BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF013B02

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771014.1|  PREDICTED: putative RNA polymerase II subuni...    200   1e-55   Nicotiana sylvestris
ref|XP_009629194.1|  PREDICTED: putative RNA polymerase II subuni...    198   4e-55   Nicotiana tomentosiformis
ref|XP_009629188.1|  PREDICTED: putative RNA polymerase II subuni...    199   4e-55   Nicotiana tomentosiformis
ref|XP_004230345.1|  PREDICTED: putative RNA polymerase II subuni...    198   6e-55   
ref|XP_006358558.1|  PREDICTED: putative RNA polymerase II subuni...    197   1e-54   Solanum tuberosum [potatoes]
ref|XP_009602820.1|  PREDICTED: putative RNA polymerase II subuni...    195   7e-54   Nicotiana tomentosiformis
ref|XP_011087531.1|  PREDICTED: putative RNA polymerase II subuni...    188   2e-51   Sesamum indicum [beniseed]
ref|XP_011087529.1|  PREDICTED: putative RNA polymerase II subuni...    188   3e-51   Sesamum indicum [beniseed]
ref|XP_011087530.1|  PREDICTED: putative RNA polymerase II subuni...    188   3e-51   Sesamum indicum [beniseed]
emb|CAN62034.1|  hypothetical protein VITISV_014731                     187   4e-51   Vitis vinifera
ref|XP_007016926.1|  F2P16.20 protein, putative isoform 1               182   3e-49   
ref|XP_002280625.1|  PREDICTED: putative RNA polymerase II subuni...    181   1e-48   Vitis vinifera
gb|EYU19406.1|  hypothetical protein MIMGU_mgv1a003240mg                179   4e-48   Erythranthe guttata [common monkey flower]
gb|KJB31664.1|  hypothetical protein B456_005G200700                    177   2e-47   Gossypium raimondii
ref|XP_006428243.1|  hypothetical protein CICLE_v10011677mg             174   3e-47   
gb|KHG00855.1|  hypothetical protein F383_23706                         176   4e-47   Gossypium arboreum [tree cotton]
emb|CDP15205.1|  unnamed protein product                                175   1e-46   Coffea canephora [robusta coffee]
ref|XP_006480289.1|  PREDICTED: putative RNA polymerase II subuni...    175   1e-46   Citrus sinensis [apfelsine]
gb|KHG00854.1|  hypothetical protein F383_23706                         171   4e-45   Gossypium arboreum [tree cotton]
ref|XP_010097327.1|  hypothetical protein L484_006008                   170   8e-45   Morus notabilis
ref|XP_008246291.1|  PREDICTED: putative RNA polymerase II subuni...    169   1e-44   Prunus mume [ume]
ref|XP_007208433.1|  hypothetical protein PRUPE_ppa002134mg             169   1e-44   Prunus persica
ref|XP_010271590.1|  PREDICTED: putative RNA polymerase II subuni...    168   2e-44   Nelumbo nucifera [Indian lotus]
ref|XP_004497627.1|  PREDICTED: putative RNA polymerase II subuni...    167   7e-44   Cicer arietinum [garbanzo]
ref|XP_011044665.1|  PREDICTED: putative RNA polymerase II subuni...    167   8e-44   Populus euphratica
ref|XP_011044667.1|  PREDICTED: putative RNA polymerase II subuni...    167   8e-44   Populus euphratica
ref|XP_009771016.1|  PREDICTED: putative RNA polymerase II subuni...    166   9e-44   Nicotiana sylvestris
ref|XP_007145767.1|  hypothetical protein PHAVU_007G265900g             167   1e-43   Phaseolus vulgaris [French bean]
ref|XP_009629199.1|  PREDICTED: putative RNA polymerase II subuni...    165   3e-43   Nicotiana tomentosiformis
gb|KDP37902.1|  hypothetical protein JCGZ_05341                         165   4e-43   Jatropha curcas
ref|XP_009602823.1|  PREDICTED: putative RNA polymerase II subuni...    163   1e-42   Nicotiana tomentosiformis
ref|XP_002321396.2|  hypothetical protein POPTR_0015s01330g             160   1e-41   
ref|XP_010921352.1|  PREDICTED: putative RNA polymerase II subuni...    159   3e-41   Elaeis guineensis
ref|XP_010042212.1|  PREDICTED: putative RNA polymerase II subuni...    159   5e-41   Eucalyptus grandis [rose gum]
ref|XP_003537129.1|  PREDICTED: putative RNA polymerase II subuni...    159   8e-41   Glycine max [soybeans]
ref|XP_004302308.1|  PREDICTED: putative RNA polymerase II subuni...    158   9e-41   Fragaria vesca subsp. vesca
ref|XP_002521936.1|  conserved hypothetical protein                     157   2e-40   Ricinus communis
ref|XP_003519102.1|  PREDICTED: putative RNA polymerase II subuni...    156   5e-40   Glycine max [soybeans]
gb|KHN23219.1|  Putative RNA polymerase II subunit B1 CTD phospha...    156   5e-40   Glycine soja [wild soybean]
ref|XP_006575272.1|  PREDICTED: putative RNA polymerase II subuni...    156   6e-40   Glycine max [soybeans]
gb|KEH41826.1|  RNA polymerase II subunit B1 CTD phosphatase RPAP...    155   1e-39   Medicago truncatula
ref|XP_009366054.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    154   3e-39   
ref|XP_008781193.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...    150   1e-37   Phoenix dactylifera
ref|XP_010551019.1|  PREDICTED: putative RNA polymerase II subuni...    145   4e-36   Tarenaya hassleriana [spider flower]
ref|XP_010674526.1|  PREDICTED: putative RNA polymerase II subuni...    143   4e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008388442.1|  PREDICTED: putative RNA polymerase II subuni...    142   6e-35   
