMIRRDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWID LKDHA+  V D+ +  A+F+YPENTPTTKEGY YRTIFEKFFPKNAAR+TVPGG
Sbjct  459  YSWIDALKDHADKQVPDATMLAANFIYPENTPTTKEGYLYRTIFEKFFPKNAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDASWSKNLDPSGRAALG+H A+YED  D K
Sbjct  519  PSVACSTAKAVEWDASWSKNLDPSGRAALGVHEASYEDVVDTK  561



>ref|XP_009131148.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3-like 
[Brassica rapa]
Length=580

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK F++ AM IDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKAFLDVAMGIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NA+FV+PENTP TKE YYYR IFEKFFPK+AAR+TVPGG
Sbjct  460  YSWIDGLKDHANKHVSDAMLTNANFVFPENTPLTKEAYYYRAIFEKFFPKSAARATVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+W  NLDPSGRAALG+H AAYE     K        VQKL  + A
Sbjct  520  PSVACSTAKAVEWDAAWKGNLDPSGRAALGVHVAAYE---GDKAEAPRPEKVQKLAEKTA  576

Query  187  SVAV  176
               V
Sbjct  577  EAIV  580



>ref|NP_851272.1| asparagine synthetase 2 [Arabidopsis thaliana]
 sp|Q9LV77.1|ASNS2_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Arabidopsis thaliana]
 gb|AAK32927.1|AF367340_1 AT5g65010/MXK3_25 [Arabidopsis thaliana]
 dbj|BAA97313.1| asparagine synthetase [Arabidopsis thaliana]
 gb|AAM70575.1| AT5g65010/MXK3_25 [Arabidopsis thaliana]
 gb|AED97984.1| asparagine synthetase 2 [Arabidopsis thaliana]
Length=578

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 146/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWK+++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLNVAMSIDPEWKLIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHA  269
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H 
Sbjct  519  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHV  551



>emb|CDX81165.1| BnaC03g04190D [Brassica napus]
Length=580

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 154/184 (84%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK F++ AM IDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKAFLDVAMGIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NA+FV+P+NTP TKE YYYR IFEKFFPK+AAR+TVPGG
Sbjct  460  YSWIDGLKDHANKHVSDAMLTNANFVFPDNTPVTKEAYYYRAIFEKFFPKSAARATVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+W  NLDPSGRAALG+H AAYE   D    T  E  VQKL  + A
Sbjct  520  PSVACSTAKAVEWDAAWKGNLDPSGRAALGVHVAAYEG--DKAEDTRPE-KVQKLAEKTA  576

Query  187  SVAV  176
               V
Sbjct  577  EAIV  580



>gb|AAZ66934.1| 117M18_15 [Brassica rapa]
Length=608

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK F++ AM IDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  428  LDKAFLDVAMGIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  487

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NA+FV+PENTP TKE YYYR IFEKFFPK+AAR+TVPGG
Sbjct  488  YSWIDGLKDHANKHVSDAMLTNANFVFPENTPLTKEAYYYRAIFEKFFPKSAARATVPGG  547

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+W  NLDPSGRAALG+H AAYE     K        VQKL  + A
Sbjct  548  PSVACSTAKAVEWDAAWKGNLDPSGRAALGVHVAAYE---GDKAEAPRPEKVQKLAEKTA  604

Query  187  SVAV  176
               V
Sbjct  605  EAIV  608



>emb|CDX78372.1| BnaA03g02840D [Brassica napus]
Length=580

 Score =   293 bits (750),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK F++ AM IDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKAFLDVAMGIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML NA+FV+P+NTP TKE YYYR IFEKFFPK+AAR+TVPGG
Sbjct  460  YSWIDGLKDHANKHVSDAMLTNANFVFPDNTPVTKEAYYYRAIFEKFFPKSAARATVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+W  NLDPSGRAALG+H AAYE     K        VQKL  + A
Sbjct  520  PSVACSTAKAVEWDAAWKGNLDPSGRAALGVHVAAYE---GDKAEAPRPEKVQKLAEKTA  576

Query  187  SVAV  176
               V
Sbjct  577  EAIV  580



>ref|XP_002864935.1| hypothetical protein ARALYDRAFT_496723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41194.1| hypothetical protein ARALYDRAFT_496723 [Arabidopsis lyrata subsp. 
lyrata]
Length=574

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++PDLGRIEKWVLRNAFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLNVAMSIDPEWKMIKPDLGRIEKWVLRNAFDDEQRPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK-NAARSTVPG  371
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK +AAR+TVPG
Sbjct  459  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKQSAARATVPG  518

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHA  269
            GPS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H 
Sbjct  519  GPSIACSTAKAVEWDATWSKNLDPSGRAALGVHV  552



>gb|AAC72837.1| asparagine synthetase [Arabidopsis thaliana]
Length=578

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 145/153 (95%), Gaps = 0/153 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWK+++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLNVAMSIDPEWKLIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSD+ML+NASF +P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  459  YSWIDGLKDHANKHVSDTMLSNASFFFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHA  269
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H 
Sbjct  519  PSIACSTAKAVEWDATWSKNLDPSGRAALGVHV  551



>gb|EMT31774.1| Asparagine synthetase (glutamine-hydrolyzing) [Aegilops tauschii]
Length=589

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 158/191 (83%), Gaps = 7/191 (4%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM +DPE KM+R DLGRIEKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKSFINVAMDLDPECKMIRRDLGRIEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NASFVYP+NTPTTKE YYYRT+FEKF+PKNAAR TVPGG
Sbjct  459  YSWIDGLKDHANAHVSDSMMTNASFVYPDNTPTTKEAYYYRTVFEKFYPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDA------KTTTSSETSVQ  209
            PSVACSTA+AVEWD +WSK LDPSGRAALG+H AAY E AP +        + S    V+
Sbjct  519  PSVACSTAKAVEWDTAWSKLLDPSGRAALGVHDAAYKEKAPASVDPAVDDVSCSPAHDVK  578

Query  208  KLEVEKASVAV  176
            +L+   ++ AV
Sbjct  579  RLKTAVSAAAV  589



>ref|XP_010680552.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 [Beta 
vulgaris subsp. vulgaris]
Length=587

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI+ AM IDPEWKM+  D GRIEKWVLRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFIDVAMGIDPEWKMINCDQGRIEKWVLRNAFDDDKKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  V+DSMLANASFVYP+NTPTTKEGYYYR IFEKFFPKNAAR TVPGG
Sbjct  459  YSWIDGLKDHASKHVTDSMLANASFVYPDNTPTTKEGYYYRAIFEKFFPKNAARHTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            P++ACSTA+AVEWDASWSKNLDPSGRAALG+H AAY +
Sbjct  519  PTIACSTAKAVEWDASWSKNLDPSGRAALGVHEAAYRE  556



>dbj|BAJ84981.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM +DPE KM+R DLGRIEKWVLRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDLDPECKMIRRDLGRIEKWVLRNAFDDDEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NASFVYPENTPTTKE YYYRT+FEKF+PKNAAR TVPGG
Sbjct  459  YSWIDGLKDHANAHVSDSMMTNASFVYPENTPTTKEAYYYRTVFEKFYPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSK LDPSGRAALG+H AAYE+
Sbjct  519  PSVACSTAKAVEWDAAWSKLLDPSGRAALGVHDAAYEE  556



>gb|AFZ85291.1| asparagine synthetase [Secale cereale x Triticum turgidum subsp. 
durum]
Length=587

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM +DPE KM+R DLGRIEKWVLRNAFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDLDPESKMIRRDLGRIEKWVLRNAFDDDEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHAN  VSDSM+ NASFVYPENTPTTKE YYYRT+FEKF+PKNAAR TVPGG
Sbjct  459  YSWIDGLKDHANAHVSDSMITNASFVYPENTPTTKEAYYYRTVFEKFYPKNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSK LDPSGRAALG+H AAYE+
Sbjct  519  PSVACSTAKAVEWDAAWSKLLDPSGRAALGVHDAAYEE  556



>dbj|BAK06280.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95102.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=589

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM +DPE KM+R DLGRIEKWVLRNAFDD ++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNFINVAMDLDPECKMIRRDLGRIEKWVLRNAFDDNEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  VSDSM+ NASFVYPENTPTTKE YYYRT+FEKF+PKNAAR TVPGG
Sbjct  459  YSWIDGLKDHASAHVSDSMMTNASFVYPENTPTTKEAYYYRTVFEKFYPKNAARQTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA+AVEWDA+WSK LDPSGRAALG+H AAYE+
Sbjct  519  PSVACSTAKAVEWDAAWSKLLDPSGRAALGVHDAAYEE  556



>ref|NP_201306.2| asparagine synthetase 2 [Arabidopsis thaliana]
 gb|AED97985.1| asparagine synthetase 2 [Arabidopsis thaliana]
Length=579

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWK+++PDLGRIEKWVLRNAFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFLNVAMSIDPEWKLIKPDLGRIEKWVLRNAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK-NAARSTVPG  371
            YSWIDGLKDHAN  VSD+ML+NASFV+P+NTP TKE YYYRTIFEKFFPK +AAR+TVPG
Sbjct  459  YSWIDGLKDHANKHVSDTMLSNASFVFPDNTPLTKEAYYYRTIFEKFFPKQSAARATVPG  518

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHA  269
            GPS+ACSTA+AVEWDA+WSKNLDPSGRAALG+H 
Sbjct  519  GPSIACSTAKAVEWDATWSKNLDPSGRAALGVHV  552



>ref|XP_007207234.1| hypothetical protein PRUPE_ppa015268mg [Prunus persica]
 gb|EMJ08433.1| hypothetical protein PRUPE_ppa015268mg [Prunus persica]
Length=563

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -1

Query  673  VRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANGLVSDS  494
            +RPDLGRIEKWVLRNAFDD Q+PYLPKHILYRQKEQFSDGVGYSWIDGLKDHAN  V+D+
Sbjct  396  IRPDLGRIEKWVLRNAFDDVQKPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANKQVTDA  455

Query  493  MLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGGPSVACSTARAVEWDASWS  314
            ML +ASF+YPENTPTTKE YYYRTIFEKFFPKNAARSTVPGGPSVACSTA+AVEWDA+WS
Sbjct  456  MLTHASFIYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGGPSVACSTAKAVEWDAAWS  515

Query  313  KNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLE--VEKASVAV  176
            KNLDPSGRAALGIH+AAYE+A DAK  +S   S +KL+   EKA+  V
Sbjct  516  KNLDPSGRAALGIHSAAYEEAVDAKNKSSLSGSPKKLQGVGEKAAAVV  563



>gb|ABQ58084.1| asparagine synthetase [Arachis diogoi]
Length=204

 Score =   274 bits (701),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM++ + GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  19   LDKEFINVAMNIDPEWKMIKREEGRIEKWVLRRAFDDEEKPYLPKHILYRQKEQFSDGVG  78

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+D M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+A  TVPGG
Sbjct  79   YSWIDGLKDHAAKHVTDKMMLNAGNIFPHNTPTTKEAYYYRMIFERFFPQNSAVLTVPGG  138

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
             SVACSTA+AVEWDASWSKNLDPSG+AALG+H +AY++  ++ +  +    +  +E    
Sbjct  139  ASVACSTAKAVEWDASWSKNLDPSGKAALGVHMSAYDEKANSVSKAAEFEKIIPMESSHV  198

Query  187  SVAV  176
             VA+
Sbjct  199  GVAI  202



>ref|XP_004169772.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like, 
partial [Cucumis sativus]
Length=514

 Score =   283 bits (725),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM++ D GRIEKWVLR AFDDEQ+PYLPKH+LYRQKEQFSDGVG
Sbjct  326  LDKEFINVAMAIDPEWKMIKRDQGRIEKWVLRRAFDDEQQPYLPKHVLYRQKEQFSDGVG  385

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+AR TVPGG
Sbjct  386  YSWIDGLKAHAAQHVTDKMMLNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSARLTVPGG  445

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET---SVQKLEV  197
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAY D  +     +      S+ ++EV
Sbjct  446  PSIACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAYGDETNGVNNVAPPKIIDSIPRMEV  505

Query  196  EKASVAV  176
                V +
Sbjct  506  STPGVKI  512



>gb|ABR16560.1| unknown [Picea sitchensis]
Length=590

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN +M IDPEWKMVRPDLGRIEKWVLR AFDD + PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINISMGIDPEWKMVRPDLGRIEKWVLRKAFDDAENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V++ M+ANA ++YPENTP TKE YYYR IFE+FFP+NAAR TVPGG
Sbjct  459  YSWIDGLKEHAANHVTNMMMANAKYIYPENTPMTKEAYYYRMIFERFFPQNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT----TSSETSVQKLE  200
            PSVACSTA+A+EWDA+WS+N DPSGRAALG+H  +Y++  DA        +++ S++K +
Sbjct  519  PSVACSTAKALEWDAAWSRNPDPSGRAALGVHVDSYKENTDASNNGDEEVTADVSIKKPK  578

Query  199  VEKASVAV  176
            ++   V V
Sbjct  579  LQDGGVKV  586



>ref|XP_004143163.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
 gb|KGN47067.1| hypothetical protein Csa_6G183190 [Cucumis sativus]
Length=587

 Score =   284 bits (726),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM++ D GRIEKWVLR AFDDEQ+PYLPKH+LYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMAIDPEWKMIKRDQGRIEKWVLRRAFDDEQQPYLPKHVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMLNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET---SVQKLEV  197
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+HAAAY D  +     +      S+ ++EV
Sbjct  519  PSIACSTAKAVEWDAAWSKNLDPSGRAALGVHAAAYGDETNGVNNVAPPKIIDSIPRMEV  578

Query  196  EKASVAV  176
                V +
Sbjct  579  STPGVKI  585



>ref|XP_008465262.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis melo]
Length=586

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM++ D GRIEKWVLR AFDDEQ+PYLPKH+LYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMAIDPEWKMIKRDQGRIEKWVLRRAFDDEQQPYLPKHVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMLNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET--SVQKLEVE  194
            PS+ACSTA+A+EWDA+WSKNLDPSGRAALG+HAAAY D  +       +   S+ ++EV 
Sbjct  519  PSIACSTAKAIEWDAAWSKNLDPSGRAALGVHAAAYGDEANGVNIAPPKIIDSIPRMEVG  578

Query  193  KASVAV  176
               V +
Sbjct  579  TPGVKI  584



>ref|XP_006828491.1| hypothetical protein AMTR_s00060p00168860 [Amborella trichopoda]
 gb|ERM95907.1| hypothetical protein AMTR_s00060p00168860 [Amborella trichopoda]
Length=592

 Score =   283 bits (724),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK  IN AM IDPEWKMVRPD GRIEKW+LRNAFDD Q+PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKNLINIAMDIDPEWKMVRPDQGRIEKWILRNAFDDPQKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  VSD+MLA    ++PENTPTTKE YYYR IFEKFFPKN+A+ TVPGG
Sbjct  459  YSWIDGLKDHASRHVSDAMLAQVINIFPENTPTTKEAYYYRAIFEKFFPKNSAQLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT  233
            PSVACSTA+A+EWDA+WSKN DPSGRAALG+HAAAY++ P    T
Sbjct  519  PSVACSTAKALEWDAAWSKNPDPSGRAALGVHAAAYDEEPSVTVT  563



>gb|ADU02856.1| asparagine synthetase [Pinus pinaster]
Length=593

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AM IDPEWKMV+PD+GRIEKWVLR AFDDEQ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFVNVAMDIDPEWKMVKPDIGRIEKWVLRRAFDDEQNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D+ML NA +++P NTPTTKE YYYR IFE+F+P+NAAR TVPGG
Sbjct  460  YSWIDGLKSHAAEHVTDTMLRNAKYIFPHNTPTTKEAYYYRMIFERFYPQNAARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA  251
            PSVACSTA+AVEWDA+W+ NLDPSGRAALG+HA+AYE+ 
Sbjct  520  PSVACSTAKAVEWDAAWAHNLDPSGRAALGVHASAYEEC  558



>gb|AAU89392.1| glutamine-dependent asparagine synthetase [Triticum aestivum]
Length=585

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINEAMSIDPEWKMIRPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA F+YP NTPTTKE Y YR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAESNVTDKMMSNAKFIYPHNTPTTKEAYCYRMIFERFFPQNSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE-DAPDAKTTTSSETSVQKLEVEK  191
            PSVACSTA+AVEWDA WS NLDPSGRAALG+H +AYE +   A     +    + +EV  
Sbjct  519  PSVACSTAKAVEWDAQWSGNLDPSGRAALGVHLSAYEQEHLPATIMAGTSKKPRMIEVAA  578

Query  190  ASVAV  176
              VA+
Sbjct  579  PGVAI  583



>ref|XP_003579059.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Brachypodium distachyon]
Length=585

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINEAMSIDPEWKMIRPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA F+YP NTPTTKE YYYR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAESNVTDKMMSNAKFIYPHNTPTTKEAYYYRMIFERFFPQNSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDA WS NLDPSGRAALG+H +AYE
Sbjct  519  PSVACSTAKAVEWDAQWSGNLDPSGRAALGVHLSAYE  555



>gb|ADK13052.1| asparagine synthetase [Pinus pinaster]
Length=590

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN +M IDPEWKMVRPDLGRIEKW+LR AFDD + PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINISMGIDPEWKMVRPDLGRIEKWILRKAFDDVENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V++ M+ANA ++YPENTPTTKE YYYR IFE+FFP+NAAR TVPGG
Sbjct  459  YSWIDGLKEHAANHVTNMMMANAKYIYPENTPTTKEAYYYRMIFERFFPQNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
            PSVACSTA+A+EWDA+WS+N DPSGRAALG+H  AY++  D     + E S
Sbjct  519  PSVACSTAKALEWDAAWSRNPDPSGRAALGVHVDAYKENADIGNGNNEEVS  569



>gb|EMT27682.1| Asparagine glutamine-hydrolyzing synthetase [Aegilops tauschii]
Length=590

 Score =   281 bits (720),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKW+LR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  404  LDKEFINEAMSIDPEWKMIRPDLGRIEKWMLRKAFDDEEQPFLPKHILYRQKEQFSDGVG  463

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA F+YP NTPTTKE Y YR IFE+FFP+N+A  TVPGG
Sbjct  464  YSWIDGLKAHAESNVTDKMMSNAKFIYPHNTPTTKEAYCYRMIFERFFPQNSAILTVPGG  523

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE-DAPDAKTTTSSETSVQKLEVEK  191
            PSVACSTA+AVEWDA WS NLDPSGRAALG+H +AYE +   A     +    + +EV  
Sbjct  524  PSVACSTAKAVEWDAQWSGNLDPSGRAALGVHLSAYEQEHLPATIMAGTSKKPRMIEVAA  583

Query  190  ASVAV  176
              VA+
Sbjct  584  PGVAI  588



>ref|XP_010907409.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Elaeis guineensis]
Length=590

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 153/184 (83%), Gaps = 2/184 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKM++ DLGR+EKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPDWKMIKSDLGRLEKWVLRNAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ +YP NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEKHVTDRMMLNANRIYPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACST++A+EWD+ WS NLDPSGRAA+G+H +AY+  P   T+ S+     K+  +KA
Sbjct  519  PSVACSTSKAIEWDSQWSNNLDPSGRAAVGVHVSAYD--PQLPTSLSAGKGPAKITNKKA  576

Query  187  SVAV  176
             V V
Sbjct  577  RVVV  580



>ref|XP_009402383.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Musa 
acuminata subsp. malaccensis]
Length=591

 Score =   281 bits (718),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FI  AMSIDPEWKM++PDLGRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKAFIGVAMSIDPEWKMIKPDLGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VS  M+ NA  +YP NTPTTKE YYYR IFE+FFP+N+AR T+PGG
Sbjct  459  YSWIDGLKSHAAEHVSGKMMQNAKHIYPHNTPTTKEAYYYRMIFERFFPQNSARLTIPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA--PDAKTT-TSSETSVQK  206
            PSVACSTA+A+EWDA WSKNLDPSGRAALG+H +AY+ A  P + TT TSS   V K
Sbjct  519  PSVACSTAKAIEWDAQWSKNLDPSGRAALGVHVSAYDPAAVPSSLTTGTSSAMLVNK  575



>gb|EMT24348.1| Asparagine synthetase (glutamine-hydrolyzing) [Aegilops tauschii]
Length=588

 Score =   280 bits (717),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 146/179 (82%), Gaps = 21/179 (12%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM +DPE KM+R DLGR+EKWVLRNAFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  375  LDKNFINVAMDLDPECKMIRRDLGRMEKWVLRNAFDDEKKPYLPKHILYRQKEQFSDGVG  434

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK----------  398
            YSWIDGLKDHAN  VSDSM+ NASFVYPENTPTTKE YYYRT+FEKF+PK          
Sbjct  435  YSWIDGLKDHANAHVSDSMMTNASFVYPENTPTTKEAYYYRTVFEKFYPKVQKLQPAFAF  494

Query  397  -----------NAARSTVPGGPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
                       NAAR TVPGGPSVACSTA+AVEWDA+WSK LDPSGRAALG+H AAYE+
Sbjct  495  IMIFPSYFICMNAARLTVPGGPSVACSTAKAVEWDAAWSKLLDPSGRAALGVHDAAYEE  553



>gb|ABR16980.1| unknown [Picea sitchensis]
Length=591

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM IDP+WKMV+PD+GRIEKWVLR AFD+EQ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINIAMDIDPDWKMVKPDIGRIEKWVLRKAFDEEQNPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D+ML NA +++P NTPTTKE YYYRTIFE+ +P+NAAR TVPGG
Sbjct  460  YSWIDGLKSHAAEHVTDTMLGNAKYIFPHNTPTTKEAYYYRTIFERLYPQNAARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKL  203
            PSVACS+A+AVEWD  W+ NLDPSGRAALG+HA+AY+++ ++     S   + KL
Sbjct  520  PSVACSSAKAVEWDDGWAGNLDPSGRAALGVHASAYQESKNSVAANGSVDMLGKL  574



>ref|XP_008805175.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Phoenix 
dactylifera]
Length=589

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 145/169 (86%), Gaps = 4/169 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++PDLGRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKPDLGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTPTTKEGYYYR IFE+FF +N+AR +VPGG
Sbjct  459  YSWIDGLKAHAEEHVTDRMMLNAERIYPHNTPTTKEGYYYRMIFERFFSQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSE  221
            PSVACSTA+AVEWD+ WS NLDPSGRAALG+H +AY    D +  TSSE
Sbjct  519  PSVACSTAKAVEWDSQWSNNLDPSGRAALGVHVSAY----DPQAPTSSE  563



>ref|NP_001131013.1| asparagine synthetase2 [Zea mays]
 emb|CAR70073.1| asparagine synthetase [Zea mays]
 emb|CAR82079.1| asparagine synthetase [Zea mays]
 gb|ACN28039.1| unknown [Zea mays]
 gb|ACN28874.1| unknown [Zea mays]
 gb|ACR34235.1| unknown [Zea mays]
 tpg|DAA59147.1| TPA: asparagine synthetase [Zea mays]
Length=606

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV+PDLGRIEKWVLR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  416  LDKEFINAAMSIDPEWKMVQPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVG  475

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D ML+NA F++P NTPTTKE YYYR +FE+FFP+ +A  TVPGG
Sbjct  476  YSWIDGLKAHATSNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKSAILTVPGG  535

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPD  245
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H AAYE   D
Sbjct  536  PSVACSTAKAIEWDAQWSGNLDPSGRAALGVHLAAYEHQHD  576



>gb|AAO39048.1| asparagine synthetase 2 [Hordeum vulgare]
Length=581

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM+RPDLGRIEKW+LR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDEAMSIDPEWKMIRPDLGRIEKWILRKAFDDEEKPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   VSD M++NA F+YP NTPTTKE YYYR IFE++FP+++A  TVPGG
Sbjct  459  YSWIDGLKDHAASNVSDKMMSNAKFIYPHNTPTTKEAYYYRMIFERYFPQSSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H +AYE
Sbjct  519  PSVACSTAKAIEWDAQWSGNLDPSGRAALGVHLSAYE  555



>dbj|BAJ87368.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM+RPDLGRIEKW+LR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDEAMSIDPEWKMIRPDLGRIEKWILRKAFDDEEKPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   VSD M++NA F+YP NTPTTKE YYYR IFE++FP+++A  TVPGG
Sbjct  459  YSWIDGLKDHAASNVSDKMMSNAKFIYPHNTPTTKEAYYYRMIFERYFPQSSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H +AYE
Sbjct  519  PSVACSTAKAIEWDAQWSGNLDPSGRAALGVHLSAYE  555



>dbj|BAJ88564.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM+RPDLGRIEKW+LR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDEAMSIDPEWKMIRPDLGRIEKWILRKAFDDEEKPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   VSD M++NA F+YP NTPTTKE YYYR IFE++FP+++A  TVPGG
Sbjct  459  YSWIDGLKDHAASNVSDKMMSNAKFIYPHNTPTTKEAYYYRMIFERYFPQSSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H +AYE
Sbjct  519  PSVACSTAKAIEWDAQWSGNLDPSGRAALGVHLSAYE  555



>ref|XP_008352597.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Malus domestica]
Length=176

 Score =   265 bits (678),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 131/143 (92%), Gaps = 2/143 (1%)
 Frame = -1

Query  700  MSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVGYSWIDGLKD  521
            M+IDPEWKM+RP  GRIEKWVLRNAFD++Q+PYLPKHILYRQKEQFSDGVGYSWIDGL D
Sbjct  1    MNIDPEWKMIRP--GRIEKWVLRNAFDNDQKPYLPKHILYRQKEQFSDGVGYSWIDGLXD  58

Query  520  HANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGGPSVACSTAR  341
            HAN  V+DSML  ASF+YPENTPTTKE YYYRTIFEKFFPKNAARSTVPGGPSVACSTA+
Sbjct  59   HANSQVTDSMLIXASFIYPENTPTTKEAYYYRTIFEKFFPKNAARSTVPGGPSVACSTAK  118

Query  340  AVEWDASWSKNLDPSGRAALGIH  272
            AVEWDA W KN DPSGRAALG H
Sbjct  119  AVEWDAEWLKNPDPSGRAALGNH  141



>ref|XP_004962101.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Setaria italica]
Length=606

 Score =   279 bits (713),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMVRPDLGRIEKWVLR AFDDE+ P+LPKHILYRQKEQFSDGVG
Sbjct  406  LDKEFINEAMSIDPEWKMVRPDLGRIEKWVLRKAFDDEENPFLPKHILYRQKEQFSDGVG  465

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D ML+NA F++P NTPTTKE YYYR IFE+FFP+  A  TVPGG
Sbjct  466  YSWIDGLKAHAASNVTDKMLSNAKFIFPHNTPTTKEAYYYRMIFERFFPQKPAILTVPGG  525

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK  206
            PSVACSTA+AVEWDA WS NLDPSGRAALG+H A+Y      ++ + SE+  Q+
Sbjct  526  PSVACSTAKAVEWDAQWSANLDPSGRAALGVHLASYH-----QSESESESGAQQ  574



>ref|XP_009622719.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana 
tomentosiformis]
Length=590

 Score =   278 bits (710),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKHDQGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDRMMLNASHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED-APDAKTTTSSETSVQKL  203
            PS+ACSTA+A+EWDASWS NLDPSGRAA+G+H +AY+D  PD        T +  +
Sbjct  519  PSIACSTAKAIEWDASWSNNLDPSGRAAIGVHNSAYDDHLPDVSNGNLDTTIIDNV  574



>gb|AAK49456.1|AF307145_1 glutamine-dependent asparagine synthetase 1 [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ98806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLR AFDDE++P+LPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINEAMSIDPEWKMIRPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK H    V+D M++NA F+YP NTPTTKE Y YR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHTESNVTDKMMSNAKFIYPHNTPTTKEAYCYRMIFERFFPQNSAILTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDA WS NLDPSGRAALG+H +AYE
Sbjct  519  PSVACSTAKAVEWDARWSGNLDPSGRAALGVHLSAYE  555