ref|XP_009335520.1|  PREDICTED: putative RNA polymerase II subuni...    142   9e-35   Pyrus x bretschneideri [bai li]
gb|EPS64466.1|  hypothetical protein M569_10314                         140   9e-35   Genlisea aurea
ref|XP_008454119.1|  PREDICTED: putative RNA polymerase II subuni...    141   1e-34   Cucumis melo [Oriental melon]
ref|XP_007016928.1|  F2P16.20-like protein isoform 3                    139   6e-34   
ref|XP_004157008.1|  PREDICTED: putative RNA polymerase II subuni...    138   1e-33   
gb|KFK26439.1|  hypothetical protein AALP_AA8G248600                    139   2e-33   Arabis alpina [alpine rockcress]
ref|XP_004152151.1|  PREDICTED: putative RNA polymerase II subuni...    137   2e-33   Cucumis sativus [cucumbers]
ref|NP_198028.2|  uncharacterized protein                               134   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394906.1|  hypothetical protein EUTSA_v10003721mg             135   2e-32   Eutrema salsugineum [saltwater cress]
ref|NP_974839.1|  uncharacterized protein                               134   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17753.1|  unknown                                                 133   1e-31   Picea sitchensis
ref|XP_010921354.1|  PREDICTED: putative RNA polymerase II subuni...    131   2e-31   
ref|XP_010493937.1|  PREDICTED: putative RNA polymerase II subuni...    133   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010421540.1|  PREDICTED: putative RNA polymerase II subuni...    132   3e-31   Camelina sativa [gold-of-pleasure]
emb|CDY05542.1|  BnaA02g31490D                                          130   3e-30   
ref|XP_009129907.1|  PREDICTED: putative RNA polymerase II subuni...    129   5e-30   Brassica rapa
emb|CDY25002.1|  BnaC02g40060D                                          128   8e-30   Brassica napus [oilseed rape]
ref|XP_006290171.1|  hypothetical protein CARUB_v10003849mg             128   1e-29   
gb|AAB61054.1|  contains similarity to myosin heavy chain               127   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841578.1|  hypothetical protein AMTR_s00003p00194360          119   5e-27   Amborella trichopoda
ref|XP_009389521.1|  PREDICTED: putative RNA polymerase II subuni...    119   6e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO45358.1|  hypothetical protein CISIN_1g0087651mg                  117   1e-26   Citrus sinensis [apfelsine]
gb|KDO45359.1|  hypothetical protein CISIN_1g0087651mg                  116   1e-26   Citrus sinensis [apfelsine]
ref|XP_001782029.1|  predicted protein                                  116   1e-25   
ref|XP_003569080.1|  PREDICTED: putative RNA polymerase II subuni...    113   1e-24   Brachypodium distachyon [annual false brome]
sp|A2Y040.1|RPAP2_ORYSI  RecName: Full=Putative RNA polymerase II...    111   5e-24   Oryza sativa Indica Group [Indian rice]
sp|Q6AVZ9.1|RPAP2_ORYSJ  RecName: Full=Putative RNA polymerase II...    111   6e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010921353.1|  PREDICTED: putative RNA polymerase II subuni...    110   8e-24   
ref|NP_001137038.1|  uncharacterized protein LOC100217208               107   1e-23   
ref|XP_006654013.1|  PREDICTED: putative RNA polymerase II subuni...    108   3e-23   Oryza brachyantha
emb|CDX80586.1|  BnaC07g28580D                                          108   5e-23   
ref|XP_008654513.1|  PREDICTED: uncharacterized protein LOC100217...    107   9e-23   
ref|XP_002440538.1|  hypothetical protein SORBIDRAFT_09g002730          106   3e-22   Sorghum bicolor [broomcorn]
emb|CDX88239.1|  BnaA06g28300D                                          102   8e-22   
gb|EMT25025.1|  hypothetical protein F775_26015                         101   1e-20   
ref|XP_008345660.1|  PREDICTED: LOW QUALITY PROTEIN: putative RNA...  96.3    1e-19   
ref|XP_004960407.1|  PREDICTED: putative RNA polymerase II subuni...  98.2    2e-19   Setaria italica
gb|EMS49261.1|  hypothetical protein TRIUR3_22581                     95.9    6e-19   Triticum urartu
dbj|BAJ96888.1|  predicted protein                                    96.3    8e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002874325.1|  hypothetical protein ARALYDRAFT_326902           95.9    1e-18   
ref|XP_002990357.1|  hypothetical protein SELMODRAFT_447998           94.4    3e-18   Selaginella moellendorffii
ref|XP_002979385.1|  hypothetical protein SELMODRAFT_444189           94.0    3e-18   Selaginella moellendorffii
ref|XP_007016930.1|  F2P16.20-like protein isoform 5                  77.8    7e-13   
ref|XP_007016927.1|  F2P16.20-like protein isoform 2                  76.6    2e-12   
gb|KDO45356.1|  hypothetical protein CISIN_1g0087652mg                61.2    3e-09   Citrus sinensis [apfelsine]
gb|ACG46670.1|  hypothetical protein                                  56.2    3e-07   Zea mays [maize]
ref|XP_005844427.1|  hypothetical protein CHLNCDRAFT_139124           59.7    7e-07   Chlorella variabilis
gb|KIY99645.1|  hypothetical protein MNEG_8313                        51.6    3e-05   Monoraphidium neglectum