>gb|AHA44834.1| asparagine synthetase [Larix kaempferi]
Length=589

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 154/187 (82%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN +M IDPE KMVRPDLGRIEKWVLR AFDD + PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINISMEIDPESKMVRPDLGRIEKWVLRKAFDDVENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+++M+ANA ++YP+NTPTTKE YYYR IFE+FFP+NAAR TVPGG
Sbjct  459  YSWIDGLKVHAANHVTNTMMANAKYIYPDNTPTTKEAYYYRMIFERFFPQNAARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE---DAPDAKTTTSSETSVQKLEV  197
            PSVACSTA+A+EWDA+WS+N DPSGRAALG+H  AY+   DA +     +++ SV++ + 
Sbjct  519  PSVACSTAKALEWDAAWSRNPDPSGRAALGVHVDAYKENADASNGDEEVAADISVKRPKF  578

Query  196  EKASVAV  176
            +   V V
Sbjct  579  QDDGVKV  585



>ref|XP_009766230.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nicotiana 
sylvestris]
Length=590

 Score =   275 bits (704),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKHDHGRIEKWVLRKAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDRMMLNAAHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED-APDAKTTTSSETSVQKL  203
            PS+ACSTA+A+EWDASWS NLDPSGRAA+G+H +AY+D  PD        T +  +
Sbjct  519  PSIACSTAKAIEWDASWSNNLDPSGRAAIGVHNSAYDDHLPDVGNGNLDTTIIDNV  574



>ref|NP_001241726.1| asparagine synthetase [Zea mays]
 gb|ACG25442.1| asparagine synthetase [Zea mays]
Length=604

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 148/189 (78%), Gaps = 5/189 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKMVRPDL RIEKWVLR AFDDE++P+LPK+ILYRQKEQFSDGVG
Sbjct  414  LDKEFINAAMSIDPQWKMVRPDLRRIEKWVLRKAFDDEEQPFLPKYILYRQKEQFSDGVG  473

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D ML+NA F++P NTPTTKE YYYR +FE+FFP+ +A  TVPGG
Sbjct  474  YSWIDGLKTHAASNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKSAILTVPGG  533

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPD-----AKTTTSSETSVQKL  203
            PSVACSTA+A+EWD  WS NLDPSGRAALG+H AAYE   D     A   T S    + +
Sbjct  534  PSVACSTAKAIEWDTQWSGNLDPSGRAALGVHLAAYEHQHDPEHVPAAIATGSGKKPRTI  593

Query  202  EVEKASVAV  176
             V    VA+
Sbjct  594  RVAPPGVAI  602



>ref|XP_010264605.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Nelumbo 
nucifera]
Length=589

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM IDPEWKM++PD GRIEKWVLR AFDD+++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMDIDPEWKMIKPDQGRIEKWVLRKAFDDDEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQHVMDKMMLNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKT  236
             SVACSTA+AVEWD++WS NLDPSGRAALG+HA+AYE   +A T
Sbjct  519  ASVACSTAKAVEWDSAWSNNLDPSGRAALGVHASAYEQQLNATT  562



>ref|XP_008445538.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X2 [Cucumis melo]
Length=472

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDPEWKM++ D GRIEKWVLR AFDDEQ+PYLPK++LYRQKEQFSDGVG
Sbjct  284  LDKKFIEVAMAIDPEWKMIKHDQGRIEKWVLRRAFDDEQQPYLPKNVLYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+A  TVPGG
Sbjct  344  YSWIDGLKAHADQHVTDKMILNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSACLTVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED---APDAKTTTSSETSVQKLEV  197
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+HA+ Y D     +A        ++ ++EV
Sbjct  404  PSIACSTAKAVEWDAAWSKNLDPSGRAALGVHASTYGDEANGLNAIVQPKIVDTIPRMEV  463

Query  196  EKASVAV  176
              A V +
Sbjct  464  GTAGVKI  470



>ref|XP_010922574.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Elaeis 
guineensis]
Length=589

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM++PDLGRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIHVAMSIDPEWKMIKPDLGRIEKWVLRKAFDDEEIPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTPTTKE Y+YR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEEHVTDRMMLNAKRIYPHNTPTTKEAYHYRMIFERFFPQNSARVTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWD+ WS NLDPSGRAALG+H +AY+
Sbjct  519  PSVACSTAKAIEWDSQWSNNLDPSGRAALGVHVSAYD  555



>emb|CAD43058.1| putative asparagine synthetase [Pinus sylvestris]
Length=593

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AM IDPE KMV+PD+GRIEKWVLR AFDDEQ PYLPKHILYRQK QFSDGVG
Sbjct  400  LDKEFVNVAMDIDPERKMVKPDIGRIEKWVLRRAFDDEQNPYLPKHILYRQKGQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D+ML NA +++P NTPTTKE YYYR IFE+F+P+NAAR TVPGG
Sbjct  460  YSWIDGLKSHAAEHVTDTMLRNAKYIFPHNTPTTKEAYYYRMIFERFYPQNAARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA  251
            PSVACSTA+AVEWDA+W+ NLDPSGRAALG+HA+AY++ 
Sbjct  520  PSVACSTAKAVEWDAAWAHNLDPSGRAALGVHASAYQEC  558



>ref|NP_001268166.1| asparagine synthetase [glutamine-hydrolyzing]-like [Vitis vinifera]
 gb|AEO72339.1| asparagine synthetase 1 [Vitis vinifera]
Length=583

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM IDPEWKM++P+ GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIKVAMDIDPEWKMIKPEQGRIEKWVLRRAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHASQHVTDKMMLNASHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV  212
             SVACSTA+AVEWD++WS NLDPSGRAALG+H +AY    D K TT S  +V
Sbjct  519  ASVACSTAKAVEWDSAWSNNLDPSGRAALGVHLSAY----DQKLTTVSAANV  566



>emb|CBI15932.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM IDPEWKM++P+ GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIKVAMDIDPEWKMIKPEQGRIEKWVLRRAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHASQHVTDKMMLNASHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV  212
             SVACSTA+AVEWD++WS NLDPSGRAALG+H +AY    D K TT S  +V
Sbjct  519  ASVACSTAKAVEWDSAWSNNLDPSGRAALGVHLSAY----DQKLTTVSAANV  566



>gb|KJB55712.1| hypothetical protein B456_009G0905001, partial [Gossypium raimondii]
Length=330

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LD EFIN AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  144  LDIEFINAAMSIDPESKMIKKDQGRIEKWILRKAFDDEERPYLPKHILYRQKEQFSDGVG  203

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS+++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  204  YSWIDGLKAHAAKNVTDKMMLNASYIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  263

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET--SVQKLEVE  194
             SVACSTA+AVEWD +W  NLDPSGRAALG+H +AY+  P   +   S+   S+ ++ VE
Sbjct  264  ASVACSTAKAVEWDVAWKNNLDPSGRAALGVHLSAYDAEPPLISNVPSKVIDSIPRM-VE  322

Query  193  KASVAV  176
               VA+
Sbjct  323  VPGVAI  328



>ref|XP_006843600.1| hypothetical protein AMTR_s00007p00134530 [Amborella trichopoda]
 gb|ERN05275.1| hypothetical protein AMTR_s00007p00134530 [Amborella trichopoda]
Length=590

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 150/183 (82%), Gaps = 2/183 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM IDPEWKM++PD GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMDIDPEWKMIKPDQGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V+D M+ANA FVYP N+P TKE Y+YR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKEHAATHVTDRMMANAKFVYPHNSPLTKEAYFYRMIFERFFPQNSASLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
             S+ACSTA+A+EWDA WSKNLDPSGRAA+G+HA+AY DAP   +    + S  KL  +KA
Sbjct  519  ASIACSTAKAIEWDAEWSKNLDPSGRAAVGVHASAY-DAPMPNSGVVGKAS-SKLINKKA  576

Query  187  SVA  179
             + 
Sbjct  577  KMV  579



>ref|XP_004294298.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Fragaria 
vesca subsp. vesca]
Length=586

 Score =   273 bits (699),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPE+KM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMSIDPEFKMIKKDEGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKEGYYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAALHVNDKMMQNAAHIFPHNTPTTKEGYYYRMIFERFFPQNSARQTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET--SVQKLEVE  194
            PSVACSTA A+EWDA WSKNLDPSGRAALG+H +AYE+     +    E   +V  ++V 
Sbjct  519  PSVACSTATAIEWDAEWSKNLDPSGRAALGVHNSAYENQAAVPSGLGPEIIENVPHMKVG  578

Query  193  KASVAV  176
               VA+
Sbjct  579  TQGVAI  584



>gb|AFK47234.1| unknown [Medicago truncatula]
Length=363

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ + GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  177  LDKDFIKVAMDIDPEYKMIKHEEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  236

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  237  YGWIDGIKDHAAKHVTDRMMLNASHIFPFNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  296

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA-KTTTSSETSVQKLEVEK  191
             SVACST +A+EWDASWS NLDPSGRAA G+H +AYE+  ++   T   E  + K+E+  
Sbjct  297  ASVACSTEKAIEWDASWSSNLDPSGRAAFGVHNSAYENQVNSVAKTVEPEKIIPKMEISN  356

Query  190  ASVAV  176
              VA+
Sbjct  357  LGVAI  361



>ref|XP_004240406.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Solanum 
lycopersicum]
Length=590

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKHDQGRIEKWVLRKAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKEGYYYR IF++FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDRMMLNAAHIFPHNTPTTKEGYYYRMIFDRFFPQNSASLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+A+EWDASWS NLDPSGRAA+G+H +AY++
Sbjct  519  PSIACSTAKAIEWDASWSNNLDPSGRAAIGVHNSAYDN  556



>ref|XP_008445536.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Cucumis melo]
 ref|XP_008445537.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Cucumis melo]
Length=587

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDPEWKM++ D GRIEKWVLR AFDDEQ+PYLPK++LYRQKEQFSDGVG
Sbjct  399  LDKKFIEVAMAIDPEWKMIKHDQGRIEKWVLRRAFDDEQQPYLPKNVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHADQHVTDKMILNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSACLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED---APDAKTTTSSETSVQKLEV  197
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+HA+ Y D     +A        ++ ++EV
Sbjct  519  PSIACSTAKAVEWDAAWSKNLDPSGRAALGVHASTYGDEANGLNAIVQPKIVDTIPRMEV  578

Query  196  EKASVAV  176
              A V +
Sbjct  579  GTAGVKI  585



>ref|XP_006344055.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Solanum 
tuberosum]
Length=590

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AMSIDPEWKM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDVAMSIDPEWKMIKHDQGRIEKWVLRKAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKEGYYYR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDRMMLNAAHIFPHNTPTTKEGYYYRMIFERFFPQNSASLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PS+ACSTA+A+EWDASWS NLDPSGRAA+G+H +AY++
Sbjct  519  PSIACSTAKAIEWDASWSNNLDPSGRAAIGVHNSAYDN  556



>ref|XP_008805038.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Phoenix dactylifera]
Length=621

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++ DLGR+EKWVLR AF DE+ PYLPK+ILYRQKEQFSDGVG
Sbjct  430  LDKEFINVAMSIDPEWKMIKSDLGRLEKWVLRKAFHDEENPYLPKNILYRQKEQFSDGVG  489

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  490  YSWIDGLKAHAEEHVTDRMMLNAKRIYPHNTPTTKEAYYYRIIFERFFPQNSARLTVPGG  549

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEK  191
            PSVACSTA+A+EWD+ WS NLDPSGRAALG+H +AY+  P   T+ S+     K+  +K
Sbjct  550  PSVACSTAKAIEWDSQWSNNLDPSGRAALGVHVSAYD--PQVHTSLSAGKGPAKITNKK  606



>ref|XP_010253782.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Nelumbo 
nucifera]
Length=589

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM I+PEWKM++PD GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMDIEPEWKMIKPDQGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAENVTDKMMLNASHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWD++WS NLDPSGRAALG+H  AYE
Sbjct  519  ASVACSTAKAVEWDSAWSNNLDPSGRAALGVHVQAYE  555



>ref|XP_010102790.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
 gb|EXB94103.1| Glutamine-dependent asparagine synthetase 2 [Morus notabilis]
Length=577

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI TAMSIDPE KM++P+ G+IEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  390  LDKQFIQTAMSIDPEHKMIKPEEGKIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  449

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYRTIFE+FFP+N+AR TVPGG
Sbjct  450  YSWIDGLKAHAAQHVTDKMMLNAANIFPHNTPTTKEAYYYRTIFERFFPQNSARLTVPGG  509

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDASWSKNLDPSGRAALGIHA+AY+
Sbjct  510  ASVACSTAKAVEWDASWSKNLDPSGRAALGIHASAYD  546



>gb|KHG22055.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=468

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  284  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEYPYLPKHILYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK H    V+D M++NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  344  YSWIDGLKAHTARHVTDKMMSNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  404  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  450



>gb|KHG07877.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=469

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  284  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEYPYLPKHILYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK H    V+D M++NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  344  YSWIDGLKAHTARHVTDKMMSNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  404  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  450



>ref|XP_008349663.1| PREDICTED: asparagine synthetase, nodule [glutamine-hydrolyzing]-like, 
partial [Malus domestica]
Length=200

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM IDPE+KM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  13   LDKDFINVAMDIDPEFKMIKKDQGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  72

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  73   YSWIDGLKAHAELHVTDKMMLNAERIFPHNTPYTKEAYYYRMIFERFFPQNSARNTVPGG  132

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA AV WDA WSKNLDPSGRA L +H  AY D   A  T+     +  +   KA
Sbjct  133  PSVACSTATAVAWDAEWSKNLDPSGRAILEVHQQAY-DKQGAPVTSGIPEIIDNVPQMKA  191