>ref|XP_009771014.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
 ref|XP_009771015.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana sylvestris]
Length=664

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLPVPIS LE+G+  LIDTMSFVDPLP+FRMKQWQLIVLLFLDALSICR
Sbjct  554  ARALPGLVADLRLPVPISVLEQGLVLLIDTMSFVDPLPAFRMKQWQLIVLLFLDALSICR  613

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP+LTPYMTGRR LLPKVLDGAQISA EYEI+KDLIIPLGRVP+F+MQSG 
Sbjct  614  IPVLTPYMTGRRTLLPKVLDGAQISAAEYEILKDLIIPLGRVPQFSMQSGG  664



>ref|XP_009629194.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629195.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629196.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009629197.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=664

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLPVPIS LE+G+  LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICR
Sbjct  554  ARALPELVADLRLPVPISVLEQGVVLLIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICR  613

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP+LTPYMTGRR LLPKVLDGAQISA EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  614  IPVLTPYMTGRRTLLPKVLDGAQISAVEYEIMKDLIIPLGRVPQFSMQSGG  664



>ref|XP_009629188.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629189.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629190.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629192.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629193.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=680

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLPVPIS LE+G+  LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICR
Sbjct  570  ARALPELVADLRLPVPISVLEQGVVLLIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICR  629