Query  187  S  185
            S
Sbjct  192  S  192



>dbj|BAA96251.1| asparagine synthetase [Astragalus sinicus]
Length=584

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDP  KM+  D GRIEK++LR AFDDE+ PYLPKHIL+RQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPANKMINLDEGRIEKYILRKAFDDEEHPYLPKHILFRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ +YP NTP+TKEGYYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMMRNAANIYPHNTPSTKEGYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            P+VACSTA+AVEWDA+WSKNLDPSGRAALG+HA+AYE+  ++   +     +  LE    
Sbjct  519  PTVACSTAKAVEWDAAWSKNLDPSGRAALGVHASAYENQNNSVNKSIEFEKIIPLEASSV  578

Query  187  SVAV  176
             VA+
Sbjct  579  GVAI  582



>ref|XP_004144212.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
 ref|XP_004158264.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Cucumis sativus]
Length=587

 Score =   270 bits (691),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI+ AM+IDPEWKM++ + GRIEKWVLR AFDDEQ+PYLPK++LYRQKEQFSDGVG
Sbjct  399  LDKKFIDVAMAIDPEWKMIKHNQGRIEKWVLRRAFDDEQQPYLPKNVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHADQHVTDKMILNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSACLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET---SVQKLEV  197
            PS+ACSTA+AVEWDA+WSKNLDPSGRAALG+HA+ Y D  +            ++ ++EV
Sbjct  519  PSIACSTAKAVEWDAAWSKNLDPSGRAALGVHASTYGDEANGLNDIVPPKIVDTIPRMEV  578

Query  196  EKASVAV  176
              A V +
Sbjct  579  STAGVKI  585



>gb|KDO66932.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=474

 Score =   267 bits (682),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+ P  GRIEKW+LR AFDDE+ PYLPKH+LYRQKEQFSDGVG
Sbjct  284  LDKDFINVAMAIDPEWKMINPQEGRIEKWILRKAFDDEERPYLPKHVLYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA +++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  344  YSWIDGLKAHAEQHVTDKMVQNAQYIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDA W+ NLDPSGRAALG+H +AYE
Sbjct  404  ASVACSTAKAVEWDAEWANNLDPSGRAALGVHLSAYE  440



>ref|XP_010043416.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Eucalyptus 
grandis]
Length=589

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKM + + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPKWKMAKREEGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V+D M+ NAS +YP NTPTTKEGYYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YSWIDGLKEHAAQHVTDKMIENASHIYPHNTPTTKEGYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWD +WS NLDPSGRAALG+H +AY+
Sbjct  519  PSVACSTAKAIEWDDAWSNNLDPSGRAALGVHLSAYD  555



>gb|AFH57273.1| asparagine synthetase [Gossypium hirsutum]
Length=583

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAARHVTDKMMFNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  519  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  565



>gb|KJB35221.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=583

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAARHVTDKMMFNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  519  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  565



>gb|KJB35224.1| hypothetical protein B456_006G105200 [Gossypium raimondii]
Length=582

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  458  YSWIDGLKAHAARHVTDKMMFNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  518  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  564



>sp|O24661.3|ASNS_TRIVS RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Triphysaria 
versicolor]
 gb|AAD05033.1| asparagine synthetase [Triphysaria versicolor]
 gb|AAD05034.1| asparagine synthetase [Triphysaria versicolor]
 gb|AAD05035.1| asparagine synthetase [Triphysaria versicolor]
Length=586

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPE KM++PD GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFVNLAMSIDPEAKMIKPDQGRIEKWILRKAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTPTTKEGYYYR IFE+FFP+N+A+ TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDKMMLNAGHIFPHNTPTTKEGYYYRMIFERFFPQNSAKLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            PSVACSTA AV WDASWSKNLDPSGRAA G+H  AYE+
Sbjct  519  PSVACSTATAVAWDASWSKNLDPSGRAATGVHDLAYEN  556



>ref|XP_009416293.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=580

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FI+ AM IDPEWKM++PDLGRIEKWVLR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKGFIDVAMGIDPEWKMIKPDLGRIEKWVLRKAFDDEAKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD M+ +A  VYP NTP TKE YYYR IFE FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAEHVSDKMMQHAEHVYPYNTPATKEAYYYRMIFESFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA WSKN+DPSGRAA+G+HA+AY+  P A +   ++  + +++    
Sbjct  519  PSVACSTAKAVEWDARWSKNVDPSGRAAVGVHASAYD--PTAPSLLDAKHRMTEVKASGL  576

Query  187  SVA  179
            +V+
Sbjct  577  TVS  579



>ref|XP_009416291.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=580

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 149/183 (81%), Gaps = 2/183 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FI+ AM IDPEWKM++PDLGRIEKWVLR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKGFIDVAMGIDPEWKMIKPDLGRIEKWVLRKAFDDEAKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD M+ +A  VYP NTP TKE YYYR IFE FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAEHVSDKMMQHAEHVYPYNTPATKEAYYYRMIFESFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA WSKN+DPSGRAA+G+HA+AY+  P A +   ++  + +++    
Sbjct  519  PSVACSTAKAVEWDARWSKNVDPSGRAAVGVHASAYD--PTAPSLLDAKHRMTEVKASGL  576

Query  187  SVA  179
            +V+
Sbjct  577  TVS  579



>ref|XP_009416292.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=578

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FI+ AM IDPEWKM++PDLGRIEKWVLR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKGFIDVAMGIDPEWKMIKPDLGRIEKWVLRKAFDDEAKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD M+ +A  VYP NTP TKE YYYR IFE FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAEHVSDKMMQHAEHVYPYNTPATKEAYYYRMIFESFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+AVEWDA WSKN+DPSGRAA+G+HA+AY+
Sbjct  519  PSVACSTAKAVEWDARWSKNVDPSGRAAVGVHASAYD  555



>emb|CAA67889.1| asparagine synthetase [Asparagus officinalis]
Length=590

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDPE KM++PDLGRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFMDVAMSIDPESKMIKPDLGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ +YP NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDRMMLNAARIYPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PS+ACSTA+A+EWDA WS NLDPSGRAALG+H +AY+
Sbjct  519  PSIACSTAKAIEWDARWSNNLDPSGRAALGVHDSAYD  555



>gb|KHG11690.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=564

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 144/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  379  LDKEFINVAMSIDPEAKMIKKDEGRIEKWVLRRAFDDEEYPYLPKHILYRQKEQFSDGVG  438

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  439  YSWIDGLKAHAARHVTDKMMFNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  498

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  499  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSNKPS  545



>ref|XP_011080785.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Sesamum 
indicum]
 ref|XP_011080786.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Sesamum 
indicum]
Length=586

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++P+  RIEKW+LR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKPEQKRIEKWILRRAFDDEKQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YSWIDGLKAHADLHVNDKMMLNAAHIFPHNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA AVEWDA+WSKNLDPSGRAA+G+H +AYE
Sbjct  519  ASVACSTATAVEWDAAWSKNLDPSGRAAIGVHNSAYE  555



>ref|XP_008792949.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Phoenix dactylifera]
Length=590

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AMSIDPE+KM++PD+GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIKVAMSIDPEYKMIKPDMGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTP TKE Y YR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAEHVTDKMMQNAQHIYPHNTPATKEAYCYRMIFERFFPQNSARMTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H++AY+
Sbjct  519  PSVACSTAKAIEWDAQWSNNLDPSGRAALGVHSSAYD  555



>ref|XP_004500279.1| PREDICTED: asparagine synthetase, nodule [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=585

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM +DPE+K+++P+ GRIEKWVLR AFDD + PYLP+HILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMDMDPEFKLIKPEEGRIEKWVLRKAFDDAENPYLPRHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YGWIDGIKDHAAKHVTDKMMLNASHIFPFNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKT-TTSSETSVQKLEVEK  191
            PSVACST +A+EWDASWS NLDPSGRAALG+H +AYE+  ++   T   E  + K+++  
Sbjct  519  PSVACSTEKAIEWDASWSNNLDPSGRAALGVHVSAYEEQVNSVIKTVEPEKIIPKMQISP  578

Query  190  ASVAV  176
              VA+
Sbjct  579  LGVAI  583



>sp|P31752.2|ASNS_ASPOF RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
Short=AS [Asparagus officinalis]
 emb|CAA48141.1| asparagine synthase (glutamine-hydrolysing) [Asparagus officinalis]
Length=590

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDPE KM++PDLGRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFMDVAMSIDPESKMIKPDLGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ +YP NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDRMMLNAARIYPHNTPTTKEAYYYRMIFERFFPQNSARFTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PS+ACSTA+A+EWDA WS NLDPSGRAALG+H +AY+
Sbjct  519  PSIACSTAKAIEWDARWSNNLDPSGRAALGVHDSAYD  555



>ref|XP_007146780.1| hypothetical protein PHAVU_006G069300g [Phaseolus vulgaris]
 gb|ESW18774.1| hypothetical protein PHAVU_006G069300g [Phaseolus vulgaris]
Length=579

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+IDPE+KM++ + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIEVAMNIDPEYKMIKKEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YGWIDGLKGHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>gb|AAO38524.1| asparagine synthetase [Securigera parviflora]
Length=586

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPENKMIKLDEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLKDHA   V+D M+ NAS +YP NTPTTKE YYYR IFE+F+P+N+AR +VPGG
Sbjct  459  YGWIDGLKDHAAKHVTDRMMLNASNIYPFNTPTTKEAYYYRMIFERFYPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT--TSSETSVQKLEVE  194
             SVACST +A+EWDA WSKNLDPSGRAALG+H +AYE+   +  +     E  + K+E+ 
Sbjct  519  ASVACSTEKALEWDAEWSKNLDPSGRAALGVHVSAYENQLSSSVSKGVEPEKIIPKMEIS  578

Query  193  KASVAV  176
               VA+
Sbjct  579  PLGVAI  584



>gb|KCW85423.1| hypothetical protein EUGRSUZ_B02239 [Eucalyptus grandis]
Length=674

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDP+WKM + + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  484  LDKEFINVAMSIDPKWKMAKREEGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  543

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V+D M+ NAS +YP NTPTTKEGYYYR IFE+FFP+N+AR +VPGG
Sbjct  544  YSWIDGLKEHAAQHVTDKMIENASHIYPHNTPTTKEGYYYRMIFERFFPQNSARLSVPGG  603

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA+A+EWD +WS NLDPSGRAALG+H +AY+
Sbjct  604  PSVACSTAKAIEWDDAWSNNLDPSGRAALGVHLSAYD  640



>ref|XP_003615711.1| Asparagine synthetase [Medicago truncatula]
 gb|AES98669.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=584

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 148/187 (79%), Gaps = 6/187 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GRIEK++LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPENKMIKKDEGRIEKYILRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDRMMLNAGNIYPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQK---LEV  197
            P+VACSTA+AVEWDASWSKNLDPSGRAALG+H +AYE   + KT  +     +K   LE 
Sbjct  519  PTVACSTAKAVEWDASWSKNLDPSGRAALGVHDSAYE---NQKTLVNKPVEFEKIIPLEA  575

Query  196  EKASVAV  176
                VA+
Sbjct  576  SPVEVAI  582



>gb|AEE81749.1| asparagine synthetase [Morus alba var. multicaulis]
Length=586

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI TAMSIDPE+K + P+ GRIEKWVLR AFDDE  PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKQFIQTAMSIDPEYKKINPEEGRIEKWVLRRAFDDEVHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA+ ++P NTPTTKE YYYRTIFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHADRHVTDKMMLNAANIFPHNTPTTKEAYYYRTIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDASWSKNLDPSGRAALGIHA AY+
Sbjct  519  ASVACSTAKAVEWDASWSKNLDPSGRAALGIHAPAYD  555



>dbj|BAM93579.1| asparagine synthase [Vigna unguiculata]
Length=579

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+IDPE+KM++ + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIKVAMNIDPEYKMIKKEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+H++AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHSSAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             V +
Sbjct  576  GVVI  579



>ref|NP_001235492.1| asparagine synthetase [Glycine max]
 gb|AAC09952.1| asparagine synthetase [Glycine max]
Length=579

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDPE+KM++ + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFIRVAMNIDPEYKMIKKEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>gb|KHN05227.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
 gb|KHN19843.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
Length=580

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDPE+KM++ + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKDFIRVAMNIDPEYKMIKKEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  460  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  520  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  576

Query  187  SVAV  176
             VA+
Sbjct  577  GVAI  580



>emb|CDY71298.1| BnaCnng72260D, partial [Brassica napus]
Length=555

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  369  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  428

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+F++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  429  YSWIDGLKAHAAENVNDKMMSNAAFIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  488

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  489  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  525



>gb|KDO66931.1| hypothetical protein CISIN_1g007799mg [Citrus sinensis]
Length=589

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+ P  GRIEKW+LR AFDDE+ PYLPKH+LYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMINPQEGRIEKWILRKAFDDEERPYLPKHVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA +++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDKMVQNAQYIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDA W+ NLDPSGRAALG+H +AYE
Sbjct  519  ASVACSTAKAVEWDAEWANNLDPSGRAALGVHLSAYE  555



>ref|XP_006425094.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
 gb|ESR38334.1| hypothetical protein CICLE_v10028078mg [Citrus clementina]
Length=589

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+ P  GRIEKW+LR AFDDE+ PYLPKH+LYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMINPQEGRIEKWILRKAFDDEERPYLPKHVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA +++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDKMVQNAQYIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDA W+ NLDPSGRAALG+H +AYE
Sbjct  519  ASVACSTAKAVEWDAEWANNLDPSGRAALGVHLSAYE  555



>emb|CDX99060.1| BnaA06g17510D [Brassica napus]
Length=585

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+F++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YSWIDGLKAHAAENVNDKMMSNAAFIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  520  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  556



>ref|XP_009149924.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Brassica 
rapa]
Length=585

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+F++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YSWIDGLKAHAAENVNDKMMSNAAFIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  520  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  556



>gb|KDP45791.1| hypothetical protein JCGZ_17398 [Jatropha curcas]
Length=589

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPEWKM++P+ GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMAIDPEWKMIKPEQGRIEKWVLRRAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMQNAGHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIH  272
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H
Sbjct  519  ASVACSTAKAVEWDATWSNNLDPSGRAALGVH  550



>emb|CAA96526.1| asparagine synthetase [Vicia faba]
Length=586

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKDFIKAAMDIDPEFKMIKHDEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YGWIDGIKDHAAKHVTDKMMFNASHIFPFNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT-TSSETSVQKLEVEK  191
            PSVACST +A+EWDASWS NLDPSGRAALG+H +AYE+  +  T     E  + K+ V  
Sbjct  520  PSVACSTEKAIEWDASWSGNLDPSGRAALGVHVSAYENQINPITKGVEPEKIIPKIGVSP  579

Query  190  ASVAV  176
              VA+
Sbjct  580  LGVAI  584



>gb|KJB35226.1| hypothetical protein B456_006G105400 [Gossypium raimondii]
Length=584

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEAKMIKNDEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK H    V+D M++NASF++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHTARHVTDKMMSNASFIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
             SVACSTA+AVEWD +W  NLDPSGRAALG+H +AY    DA+T  S++ S
Sbjct  519  ASVACSTAKAVEWDTAWKYNLDPSGRAALGVHLSAY----DAETPLSNKPS  565



>gb|AAB48058.1| asparagine synthetase [Medicago sativa]
Length=586

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM IDPE+KM++ + GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFIKVAMDIDPEYKMIKHEEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YGWIDGIKDHAAKHVTDRMMLNASHIFPFNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA-KTTTSSETSVQKLEVEK  191
             SVACST +A+EWDASWS NLDPSGRAA G+H +AYE+  ++   T   E  + K+E+  
Sbjct  520  ASVACSTEKAIEWDASWSSNLDPSGRAAFGVHNSAYENQVNSVAKTVEPEKIIPKMEISN  579

Query  190  ASVAV  176
              VA+
Sbjct  580  LGVAI  584



>ref|XP_009616367.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Nicotiana tomentosiformis]
Length=590

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWK+++P+  RIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKLIKPEQRRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NAS ++P NTP TKE YYYR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTNRMMLNASHIFPHNTPITKEAYYYRMIFERFFPQNSAGLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSV  212
             SVACSTA+AVEWDASWSKNLDPSGRAA+G+H +AYE+   A    +  T +
Sbjct  519  ASVACSTAKAVEWDASWSKNLDPSGRAAIGVHNSAYENHEPAMANGNLATKI  570



>ref|XP_006488550.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Citrus sinensis]
Length=589

 Score =   266 bits (681),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM+ P  GR+EKW+LR AFDDE+ PYLPKH+LYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMINPQEGRLEKWILRKAFDDEERPYLPKHVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA +++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTDKMMQNAQYIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDA W+ NLDPSGRAALG+H +AYE
Sbjct  519  ASVACSTAKAVEWDAEWANNLDPSGRAALGVHLSAYE  555



>ref|XP_006290806.1| hypothetical protein CARUB_v10016913mg [Capsella rubella]
 gb|EOA23704.1| hypothetical protein CARUB_v10016913mg [Capsella rubella]
Length=585

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPECKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQNVNDKMMSNAAHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AYE
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYE  555



>ref|XP_003519256.1| PREDICTED: asparagine synthetase, root [glutamine-hydrolyzing]-like 
[Glycine max]
Length=582

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FINTAMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKAFINTAMSIDPESKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMMLNAGNIYPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+  + K
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYENQNNNK  561



>ref|XP_002877554.1| hypothetical protein ARALYDRAFT_905953 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53813.1| hypothetical protein ARALYDRAFT_905953 [Arabidopsis lyrata subsp. 
lyrata]
Length=584

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINTAMSLDPECKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKDHAAQNVNDKMMSNAAHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  555



>ref|XP_010535370.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Tarenaya 
hassleriana]
Length=578

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMSIDP WKM++P+ GRIEKWVLR AF+D+  PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSIDPHWKMIKPEEGRIEKWVLRRAFEDDDRPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA+  V+D M+ NA+ ++P NTPT+KEGYYYR IFE+ FP+N+AR TVPGG
Sbjct  459  YSWIDGLKDHASQHVTDKMMVNAAHIFPHNTPTSKEGYYYRMIFERLFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACST +A EWD++WSKNLDPSGRAALG+H ++Y+
Sbjct  519  ASVACSTEKAAEWDSNWSKNLDPSGRAALGVHLSSYD  555



>gb|KFK32648.1| hypothetical protein AALP_AA6G270400 [Arabis alpina]
Length=584

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAENVNDRMMSNAAHIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAALG+H +AYE
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAALGVHLSAYE  555



>ref|XP_002299991.2| asparagine synthetase family protein [Populus trichocarpa]
 gb|EEE84796.2| asparagine synthetase family protein [Populus trichocarpa]
Length=578

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM++P  GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  390  LDKDFINVAMAIDPEWKMIKP--GRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  447

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V D M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  448  YSWIDGLKAHAELHVHDKMMQNAEHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  507

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDASWS NLDPSGRAALG+H +AYE
Sbjct  508  ASVACSTAKAVEWDASWSNNLDPSGRAALGVHLSAYE  544



>dbj|BAA96252.1| asparagine synthetase [Astragalus sinicus]
Length=586

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM IDPE KM++ D GRIEKWVLR AFDDE +PYLP+HILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMDIDPEEKMIKRDEGRIEKWVLRKAFDDENKPYLPRHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+  M+ NAS ++P+NTPT+KEGYYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YGWIDGIKDHAAKHVTAKMMLNASHIFPDNTPTSKEGYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKT--TTSSETSVQKLEVE  194
             S+ACST +A+EWDASWS NLDPSGRAALG+H +AYE+  ++        E  + K++V 
Sbjct  519  ASIACSTEKAIEWDASWSNNLDPSGRAALGVHVSAYENQVNSSVGKGVEPEKIIPKMKVS  578

Query  193  KASVAV  176
               VA+
Sbjct  579  PLGVAI  584



>gb|EPS60769.1| hypothetical protein M569_14030, partial [Genlisea aurea]
Length=481

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDPEWKM++P  GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  326  LDKEFVNVAMSIDPEWKMIKPSQGRIEKWILRRAFDDEERPYLPKHILYRQKEQFSDGVG  385

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  386  YSWIDGLKAHAAQHVTDKMMLNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARQTVPGG  445

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             SVACST  AV WD SWSKNLDPSGRAA+G+H + Y
Sbjct  446  ASVACSTETAVAWDESWSKNLDPSGRAAIGVHKSDY  481



>ref|XP_010685525.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Beta vulgaris subsp. vulgaris]
Length=588

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM++P+  R+EKW+LR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKMIKPEEKRMEKWILRKAFDDEKQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NA  ++  NTPTTKE YYYR IFEKFFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTNKMMHNAQHIFTYNTPTTKEAYYYRMIFEKFFPQNSATLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAP-DAKTT  233
            PSVACSTA+AVEWD +WS NLDPSGRAALG+H +AYE  P D+K T
Sbjct  519  PSVACSTAKAVEWDQAWSNNLDPSGRAALGVHNSAYERQPIDSKAT  564



>sp|P19251.3|ASNS1_PEA RecName: Full=Asparagine synthetase, nodule [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase 
[Pisum sativum]
 emb|CAA36429.1| unnamed protein product [Pisum sativum]
Length=586

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 145/185 (78%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKDFIKVAMDIDPEFKMIKHDEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YGWIDGIKDHAAKHVTDRMMFNASHIFPFNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT-TSSETSVQKLEVEK  191
            PSVACST +A+EWDASWS NLDPSGRAALG+H +AYE   +  T     E  + K+ V  
Sbjct  520  PSVACSTEKAIEWDASWSNNLDPSGRAALGVHVSAYEHQINPVTKGVEPEKIIPKIGVSP  579

Query  190  ASVAV  176
              VA+
Sbjct  580  LGVAI  584



>ref|XP_007016070.1| Glutamine-dependent asparagine synthase 1 [Theobroma cacao]
 gb|EOY33689.1| Glutamine-dependent asparagine synthase 1 [Theobroma cacao]
Length=584

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE K+++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMAIDPESKLIKKDQGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS+++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMLNASYIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSS  224
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY    DA+T  S+
Sbjct  519  ASVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY----DAETPLSN  562



>ref|XP_003538303.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2-like 
[Glycine max]
Length=579

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDP++KM++ + GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFIRVAMNIDPDYKMIKKEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>ref|XP_006602084.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X1 [Glycine max]
 ref|XP_006602085.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X2 [Glycine max]
 ref|XP_006602086.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 2 isoform 
X3 [Glycine max]
Length=579

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+IDPE KM++ + GRIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIRVAMNIDPECKMIKKEEGRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE Y+YR IFE+FFP+N+AR TVPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYHYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>ref|NP_190318.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
 sp|P49078.2|ASNS1_ARATH RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 1; 
AltName: Full=Glutamine-dependent asparagine synthetase 1; 
AltName: Full=Protein DARK INDUCIBLE 6 [Arabidopsis thaliana]
 gb|AAL31889.1|AF419557_1 AT3g47340/T21L8_90 [Arabidopsis thaliana]
 gb|AAA74359.1| glutamine-dependent asparagine synthetase [Arabidopsis thaliana]
 emb|CAB51206.1| glutamine-dependent asparagine synthetase [Arabidopsis thaliana]
 gb|AAL60035.1| putative glutamine-dependent asparagine synthetase [Arabidopsis 
thaliana]
 gb|AAM20242.1| putative glutamine-dependent asparagine synthetase [Arabidopsis 
thaliana]
 gb|AEE78264.1| asparagine synthetase [glutamine-hydrolyzing] [Arabidopsis thaliana]
Length=584

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+D M++NA  ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKDHAAQNVNDKMMSNAGHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  555



>gb|KHG11567.1| Asparagine synthetase [glutamine-hydrolyzing] 1 [Gossypium arboreum]
Length=558

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  372  LDKEFIKVAMSIDPESKMIKRDQGRIEKWILRKAFDDEERPYLPKHILYRQKEQFSDGVG  431

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS+++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  432  YSWIDGLKAHAAKHVTDKMILNASYIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  491

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE-DAPDAKTTTSSETSVQKLEVEK  191
             SVACSTA+AVEWD +W  NLDPSGRAALG+H +AY+ +AP      S         VE 
Sbjct  492  ASVACSTAKAVEWDVAWKNNLDPSGRAALGVHLSAYDAEAPLINNVPSKFIDSIPRMVEV  551

Query  190  ASVAV  176
              VA+
Sbjct  552  PGVAI  556



>gb|KHN02080.1| Asparagine synthetase [glutamine-hydrolyzing] 2 [Glycine soja]
Length=592

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 146/184 (79%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+IDPE KM++ + GRIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  412  LDKEFIRVAMNIDPECKMIKKEEGRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  471

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE Y+YR IFE+FFP+N+AR TVPGG
Sbjct  472  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYHYRMIFERFFPQNSARLTVPGG  531

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  532  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  588

Query  187  SVAV  176
             VA+
Sbjct  589  GVAI  592



>dbj|BAB17726.1| asparagine synthetase [Raphanus sativus]
Length=585

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA++++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YSWIDGLKAHAAENVNDKMMSNAAYIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  520  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  556



>dbj|BAO45866.1| asparagine synthetase [Acacia mangium]
Length=588

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 146/186 (78%), Gaps = 3/186 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AM+IDP++KM  P+ GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDVAMNIDPKYKMPNPEEGRIEKWVLRRAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGL+DHA   V+D M+ NA+ +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YGWIDGLRDHAAKYVTDKMMQNAANIYPHNTPCTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSS---ETSVQKLEV  197
             SVACST +A+EWDA+WS NLDPSGRAALG+H +AY+D       T +   E  + K+EV
Sbjct  519  ASVACSTEKAIEWDAAWSNNLDPSGRAALGVHLSAYDDKQVNSVPTEAAGPEKIIPKMEV  578

Query  196  EKASVA  179
                V 
Sbjct  579  NSLGVV  584



>gb|AAB81011.1| asparagine synthetase [Medicago sativa]
Length=586

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ + GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKDFIKVAMDIDPEYKMIKHEEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YGWIDGIKDHAAKHVTDRMMLNASHIFPFNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA-KTTTSSETSVQKLEVEK  191
             SVACST +A+EWDASWS NLDPSGRAA G+H +AYE+  ++   T   E  + K+E+  
Sbjct  520  ASVACSTEKAIEWDASWSSNLDPSGRAAFGVHNSAYENQVNSVAKTVEPEKIIPKMEISN  579

Query  190  ASVAV  176
              VA+
Sbjct  580  LGVAI  584



>gb|KEH34317.1| asparagine synthetase [glutamine-hydrolyzing] protein [Medicago 
truncatula]
Length=586

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ + GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKDFIKVAMDIDPEYKMIKHEEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDG+KDHA   V+D M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YGWIDGIKDHAAKHVTDRMMLNASHIFPFNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA-KTTTSSETSVQKLEVEK  191
             SVACST +A+EWDASWS NLDPSGRAA G+H +AYE+  ++   T   E  + K+E+  
Sbjct  520  ASVACSTEKAIEWDASWSSNLDPSGRAAFGVHNSAYENQVNSVAKTVEPEKIIPKMEISN  579

Query  190  ASVAV  176
              VA+
Sbjct  580  LGVAI  584



>emb|CDP09210.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   265 bits (678),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM++P  GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  416  LDKEFINVAMSIDPESKMIKPGEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  475

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTPTTKE YYYRTIFE+ FP+N+A  TVPGG
Sbjct  476  YSWIDGLKAHAELHVTDKMMLNAEHIFPHNTPTTKEAYYYRTIFERSFPQNSASLTVPGG  535

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+A+EWDASWSKNLDPSGRAA+G+H +AYED
Sbjct  536  ASVACSTAKAIEWDASWSKNLDPSGRAAVGVHNSAYED  573



>gb|KHN40086.1| Asparagine synthetase [glutamine-hydrolyzing] 1 [Glycine soja]
Length=582

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AMSIDPEWKM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKAFINAAMSIDPEWKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YSWIDGLKAHAAKHVTEKMMLNAGNIYPHNTPKTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  520  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYEN  557