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP+LTPYMTGRR LLPKVLDGAQISA EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  630  IPVLTPYMTGRRTLLPKVLDGAQISAVEYEIMKDLIIPLGRVPQFSMQSGG  680



>ref|XP_004230345.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Solanum lycopersicum]
Length=660

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLPVPISTLE+GM  L++TMSFVDPLP+FRMKQWQLIVLLFLDALS+CR
Sbjct  550  ARALPGLVADLRLPVPISTLEQGMVLLLNTMSFVDPLPAFRMKQWQLIVLLFLDALSVCR  609

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPYMTGRR   PKVLDGAQISA EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  610  IPTLTPYMTGRRTSFPKVLDGAQISAAEYEIMKDLIIPLGRVPQFSMQSGG  660



>ref|XP_006358558.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Solanum tuberosum]
Length=662

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLPVPISTLE+GM  L++TMSFVDPLP+FRMKQWQLIVLLFLDALS+CR
Sbjct  552  ARALPGLVADLRLPVPISTLEQGMVLLLNTMSFVDPLPAFRMKQWQLIVLLFLDALSVCR  611

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPYMTGRR  LPKVLDGAQIS  EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  612  IPTLTPYMTGRRTSLPKVLDGAQISTAEYEIMKDLIIPLGRVPQFSMQSGG  662



>ref|XP_009602820.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602821.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Nicotiana tomentosiformis]
Length=664

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LV DLRLPVPIS LE+G+  LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICR
Sbjct  554  ARALPGLVTDLRLPVPISVLEQGVVLLIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICR  613

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP+LTPYMTGRR LLPKVLDGA ISA EYEIMKDL+IPLGRVP+F+MQSG 
Sbjct  614  IPVLTPYMTGRRTLLPKVLDGAHISAAEYEIMKDLVIPLGRVPQFSMQSGG  664



>ref|XP_011087531.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
 ref|XP_011087533.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Sesamum indicum]
Length=655

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA+LRLP+P+ST+E+GM  L+DTMSF+DPLP+FRMKQWQ+IVLLFLDALS+ R
Sbjct  545  ARALPGLVAELRLPIPMSTIEQGMGRLLDTMSFIDPLPAFRMKQWQVIVLLFLDALSVSR  604

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPY+ GRRILLPKVL+GAQISAEE+EIMKDLIIPLGRVP+F+ QSG 
Sbjct  605  IPALTPYLMGRRILLPKVLEGAQISAEEFEIMKDLIIPLGRVPQFSTQSGG  655



>ref|XP_011087529.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Sesamum indicum]
Length=699

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA+LRLP+P+ST+E+GM  L+DTMSF+DPLP+FRMKQWQ+IVLLFLDALS+ R
Sbjct  589  ARALPGLVAELRLPIPMSTIEQGMGRLLDTMSFIDPLPAFRMKQWQVIVLLFLDALSVSR  648

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPY+ GRRILLPKVL+GAQISAEE+EIMKDLIIPLGRVP+F+ QSG 
Sbjct  649  IPALTPYLMGRRILLPKVLEGAQISAEEFEIMKDLIIPLGRVPQFSTQSGG  699



>ref|XP_011087530.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Sesamum indicum]
Length=687

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA+LRLP+P+ST+E+GM  L+DTMSF+DPLP+FRMKQWQ+IVLLFLDALS+ R
Sbjct  577  ARALPGLVAELRLPIPMSTIEQGMGRLLDTMSFIDPLPAFRMKQWQVIVLLFLDALSVSR  636

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPY+ GRRILLPKVL+GAQISAEE+EIMKDLIIPLGRVP+F+ QSG 
Sbjct  637  IPALTPYLMGRRILLPKVLEGAQISAEEFEIMKDLIIPLGRVPQFSTQSGG  687



>emb|CAN62034.1| hypothetical protein VITISV_014731 [Vitis vinifera]
Length=659

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP LVADLRLP+P+S LE+G+  L+DTMSFVD LPSFRMKQWQ+IVLLF+DALS+CR
Sbjct  549  SRALPGLVADLRLPIPVSNLEQGVGRLLDTMSFVDALPSFRMKQWQVIVLLFIDALSVCR  608