>ref|XP_011003961.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Populus euphratica]
Length=589

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 146/189 (77%), Gaps = 5/189 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM++P  G IEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMIKPGQGHIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMQNAEHIFPHNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSS-----ETSVQKL  203
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AY+                +T  + L
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHLSAYDQQAALANAGVVPPKIIDTLPRML  578

Query  202  EVEKASVAV  176
            EV  + VA+
Sbjct  579  EVSASGVAI  587



>sp|P49093.2|ASNS2_LOTJA RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 2; 
AltName: Full=Glutamine-dependent asparagine synthetase 2 
[Lotus japonicus]
 emb|CAA61590.1| asparagine synthase (glutamine-hydrolysing) [Lotus japonicus]
Length=586

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 146/186 (78%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI+ AM IDPE KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKKFIDVAMGIDPENKMIKRDEGRIEKWVLRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLKDHA   V+D M+ NAS +YP NTP TKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YGWIDGLKDHAAKHVTDKMMLNASNIYPFNTPNTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTT--TSSETSVQKLEVE  194
             S+ACST +A+EWDA+WS NLDPSGRAALG+H +AY+D  +   +     E  + K+EV 
Sbjct  519  ASIACSTEKAIEWDAAWSNNLDPSGRAALGVHDSAYDDQLNKSVSKGVEPEKIIPKMEVS  578

Query  193  KASVAV  176
               VA+
Sbjct  579  PLGVAI  584



>sp|P49091.2|ASNS_BRAOL RecName: Full=Asparagine synthetase [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase [Brassica 
oleracea]
 emb|CAA59138.1| asparagine synthase (glutamine-hydrolysing) [Brassica oleracea]
Length=586

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++ A+F++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  460  YSWIDGLKAHAAENVNDKMMSKAAFIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  520  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  556



>ref|XP_006404395.1| hypothetical protein EUTSA_v10010235mg [Eutrema salsugineum]
 gb|ESQ45848.1| hypothetical protein EUTSA_v10010235mg [Eutrema salsugineum]
Length=584

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAENVNDKMMSNAAHIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDA  242
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+ +  A
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYDGSNKA  560



>ref|XP_010426174.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Camelina 
sativa]
Length=585

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPECKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAARNVNDKMMSNAAHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  555



>ref|XP_010515041.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Camelina sativa]
Length=584

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPECKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAARNVNDKMMSNAAHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  555



>gb|KJB08974.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=424

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  239  LDKQFINVAMSIDPESKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  298

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V++ M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  299  YSWIDGLKAHADQHVTNKMMRNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  358

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             +VACSTA+AVEWDA+W  NLDPSGRAALG+H +AY
Sbjct  359  ATVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY  394



>ref|XP_010690144.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010690145.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=588

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN  MSIDPEWKM++P+ GR+EKW+LR AFDDE++PYL KHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVVMSIDPEWKMIKPEEGRMEKWILRKAFDDEKQPYLLKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK H    V+D M+ NA  ++  NTPTTKE YYYR IF+KFFP+++A  TVPGG
Sbjct  459  YSWIDGLKAHVEQHVTDKMMYNAEHIFTHNTPTTKEAYYYRMIFDKFFPQSSAMLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAP-DAKTTTSSE  221
            PSVACSTA+AVEWD +WS+NLDPSGRAALGIH +AYE  P  AK T S++
Sbjct  519  PSVACSTAKAVEWDQAWSRNLDPSGRAALGIHDSAYERQPIGAKNTISTK  568



>ref|XP_009792170.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Nicotiana sylvestris]
Length=590

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWK+++P+  RIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEWKLIKPEQRRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NAS ++P NTP TKE YYYR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAEQHVTNRMMFNASHIFPHNTPITKEAYYYRMIFERFFPQNSAGLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWDASWSKNLDPSGRAA+G+H +AYE+
Sbjct  519  ASVACSTAKAVEWDASWSKNLDPSGRAAIGVHNSAYEN  556



>ref|XP_011024933.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform 
X1 [Populus euphratica]
 ref|XP_011024934.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 isoform 
X2 [Populus euphratica]
Length=587

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 137/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM++P  GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMIKP--GRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  456

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  457  YSWIDGLKAHAELHVNEKMMQNAEHIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  516

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDASWS NLDPSGRAALG+H +AY+
Sbjct  517  ASVACSTAKAVEWDASWSNNLDPSGRAALGVHLSAYD  553



>gb|AAC16325.1| asparagine synthetase [Elaeagnus umbellata]
Length=585

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE+K ++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPEYKKIKRDEGRIEKWVLRKAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTP TKEGYYYR IFE+F+P+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMIRNAAHIFPHNTPNTKEGYYYRMIFERFYPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWD SWSKNLDPSGRAALG+H +AY++
Sbjct  519  ASVACSTAKAVEWDESWSKNLDPSGRAALGVHLSAYDN  556



>gb|ABB04097.1| asparagine synthetase [Glycine max]
Length=579

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 147/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM+IDPE+KM++ + GRIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFIRVAMNIDPEYKMIKKEEGRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE Y+YR IFE+FFP+N+AR +VPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYHYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>ref|XP_007142192.1| hypothetical protein PHAVU_008G259900g [Phaseolus vulgaris]
 gb|ESW14186.1| hypothetical protein PHAVU_008G259900g [Phaseolus vulgaris]
Length=575

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GRIEKW+LR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  390  LDKEFINAAMNIDPEHKMIKRDEGRIEKWILRRAFDDEDQPYLPKHILYRQKEQFSDGVG  449

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  450  YSWIDGLKAHAAKHVTDKMMLNAGNIYPHNTPVTKEAYYYRMIFERFFPQNSARLTVPGG  509

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  510  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYEN  547



>gb|ABU95104.1| asparagine synthetase [Phaseolus vulgaris]
Length=584

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GRIEKW+LR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINAAMNIDPEHKMIKRDEGRIEKWILRRAFDDEDQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMMLNAGNIYPHNTPVTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYEN  556



>emb|CAA08913.1| asparagine synthetase type II [Phaseolus vulgaris]
Length=584

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GRIEKW+LR AFDDE +PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINAAMNIDPEHKMIKRDEGRIEKWILRRAFDDEDQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMMLNAGNIYPHNTPVTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYEN  556



>ref|XP_010503333.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Camelina 
sativa]
Length=585

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINTAMS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINTAMSLDPECKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAARNVNDKMMSNAAHIFPYNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDASWS N+DPSGRAA+G+H +AY+
Sbjct  519  ATVACSTAKAVEWDASWSNNMDPSGRAAIGVHLSAYD  555



>sp|P49092.2|ASNS1_LOTJA RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 1; 
AltName: Full=Glutamine-dependent asparagine synthetase 1 
[Lotus japonicus]
 emb|CAA61589.1| asparagine synthase (glutamine-hydrolysing) [Lotus japonicus]
Length=586

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE+KM++ D GRIEK++LR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPEYKMIKRDEGRIEKYILRRAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   V+D M+ NA  ++  NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKDHAAKHVTDKMILNAGNIFRHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            P+VACSTA+AVEWDA+WS NLDPSGRAALG+H +AY+D
Sbjct  519  PTVACSTAKAVEWDAAWSNNLDPSGRAALGVHLSAYDD  556



>gb|KJB83674.1| hypothetical protein B456_013G259500 [Gossypium raimondii]
 gb|KJB83675.1| hypothetical protein B456_013G259500 [Gossypium raimondii]
Length=583

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM+  D GRIEKWVLR AFDDE  PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMAIDPESKMINKDEGRIEKWVLRRAFDDENHPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  458  YSWIDGLKAHAAAHVADKMMLNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+AVEWDA+W  NLDPSGRAALG+H +AY+
Sbjct  518  ASVACSTAKAVEWDATWKNNLDPSGRAALGVHLSAYD  554



>emb|CAB57292.1| asparagine synthetase (type-I) [Phaseolus vulgaris]
Length=579

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 148/184 (80%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+++PE+KM++ + GRIEKWVLR AFDD + PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIEVAMNVNPEYKMIKKEEGRIEKWVLRRAFDDGEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+++AR +VPGG
Sbjct  459  YGWIDGLKGHAEKHVTDRMMLNAANIFPFNTPTTKEAYYYRMIFERFFPQDSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E ++ K+EV   
Sbjct  519  PSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKTIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>gb|KJB08975.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
 gb|KJB08977.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=469

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  284  LDKQFINVAMSIDPESKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  343

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V++ M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  344  YSWIDGLKAHADQHVTNKMMRNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  403

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             +VACSTA+AVEWDA+W  NLDPSGRAALG+H +AY
Sbjct  404  ATVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY  439



>gb|AAL91002.1| asparagine synthetase [Securigera parviflora]
Length=583

 Score =   262 bits (670),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDPE KM++ D GR+EK++LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFINVAMNIDPENKMIKRDEGRMEKYILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK+HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  458  YSWIDGLKEHAAKHVTDKMIFNAANIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AY++  +          +  +E    
Sbjct  518  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHLSAYDNQNNLANKPVEFEKIIPMEAPSL  577

Query  187  SVAV  176
             VA+
Sbjct  578  GVAI  581



>ref|XP_002313246.2| asparagine synthetase family protein [Populus trichocarpa]
 gb|EEE87201.2| asparagine synthetase family protein [Populus trichocarpa]
Length=589

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 145/189 (77%), Gaps = 5/189 (3%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPEWKM++P  G IEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEWKMIKPGQGHIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTPTTKE YYYR IFE+FFP+N+AR +VPGG
Sbjct  459  YSWIDGLKAHAAQHVTDKMMQNAEHIFPHNTPTTKEAYYYRMIFERFFPQNSARLSVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSS-----ETSVQKL  203
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H + Y+                +T  + L
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHLSDYDQQAALANAGVVPPKIIDTLPRML  578

Query  202  EVEKASVAV  176
            EV  + VA+
Sbjct  579  EVSASGVAI  587



>sp|P19252.3|ASNS2_PEA RecName: Full=Asparagine synthetase, root [glutamine-hydrolyzing]; 
AltName: Full=Glutamine-dependent asparagine synthetase 
[Pisum sativum]
 emb|CAA36430.1| unnamed protein product [Pisum sativum]
Length=583

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 1/184 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AM+IDPE KM++ D GRIEK++LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKAFINVAMNIDPENKMIKRDEGRIEKYILRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVTDKMMLNAGNIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            P+VACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+      T   E  +  LE    
Sbjct  519  PTVACSTAKAVEWDAAWSNNLDPSGRAALGVHDSAYENHNKVNKTVEFE-KIIPLEAAPV  577

Query  187  SVAV  176
             +A+
Sbjct  578  ELAI  581



>ref|XP_008221198.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Prunus 
mume]
Length=588

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 147/188 (78%), Gaps = 4/188 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPE+K+++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEFKLIKKDQGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  459  YSWIDGLKSHAALHVTDKMMLNAARIFPHNTPTTKEAYYYRMIFERFFPQNSARNTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED--APDAKTTTSSET--SVQKLE  200
            PSVACSTA AV WDA WSKNLDPSGRA   +H  AY+   AP   +    E   +V +++
Sbjct  519  PSVACSTATAVAWDAEWSKNLDPSGRAICEVHQQAYDKQAAPVTSSIVPPEIIDNVPQMK  578

Query  199  VEKASVAV  176
            V    VA+
Sbjct  579  VSTPGVAI  586



>gb|EYU45708.1| hypothetical protein MIMGU_mgv1a003412mg [Erythranthe guttata]
Length=586

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI+ AM+IDP+WKM++PD GR+EKW+LR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIDVAMNIDPDWKMIKPDQGRMEKWILRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTPTTKE Y+YR IFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHAELHVTDKMMRNAAHIFPHNTPTTKEAYHYRVIFERFFPQNSAMLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA AV WDASWSKNLDPSGRAA+G+H + YE
Sbjct  519  ASVACSTATAVAWDASWSKNLDPSGRAAVGVHNSGYE  555



>ref|XP_004490613.1| PREDICTED: asparagine synthetase, root [glutamine-hydrolyzing]-like 
[Cicer arietinum]
Length=585

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+IDP  KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMNIDPANKMIKRDEGRIEKWILRKAFDDEENPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAKHVSDKMMLNAGNIFPHNTPHTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
            P+VACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  519  PTVACSTAKAVEWDAAWSNNLDPSGRAALGVHDSAYEN  556



>ref|NP_001235738.1| asparagine synthetase 1 [Glycine max]
 gb|AAC49614.1| asparagine synthetase 1 [Glycine max]
Length=579

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 3/184 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AM+IDPE KM++ + GRIEKW LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFIRVAMNIDPECKMIKKEEGRIEKWALRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WIDGLK HA   V+D M+ NA+ ++P NTPTTKE Y+YR IFE+FFP+N+ R TVPGG
Sbjct  459  YGWIDGLKAHAEKHVTDRMMLNAANIFPFNTPTTKEAYHYRMIFERFFPQNSCRLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
             SVACSTA+AVEWDA+WS NLDPSGRAALG+HA+AY +   A      E  + K+EV   
Sbjct  519  TSVACSTAKAVEWDAAWSNNLDPSGRAALGVHASAYGNQVKA---VEPEKIIPKMEVSPL  575

Query  187  SVAV  176
             VA+
Sbjct  576  GVAI  579



>gb|KJB08981.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=584

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKQFINVAMSIDPESKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V++ M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHADQHVTNKMMRNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             +VACSTA+AVEWDA+W  NLDPSGRAALG+H +AY
Sbjct  519  ATVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY  554



>gb|KHG19876.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=561

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+N AMSIDP+ KM++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  398  LDKEFLNVAMSIDPKSKMIKKDEGRIEKWVLRKAFDDEECPYLPKHILYRQKEQFSDGVG  457

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD M+ NAS ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  458  YSWIDGLKAHAADRVSDKMMVNASCIFPHNTPKTKEAYYYRMIFERFFPQNSARLTVPGG  517