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT RR+L PKV D AQ+SAEEYE+MKDLIIPLGRVP+F+ QSG 
Sbjct  609  IPALTPHMTSRRMLFPKVFDAAQVSAEEYEVMKDLIIPLGRVPQFSAQSGG  659



>ref|XP_007016926.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34545.1| F2P16.20 protein, putative isoform 1 [Theobroma cacao]
Length=739

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V DLRLP+PISTLE+GM  LIDT+SF++ LP+FRMKQWQ+IVLLF+DALS+CR
Sbjct  629  SRALPAIVTDLRLPIPISTLEQGMGHLIDTISFMEALPAFRMKQWQVIVLLFIDALSVCR  688

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT  R+LL KVLDGAQIS EEYE+MKDLIIPLGR P F+ QSGA
Sbjct  689  IPALTPHMTNGRMLLHKVLDGAQISMEEYEVMKDLIIPLGRAPHFSAQSGA  739



>ref|XP_002280625.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659731.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 ref|XP_010659732.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Vitis vinifera]
 emb|CBI39649.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRLP+P+S LE+G+  L+DTMSFVD LPSFRMKQWQ+IVLLF+DALS+C+
Sbjct  549  ARALPGLVADLRLPIPVSNLEQGVGRLLDTMSFVDALPSFRMKQWQVIVLLFIDALSVCQ  608

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+M  +R+L PKV D AQ+SAEEYE+MKDLIIPLGRVP+F+ QSG 
Sbjct  609  IPALTPHMISKRMLFPKVFDAAQVSAEEYEVMKDLIIPLGRVPQFSAQSGG  659



>gb|EYU19406.1| hypothetical protein MIMGU_mgv1a003240mg [Erythranthe guttata]
Length=597

 Score =   179 bits (453),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LV+++R+P P+ST+E+GM  L+DTMSF D LP FRMKQWQ+I LLFLDALS+ R
Sbjct  487  ARALPGLVSEIRIPTPVSTIEQGMGRLLDTMSFTDALPGFRMKQWQVIALLFLDALSVSR  546

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L+PYMTGRRILLPKVL+GAQI+ EE+EIMKDLIIPLGRVP+F+ QSG 
Sbjct  547  IPALSPYMTGRRILLPKVLEGAQINVEEFEIMKDLIIPLGRVPQFSTQSGG  597



>gb|KJB31664.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31665.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31666.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31667.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
 gb|KJB31668.1| hypothetical protein B456_005G200700 [Gossypium raimondii]
Length=708

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRA P +V  LRLP+PISTLE+GM  L+DTMSFV+ LP+FRMKQWQ+IVLL +DALS+CR
Sbjct  598  SRAFPAIVTALRLPIPISTLEQGMGRLLDTMSFVEALPAFRMKQWQVIVLLLIDALSVCR  657

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT  R+LL KVLDGAQIS EEYE+MKDLIIPLGR P F+ QSGA
Sbjct  658  IPALTPHMTNGRMLLHKVLDGAQISMEEYEVMKDLIIPLGRAPHFSAQSGA  708



>ref|XP_006428243.1| hypothetical protein CICLE_v10011677mg [Citrus clementina]
 gb|ESR41483.1| hypothetical protein CICLE_v10011677mg [Citrus clementina]
Length=460

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R  P LVADLRL +P+STLEKG+  L++TMSF+DPLP+F++KQWQ+I +LFLDALS+CR
Sbjct  350  ARTFPALVADLRLRIPVSTLEKGLEGLLNTMSFIDPLPAFKVKQWQVITVLFLDALSVCR  409

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT R +LL KVLDGAQISAEEYE+MKD ++PLGR P+F+ QSGA
Sbjct  410  IPALTPHMTNRTMLLRKVLDGAQISAEEYEVMKDFLMPLGRAPQFSSQSGA  460



>gb|KHG00855.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=708

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V  LRLP+PISTLE+GM  L+DTMSFV+ LP+FRMKQWQ++VLL +DALS+CR
Sbjct  598  SRALPAIVTALRLPIPISTLEQGMGRLLDTMSFVEALPAFRMKQWQVLVLLLIDALSVCR  657

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT  R+LL KVLDGAQIS EEYE+MKDLIIPLGR P F+ QSGA
Sbjct  658  IPALTPHMTNGRMLLHKVLDGAQISLEEYEVMKDLIIPLGRAPHFSAQSGA  708



>emb|CDP15205.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADL+LP+P+STLEK M  L+DTMSF+DPLP FRMKQWQL+VLL LDALS+CR
Sbjct  652  ARALPALVADLQLPMPLSTLEKEMDHLLDTMSFMDPLPPFRMKQWQLLVLLLLDALSVCR  711

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTPYMTGRRILLPKVL GAQISAEEYEIMKDLIIPLGRVP+F MQ GA
Sbjct  712  IPALTPYMTGRRILLPKVLQGAQISAEEYEIMKDLIIPLGRVPQFAMQCGA  762



>ref|XP_006480289.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Citrus sinensis]
Length=768

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R  P LVADLRL +P+STLEKG+  L++TMSF+DPLP+F++KQWQ+I +LFLDALS+CR
Sbjct  658  ARTFPALVADLRLRIPVSTLEKGLEGLLNTMSFIDPLPAFKVKQWQVITVLFLDALSVCR  717

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT R +LL KVLDGAQISAEEYE+MKD ++PLGR P+F+ QSGA
Sbjct  718  IPALTPHMTNRTMLLRKVLDGAQISAEEYEVMKDFLMPLGRAPQFSSQSGA  768



>gb|KHG00854.1| hypothetical protein F383_23706 [Gossypium arboreum]
Length=729

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V  LRLP+PISTLE+GM  L+DTMSFV+ LP+FRMKQWQ++VLL +DALS+CR
Sbjct  587  SRALPAIVTALRLPIPISTLEQGMGRLLDTMSFVEALPAFRMKQWQVLVLLLIDALSVCR  646

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQ  445
            IP LTP+MT  R+LL KVLDGAQIS EEYE+MKDLIIPLGR P F+ Q
Sbjct  647  IPALTPHMTNGRMLLHKVLDGAQISLEEYEVMKDLIIPLGRAPHFSAQ  694



>ref|XP_010097327.1| hypothetical protein L484_006008 [Morus notabilis]
 gb|EXB67559.1| hypothetical protein L484_006008 [Morus notabilis]
Length=695

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVADLRL  PIS+LE+GM  L+DTMSFVD LP FRMKQWQ+I+LLFL+ALS+ R
Sbjct  585  ARALPGLVADLRLSTPISSLEQGMGRLLDTMSFVDALPPFRMKQWQVIILLFLEALSVYR  644

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P LTP+M  RR+L  KVLD AQISAEEYE+MKDL+IPLGR P F+ QSGA
Sbjct  645  LPALTPHMMYRRVLFHKVLDSAQISAEEYEVMKDLVIPLGRTPHFSAQSGA  695



>ref|XP_008246291.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Prunus mume]
Length=711

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V++LRLP PIS+LE+GM  +++TMSF+D +P+FRMKQWQ+IVLLFL+ LS+CR
Sbjct  601  ARALPGVVSELRLPTPISSLEQGMGRMLNTMSFIDAIPAFRMKQWQVIVLLFLEGLSVCR  660

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT RR+L  KVL+  QISAE+YE+MKDLIIPLGR P+F+ QSGA
Sbjct  661  IPALTPHMTNRRMLFYKVLENTQISAEQYELMKDLIIPLGRAPQFSAQSGA  711



>ref|XP_007208433.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
 gb|EMJ09632.1| hypothetical protein PRUPE_ppa002134mg [Prunus persica]
Length=711

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V++LRLP PIS+LE+GM  +++TMSF+D +P+FRMKQWQ+IVLLFL+ LS+CR
Sbjct  601  ARALPGVVSELRLPTPISSLEQGMGRMLNTMSFIDAIPAFRMKQWQVIVLLFLEGLSVCR  660

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LTP+MT RR+L  KVL+  QISAE+YE+MKDLIIPLGR P+F+ QSGA
Sbjct  661  IPALTPHMTNRRMLFYKVLENTQISAEQYELMKDLIIPLGRAPQFSAQSGA  711



>ref|XP_010271590.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
 ref|XP_010271591.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Nelumbo nucifera]
Length=650