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             SVACSTA+AVEWD +W  NLDPSGRAALG+H +AY
Sbjct  518  ASVACSTAKAVEWDVAWKNNLDPSGRAALGVHLSAY  553



>ref|XP_007208013.1| hypothetical protein PRUPE_ppa003265mg [Prunus persica]
 gb|EMJ09212.1| hypothetical protein PRUPE_ppa003265mg [Prunus persica]
 gb|AHM02305.1| asparagine synthetase [Prunus persica]
Length=588

 Score =   260 bits (664),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 146/188 (78%), Gaps = 4/188 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM+IDPE+K+++ D GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMAIDPEFKLIKKDQGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA+ ++P NTP TKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  459  YSWIDGLKSHAALHVTDKMMLNAARIFPHNTPNTKEAYYYRMIFERFFPQNSARNTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED--APDAKTTTSSET--SVQKLE  200
            PSVACSTA AV WDA WSKNLDPSGRA   +H  AY+   AP   +    E   +V +++
Sbjct  519  PSVACSTATAVAWDAEWSKNLDPSGRAIFEVHQQAYDKQAAPVTSSIVPPEIIDNVPQMK  578

Query  199  VEKASVAV  176
            V    VA+
Sbjct  579  VSTPGVAI  586



>ref|XP_009338945.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] [Pyrus 
x bretschneideri]
Length=586

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM IDPE+KM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMDIDPEFKMIKKDQGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  459  YSWIDGLKAHAELHVTDKMMLNAERIFPHNTPHTKEAYYYRMIFERFFPQNSARNTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA AV WDA WSKNLDPSGRA L +H  AY D   A  T+     +  +   KA
Sbjct  519  PSVACSTATAVAWDAEWSKNLDPSGRAILEVHQQAY-DKQGAPVTSGIPEIIDNVPQMKA  577

Query  187  S  185
            S
Sbjct  578  S  578



>ref|XP_008384782.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1 [Malus 
domestica]
Length=586

 Score =   259 bits (662),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AM IDPE+KM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFINVAMDIDPEFKMIKKDQGRIEKWVLRKAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  459  YSWIDGLKAHAELHVTDKMMLNAERIFPHNTPYTKEAYYYRMIFERFFPQNSARNTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
            PSVACSTA AV WDA WSKNLDPSGRA L +H  AY D   A  T+     +  +   KA
Sbjct  519  PSVACSTATAVAWDAEWSKNLDPSGRAILEVHQQAY-DKQGAPVTSGIPEIIDNVPQMKA  577

Query  187  S  185
            S
Sbjct  578  S  578



>gb|KHG15500.1| Asparagine synthetase [glutamine-hydrolyzing] -like protein [Gossypium 
arboreum]
Length=580

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FIN AMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  395  LDKQFINVAMSIDPESKMIKKDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  454

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V++ M+ NAS ++P NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  455  YSWIDGLKAHADQHVTNKMMRNASNIFPHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  514

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             +VACSTA+AVEWD++W  NLDPSGRAALG+H +AY
Sbjct  515  ATVACSTAKAVEWDSAWKNNLDPSGRAALGVHLSAY  550



>gb|AAF74755.1| asparagine synthetase [Helianthus annuus]
Length=589

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM+  D  RIEKW+LR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMSIDPEAKMINMDQKRIEKWILRRAFDDEEKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V++ M+ NA  ++P NTP TKE YYYR IFE+FFP+N+A+ TVPGG
Sbjct  459  YSWIDGLKSHAEQHVTNKMMLNAERIFPHNTPVTKEAYYYRMIFERFFPQNSAKLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             SVACSTA+A+EWDASWS NLDPSGRAALG+H AAY+
Sbjct  519  ASVACSTAKAIEWDASWSNNLDPSGRAALGVHNAAYK  555



>gb|KHN46143.1| Asparagine synthetase, root [glutamine-hydrolyzing] [Glycine 
soja]
Length=582

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FINTAMSIDPE KM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKAFINTAMSIDPESKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  +YP NTPTTKE YYYR IFE+FFP+ A R TVPGG
Sbjct  460  YSWIDGLKAHAAKHVTDKMMLNAGNIYPHNTPTTKEAYYYRMIFERFFPQ-ATRLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+  + K
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYENQNNNK  561



>emb|CDY21785.1| BnaA06g20540D [Brassica napus]
Length=591

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINT MS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  405  LDKEFINTVMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  464

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  465  YSWIDGLKAHAAENVNDKMMSNAAHIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  524

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDA+WS N+DPSGRAA+G+H + Y+
Sbjct  525  ATVACSTAKAVEWDANWSNNMDPSGRAAIGVHLSDYD  561



>ref|XP_009150235.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Brassica rapa]
Length=608

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINT MS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  422  LDKEFINTVMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  481

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  482  YSWIDGLKAHAAENVNDKMMSNAAHIFPHNTPLTKEAYYYRMIFERFFPQNSARLTVPGG  541

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             +VACSTA+AVEWDA+WS N+DPSGRAA+G+H + Y+
Sbjct  542  ATVACSTAKAVEWDANWSNNMDPSGRAAVGVHLSDYD  578



>ref|XP_002526709.1| asparagine synthetase, putative [Ricinus communis]
 gb|EEF35671.1| asparagine synthetase, putative [Ricinus communis]
Length=591

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM+I PE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINVAMAIGPESKMIKPEEGRIEKWVLRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++  NTPTTKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDGLKAHAAEHVTDKMIQNAEHIFTHNTPTTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             S+ACSTA+AVEWDA+WS NLDPSGRAALG+H +AY
Sbjct  519  ASIACSTAKAVEWDAAWSDNLDPSGRAALGVHLSAY  554



>ref|NP_001235721.1| asparagine synthetase 2 [Glycine max]
 gb|AAC49613.1| asparagine synthetase 2 [Glycine max]
Length=581

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK FIN AMSIDPEWKM++ D GRIEKW+LR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKAFINAAMSIDPEWKMIKRDEGRIEKWILRRAFDDEEHPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWID LK H    V++ M+ NA  +YP NTP TKE YYYR IFE+FFP+N+AR TVPGG
Sbjct  459  YSWIDALKAHPPKHVTEKMMLNAGNIYPHNTPKTKEAYYYRMIFERFFPQNSARLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYED  254
             S ACSTA+AVEWDA+WS NLDPSGRAALG+H +AYE+
Sbjct  519  ASAACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYEN  556



>emb|CDX77846.1| BnaC03g53730D [Brassica napus]
Length=592

 Score =   258 bits (658),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFINT MS+DPE KM++P+ GRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  405  LDKEFINTVMSLDPESKMIKPEEGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVG  464

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFP-KNAARSTVPG  371
            YSWIDGLK HA   V+D M++NA+ ++P NTP TKE YYYR IFE+FFP +N+AR TVPG
Sbjct  465  YSWIDGLKAHAAENVNDKMMSNAAHIFPHNTPLTKEAYYYRMIFERFFPQQNSARLTVPG  524

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQ  209
            G +VACSTA+AVEWDA+WS N+DPSGRAA+G+H + Y+       ++ S  +V+
Sbjct  525  GATVACSTAKAVEWDANWSNNMDPSGRAAIGVHLSDYDGNSKVAVSSPSPKTVE  578



>ref|XP_001760709.1| predicted protein [Physcomitrella patens]
 gb|EDQ74448.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 136/171 (80%), Gaps = 0/171 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AM IDP  KM+R DLGRIEKWVLR AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  404  LDKEFMDVAMMIDPSEKMIRKDLGRIEKWVLRKAFDDEERPYLPKHILYRQKEQFSDGVG  463

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK++A   V+D M+ +A  VYP NTP TKEGYYYR IFEK FP+ +AR TVPGG
Sbjct  464  YSWIDGLKEYAESHVTDQMMKHAKHVYPFNTPNTKEGYYYRMIFEKHFPQQSARMTVPGG  523

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETS  215
            PSVACSTA AV WD +W+ NLDPSGRAALG H +AY D    K   ++E +
Sbjct  524  PSVACSTATAVAWDEAWANNLDPSGRAALGCHDSAYTDKHSEKAAPAAEAN  574



>ref|XP_009353891.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Pyrus x bretschneideri]
 ref|XP_009353897.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Pyrus x bretschneideri]
Length=586

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 142/186 (76%), Gaps = 2/186 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI  AM IDPE+KM++ D GRIEKWVLR AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKDFIKVAMDIDPEFKMIKKDQGRIEKWVLRKAFDDEEQPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ NA  ++P NTP TKE YYYR IFE+FFP+N+AR+TVPGG
Sbjct  459  YSWIDGLKSHAALHVTDKMMMNAERIFPHNTPCTKEAYYYRMIFERFFPQNSARNTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSET--SVQKLEVE  194
            PSVACSTA AV WDA WSKNLDPSGRA   +H  AY+      T+   E   +V +++  
Sbjct  519  PSVACSTATAVAWDAEWSKNLDPSGRAIFEVHQQAYDKQGVPVTSGIPEIIDNVPQMKAS  578

Query  193  KASVAV  176
               VA+
Sbjct  579  TVGVAI  584



>gb|AAF02775.1|AF190728_1 asparagine synthetase [Helianthus annuus]
Length=591

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPE KM+  D  RIEKWVLR AF+DE+ PYLPKHILYRQKEQFSDGVG
Sbjct  401  LDKEFINVAMSIDPEAKMINMDQKRIEKWVLRRAFEDEEHPYLPKHILYRQKEQFSDGVG  460

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D M+ +A  ++P NTP TKE YYYR IFE+ FP+N+A+ TVPGG
Sbjct  461  YSWIDGLKAHAELHVTDKMMLHAEHIFPHNTPVTKEAYYYRMIFERLFPQNSAKLTVPGG  520

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
             S+ACSTA+A+EWDASWS NLDPSGRAALG H AAY+
Sbjct  521  ASIACSTAKAIEWDASWSNNLDPSGRAALGAHNAAYK  557



>ref|XP_001783027.1| predicted protein [Physcomitrella patens]
 gb|EDQ52151.1| predicted protein [Physcomitrella patens]
Length=592

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LD++F+N AMSIDP  KM+    G+IEKW++R AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  401  LDRDFVNLAMSIDPAEKMINKKEGKIEKWIIRKAFDDEENPYLPKHILYRQKEQFSDGVG  460

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLKDHA   VSD MLANA  +YP NTP TKEGYYYR IFE+ FP+ +AR TVPGG
Sbjct  461  YSWIDGLKDHAASQVSDQMLANAKHIYPHNTPGTKEGYYYRMIFERCFPQESARLTVPGG  520

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYE  257
            PSVACSTA A+ WD +W+ NLDPSGRAA G+H +AYE
Sbjct  521  PSVACSTAAAIAWDKAWANNLDPSGRAATGVHDSAYE  557



>ref|XP_002967970.1| hypothetical protein SELMODRAFT_145135 [Selaginella moellendorffii]
 gb|EFJ31317.1| hypothetical protein SELMODRAFT_145135 [Selaginella moellendorffii]
Length=581

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDP  KM+RP   RIEKW++R AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  397  LDKEFVDIAMSIDPSEKMIRPG-ERIEKWIMRRAFDDEEKPYLPKHILYRQKEQFSDGVG  455

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y WID LK  A   VSD M+ANA FVYP NTP TKE YYYR +FE+ FP+ +AR +VPGG
Sbjct  456  YGWIDSLKAFATKQVSDRMMANAKFVYPHNTPQTKEAYYYRMLFERVFPQESARLSVPGG  515

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA-PDAKTTTSSETSVQKLEV  197
            PSVACSTA AV WD +WSKNLDPSGRAA G+HA AYE +    +T+T  E S ++L++
Sbjct  516  PSVACSTAAAVAWDEAWSKNLDPSGRAATGVHADAYESSEAHPQTSTVEEISKEQLQL  573



>gb|AGV54350.1| asparagine synthetase [Phaseolus vulgaris]
Length=584

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LD+EFI  AM+IDPE +M++ D GRIEKW+LR AFDDE +PYLPKHILY QKEQFSDGV 
Sbjct  399  LDREFIRGAMNIDPERRMIKRDEGRIEKWILRRAFDDEDQPYLPKHILYGQKEQFSDGVD  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGL+ HA   V+D M+ NA  +YP NTP TKE YYYR IFE+FFP+N+ R TVPGG
Sbjct  459  YSWIDGLEAHAAKHVTDKMMVNAGNIYPHNTPVTKEAYYYRMIFERFFPQNSGRLTVPGG  518

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKLEVEKA  188
             SVACSTA+AVEWDA+WS NLDPSGRAALG+H +AY    +          +  +E    
Sbjct  519  ASVACSTAKAVEWDAAWSNNLDPSGRAALGVHISAYGSQNNLANKGVEIEKIIPMEAAPL  578

Query  187  SVAV  176
             VA+
Sbjct  579  GVAI  582



>gb|KJB08976.1| hypothetical protein B456_001G117000 [Gossypium raimondii]
Length=608

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 24/180 (13%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMV------------------------RPDLGRIEKWVLRNAFD  620
            LDK+FIN AMSIDPE KMV                        + D GRIEKW+LR AFD
Sbjct  399  LDKQFINVAMSIDPESKMVSNQFIFVLELLGPLYMLLYFMNQIKRDEGRIEKWILRRAFD  458

Query  619  DEQEPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKE  440
            DE+ PYLPKHILYRQKEQFSDGVGYSWIDGLK HA+  V++ M+ NAS ++P NTPTTKE
Sbjct  459  DEEHPYLPKHILYRQKEQFSDGVGYSWIDGLKAHADQHVTNKMMRNASNIFPHNTPTTKE  518

Query  439  GYYYRTIFEKFFPKNAARSTVPGGPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY  260
             YYYR IFE+FFP+N+AR TVPGG +VACSTA+AVEWDA+W  NLDPSGRAALG+H +AY
Sbjct  519  AYYYRMIFERFFPQNSARLTVPGGATVACSTAKAVEWDAAWKNNLDPSGRAALGVHLSAY  578



>ref|XP_002450094.1| hypothetical protein SORBIDRAFT_05g000440 [Sorghum bicolor]
 gb|EES09082.1| hypothetical protein SORBIDRAFT_05g000440 [Sorghum bicolor]
Length=584

 Score =   246 bits (628),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -1

Query  673  VRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANGLVSDS  494
            VRPDLGRIEKWVLR AFDDE++P+LPKHILYRQKEQFSDGVGYSWIDGLK HA   V+D 
Sbjct  408  VRPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKEQFSDGVGYSWIDGLKAHAASNVTDK  467

Query  493  MLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGGPSVACSTARAVEWDASWS  314
            ML+NA F++P NTPTTKE YYYR IFE+FFP+  A  TVPGGPSVACSTA+A+EWDA WS
Sbjct  468  MLSNAKFIFPHNTPTTKEAYYYRMIFERFFPQKPAILTVPGGPSVACSTAKAIEWDAQWS  527

Query  313  KNLDPSGRAALGIHAAAYEDAPDAK  239
            +NLDPSGRAALG+H AAYE   D K
Sbjct  528  ENLDPSGRAALGVHLAAYEHEQDPK  552



>ref|XP_001784562.1| predicted protein [Physcomitrella patens]
 gb|EDQ50627.1| predicted protein [Physcomitrella patens]
Length=581

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 137/180 (76%), Gaps = 2/180 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF+  AM+IDP  K++R D GRIEKWVLR AF DE+ PYLPKHILYRQKEQFSDGVG
Sbjct  402  LDKEFMEVAMAIDPAEKLIRKDQGRIEKWVLRKAFYDEKNPYLPKHILYRQKEQFSDGVG  461

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   VSD ML +A  VYP NTP TKE YYYR +FEK FP+ +AR TVPGG
Sbjct  462  YSWIDGLKAHAQSHVSDQMLKHAKHVYPYNTPQTKEAYYYRMLFEKHFPQQSARLTVPGG  521

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAY-EDAPDAKTTTSSETSV-QKLEVE  194
             SVACSTA AV WD SW+ NLDPSGRAALG H AAY E++      T + ++V QK+ + 
Sbjct  522  ASVACSTATAVAWDKSWAGNLDPSGRAALGCHDAAYTENSAAMSYITKNMSNVGQKMTIH  581



>ref|XP_002963950.1| hypothetical protein SELMODRAFT_81509 [Selaginella moellendorffii]
 gb|EFJ34283.1| hypothetical protein SELMODRAFT_81509 [Selaginella moellendorffii]
Length=582

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 141/179 (79%), Gaps = 3/179 (2%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEF++ AMSIDP  KM+RP   RIEKW++R AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  397  LDKEFVDIAMSIDPSEKMIRPG-ERIEKWIMRRAFDDEEKPYLPKHILYRQKEQFSDGVG  455

Query  547  YSWIDGLKDHANGLVS-DSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPG  371
            Y WID LK  A   V+ D M+ANA FVYP NTP TKE YYYR +FE+ FP+ +AR +VPG
Sbjct  456  YGWIDSLKAFATKQVTVDRMMANAMFVYPHNTPQTKEAYYYRMLFERVFPQESARLSVPG  515

Query  370  GPSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDA-PDAKTTTSSETSVQKLEV  197
            GPSVACSTA AV WD +WSKNLDPSGRAA G+HA AYE +    +T+T  E S ++L++
Sbjct  516  GPSVACSTAAAVAWDEAWSKNLDPSGRAATGVHADAYESSEAHPQTSTVEEISKEQLKL  574



>ref|XP_008666000.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing]-like 
[Zea mays]
Length=409

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV PDLGRIEKWVLR AFDDE++P+LPKHILYRQK+QFSDGVG
Sbjct  270  LDKEFINAAMSIDPEWKMVWPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKDQFSDGVG  329

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDG K HA   V+D ML+NA F++P NTPTTKE YYYR +FE+FFP+  A  TVPGG
Sbjct  330  YSWIDGQKAHATSNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKYAILTVPGG  389

Query  367  PSVACSTARAVEWDA  323
            PSVACSTA+A+EWDA
Sbjct  390  PSVACSTAKAIEWDA  404



>gb|KGN47585.1| hypothetical protein Csa_6G362920 [Cucumis sativus]
Length=536

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDK+FI+ AM+IDPEWKM++ + GRIEKWVLR AFDDEQ+PYLPK++LYRQKEQFSDGVG
Sbjct  399  LDKKFIDVAMAIDPEWKMIKHNQGRIEKWVLRRAFDDEQQPYLPKNVLYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA+  V+D M+ NA  ++P+NTPT+KE YYYRTIFE+FFP+N+A  TVPGG
Sbjct  459  YSWIDGLKAHADQHVTDKMILNAEHIFPQNTPTSKEAYYYRTIFERFFPQNSACLTVPGG  518

Query  367  PSVACSTARAVEWDASWS  314
            PS+ACSTA+AVEWDA+WS
Sbjct  519  PSIACSTAKAVEWDAAWS  536



>ref|XP_010422871.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 3 isoform 
X2 [Camelina sativa]
Length=538

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 125/163 (77%), Gaps = 29/163 (18%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKWVLRNAFDDE+ PYLPK               
Sbjct  398  LDKEFINVAMSIDPEWKMIRPDLGRIEKWVLRNAFDDEKNPYLPK---------------  442

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
                          VSD+ML NASFV+P+NTP TKE YYYRTIFEKFFPK+AAR+TVPGG
Sbjct  443  --------------VSDTMLMNASFVFPDNTPMTKEAYYYRTIFEKFFPKSAARATVPGG  488

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAK  239
            PSVACSTA+AVEWDA+WS+NLDPSGRAALG+H AAYE+   A+
Sbjct  489  PSVACSTAKAVEWDAAWSQNLDPSGRAALGVHVAAYEEEDKAE  531



>tpg|DAA44867.1| TPA: hypothetical protein ZEAMMB73_793002 [Zea mays]
Length=742

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV PDLGRIEKWVLR AFDDE++P+LPKHILYRQK+QFSDGVG
Sbjct  603  LDKEFINAAMSIDPEWKMVWPDLGRIEKWVLRKAFDDEEQPFLPKHILYRQKDQFSDGVG  662

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDG K HA   V+D ML+NA F++P NTPTTKE YYYR +FE+FFP+  A  TVPGG
Sbjct  663  YSWIDGQKAHATSNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKYAILTVPGG  722

Query  367  PSVACSTARAVEWDA  323
            PSVACSTA+A+EWDA
Sbjct  723  PSVACSTAKAIEWDA  737



>tpg|DAA59148.1| TPA: hypothetical protein ZEAMMB73_422165 [Zea mays]
Length=615

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKMV  D    E     + F   Q   +  HILYRQKEQFSDGVG
Sbjct  425  LDKEFINAAMSIDPEWKMVLTDTTLAENGKRAHCFFFNQTKQIKAHILYRQKEQFSDGVG  484

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            YSWIDGLK HA   V+D ML+NA F++P NTPTTKE YYYR +FE+FFP+ +A  TVPGG
Sbjct  485  YSWIDGLKAHATSNVTDKMLSNAKFIFPHNTPTTKEAYYYRMVFERFFPQKSAILTVPGG  544

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPD  245
            PSVACSTA+A+EWDA WS NLDPSGRAALG+H AAYE   D
Sbjct  545  PSVACSTAKAIEWDAQWSGNLDPSGRAALGVHLAAYEHQHD  585



>gb|EEC75023.1| hypothetical protein OsI_11112 [Oryza sativa Indica Group]
Length=590

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMS+DPEWKM   DLGRIEKWV+R AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  386  LDKEFINVAMSMDPEWKMYNADLGRIEKWVMRKAFDDEEHPYLPKHILYRQKEQFSDGVG  445

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK      VSD M+ NA+ VYP NTP  KE YYYR IFE+ FP+ +AR TVP G
Sbjct  446  YNWIDGLKAFTEQQVSDEMMKNAAKVYPHNTPVNKEAYYYRMIFERLFPQESARETVPWG  505

Query  367  PSVACSTARAVEWDASWSKNLDPSGR  290
            PS+ACST  A+EW   W  + DPSGR
Sbjct  506  PSIACSTPAAIEWVEQWKASHDPSGR  531



>sp|Q10MX3.1|ASNS1_ORYSJ RecName: Full=Asparagine synthetase [glutamine-hydrolyzing] 1; 
AltName: Full=Glutamine-dependent asparagine synthetase 1 
[Oryza sativa Japonica Group]
 gb|ABF95401.1| Asparagine synthetase, putative, expressed [Oryza sativa Japonica 
Group]
Length=604

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMS+DPEWKM   DLGRIEKWV+R AFDDE+ PYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFINVAMSMDPEWKMYNADLGRIEKWVMRKAFDDEEHPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK      VSD M+ NA+ VYP NTP  KE YYYR IFE+ FP+ +AR TVP G
Sbjct  460  YNWIDGLKAFTEQQVSDEMMKNAAKVYPHNTPVNKEAYYYRMIFERLFPQESARETVPWG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGR  290
            PS+ACST  A+EW   W  + DPSGR
Sbjct  520  PSIACSTPAAIEWVEQWKASHDPSGR  545



>pir||S49846 asparagine synthase (glutamine-hydrolysing) (EC 6.3.5.4) - maize 
(fragment)
Length=189

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM +DPEWKM   +LGRIEKWV+R AFDD + PYLPKHILYRQKEQFSDGVG
Sbjct  2    LDKEFINVAMGMDPEWKMYDKNLGRIEKWVMRKAFDDYEHPYLPKHILYRQKEQFSDGVG  61

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK      V+D M+ N + ++P NTP+TKE YYYR IFE+ FP+++AR TVP G
Sbjct  62   YNWIDGLKSFTEQQVTDEMMNNVAQMFPYNTPSTKEAYYYRMIFERLFPQDSARETVPWG  121

Query  367  PSVACSTARAVEWDASWSKNLDPSGR  290
            PS+ACST  A+EW   W  + DPSGR
Sbjct  122  PSIACSTPAAIEWVEQWKASNDPSGR  147



>ref|XP_006651276.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Oryza brachyantha]
Length=648

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AM++DPEWKM  P+LGRIEKWV+R AFDDE++PYLPKHILYRQKEQFSDGVG
Sbjct  448  LDKEFINVAMNMDPEWKMYDPNLGRIEKWVMRKAFDDEEQPYLPKHILYRQKEQFSDGVG  507

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK      VSD M+ NA+ VYP NTP  KE YYYR IFE+ FP+ +AR TVP G
Sbjct  508  YNWIDGLKAFTEQQVSDEMMKNAAKVYPHNTPINKEAYYYRMIFERLFPQESARETVPWG  567

Query  367  PSVACSTARAVEWDASWSKNLDPSGR  290
            PS+ACST  A+EW   W  + DPSGR
Sbjct  568  PSIACSTPAAIEWVEQWKASHDPSGR  593



>ref|XP_003558155.1| PREDICTED: asparagine synthetase [glutamine-hydrolyzing] 1-like 
[Brachypodium distachyon]
Length=600

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFI  AMS+DPEWK+  PDLGR+EKWVLR AFD E+EPYLPKHILYRQKEQFSDGVG
Sbjct  400  LDKEFIEVAMSMDPEWKLYDPDLGRMEKWVLRKAFDVEEEPYLPKHILYRQKEQFSDGVG  459

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK      V+D M+ NA+  YP NTP  KE YYYR IFE+ +P+++AR TVP G
Sbjct  460  YNWIDGLKAFTEQQVTDEMMKNAAEEYPYNTPINKEAYYYRMIFERLYPQDSARETVPWG  519

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSETSVQKL  203
            PS+ACST  A+EW A W  + DPSGR  +  H  +    P A T     TS + +
Sbjct  520  PSIACSTPAAIEWVAQWKASNDPSGR-LIASHNDSSAAGPAAHTEDVGHTSCKGI  573



>ref|XP_002955283.1| hypothetical protein VOLCADRAFT_65699 [Volvox carteri f. nagariensis]
 gb|EFJ43583.1| hypothetical protein VOLCADRAFT_65699 [Volvox carteri f. nagariensis]
Length=578

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LD+ F++ AMSIDP  KM+    GRIEK++LR AFD  ++PYLPK +L+RQKEQFSDGVG
Sbjct  406  LDRAFLDVAMSIDPAEKMIDKSKGRIEKYILRKAFDTPEDPYLPKEVLWRQKEQFSDGVG  465

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPKNAARSTVPGG  368
            Y+WIDGLK HA   VSD ML NA   +P+NTP TKE Y+YR+IFE  FP+ AA  TVPGG
Sbjct  466  YNWIDGLKAHAESQVSDEMLKNAVHRFPDNTPRTKEAYWYRSIFESHFPQRAAMETVPGG  525

Query  367  PSVACSTARAVEWDASWSKNLDPSGRAALGIHAAAYEDAPDAKTTTSSE  221
            PSVACSTA A  WDA+W+   DPSGRA  G+H AAYE+  +A    +S+
Sbjct  526  PSVACSTATAALWDAAWAGKEDPSGRAVAGVHDAAYEEGAEANGEPASK  574



>gb|KJB48988.1| hypothetical protein B456_008G096300 [Gossypium raimondii]
Length=524

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -1

Query  727  LDKEFINTAMSIDPEWKMVRPDLGRIEKWVLRNAFDDEQEPYLPKHILYRQKEQFSDGVG  548
            LDKEFIN AMSIDPEWKM+RPDLGRIEKW+LRNAFD++++PYLPKHILYRQKEQFSDGVG
Sbjct  399  LDKEFINIAMSIDPEWKMIRPDLGRIEKWILRNAFDNDKKPYLPKHILYRQKEQFSDGVG  458

Query  547  YSWIDGLKDHANGLVSDSMLANASFVYPENTPTTKEGYYYRTIFEKFFPK  398
            YSWIDGLKDHAN  V+D+ML NA+F+YPENTPTTKEGYYYRTIFEKFFPK
Sbjct  459  YSWIDGLKDHANKQVTDAMLINANFIYPENTPTTKEGYYYRTIFEKFFPK  508



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455