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP LVAD+ LP PISTLE+GM  L+DTM+FV+ LPS RMKQW +IV LF+DALS+CR
Sbjct  540  SRALPGLVADVNLPTPISTLEQGMGCLLDTMTFVEALPSLRMKQWHVIVFLFVDALSVCR  599

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L P +T RR+LL KVLDGAQIS EEYE+MKD I+PLGR+P+F+ QSG 
Sbjct  600  MPALNPLVTSRRMLLQKVLDGAQISGEEYELMKDHILPLGRLPQFSTQSGG  650



>ref|XP_004497627.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cicer arietinum]
Length=666

 Score =   167 bits (422),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +VA+L+LP+P+STLE+GM  L+DTMSFVDPLP FR KQWQ++ LLF+DALS+CR
Sbjct  556  ARALPAVVAELKLPMPVSTLEQGMVCLLDTMSFVDPLPGFRFKQWQVVALLFVDALSVCR  615

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L  YMT RR L  KVL G+QI  EEY ++KDLI+PLGR P F+ QSGA
Sbjct  616  IPALISYMTDRRDLFHKVLSGSQIGMEEYNVLKDLIVPLGRAPHFSSQSGA  666



>ref|XP_011044665.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
 ref|XP_011044666.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Populus euphratica]
Length=733

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RA PV+VADLRLP+PISTLE+G A+L+ TMSF+D +P+FRMKQWQ+I LLF++ALS+CRI
Sbjct  624  RAFPVVVADLRLPIPISTLEQGAANLLGTMSFLDAVPAFRMKQWQVIALLFIEALSVCRI  683

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            P L  YM  RR+++ KV+DG ++SAEEYE+MKDL+IPLGR P+F+ QSGA
Sbjct  684  PALISYMDNRRMVIQKVVDGVRMSAEEYEVMKDLMIPLGRAPQFSPQSGA  733



>ref|XP_011044667.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Populus euphratica]
Length=722

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RA PV+VADLRLP+PISTLE+G A+L+ TMSF+D +P+FRMKQWQ+I LLF++ALS+CRI
Sbjct  613  RAFPVVVADLRLPIPISTLEQGAANLLGTMSFLDAVPAFRMKQWQVIALLFIEALSVCRI  672

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            P L  YM  RR+++ KV+DG ++SAEEYE+MKDL+IPLGR P+F+ QSGA
Sbjct  673  PALISYMDNRRMVIQKVVDGVRMSAEEYEVMKDLMIPLGRAPQFSPQSGA  722



>ref|XP_009771016.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana sylvestris]
Length=576

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  690  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  511
            LIDTMSFVDPLP+FRMKQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA
Sbjct  492  LIDTMSFVDPLPAFRMKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISA  551

Query  510  EEYEIMKDLIIPLGRVPEFTMQSGA  436
             EYEI+KDLIIPLGRVP+F+MQSG 
Sbjct  552  AEYEILKDLIIPLGRVPQFSMQSGG  576



>ref|XP_007145767.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
 gb|ESW17761.1| hypothetical protein PHAVU_007G265900g [Phaseolus vulgaris]
Length=706

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA P LVA LRLP+PISTLE+GMA L++TMSFVD LP+FR KQWQ++ LLF+DALS+CR
Sbjct  596  ARAFPALVAGLRLPIPISTLEQGMACLLETMSFVDALPAFRTKQWQVVALLFVDALSVCR  655

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L  YMT RR L  KVL G+QI  EEYEI+KDL++PLGR P  ++QSGA
Sbjct  656  IPSLISYMTDRRALFHKVLSGSQIGMEEYEILKDLVVPLGRAPHISVQSGA  706



>ref|XP_009629199.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X4 [Nicotiana tomentosiformis]
Length=592

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/85 (91%), Positives = 82/85 (96%), Gaps = 0/85 (0%)
 Frame = -1

Query  690  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  511
            LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGAQISA
Sbjct  508  LIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAQISA  567

Query  510  EEYEIMKDLIIPLGRVPEFTMQSGA  436
             EYEIMKDLIIPLGRVP+F+MQSG 
Sbjct  568  VEYEIMKDLIIPLGRVPQFSMQSGG  592



>gb|KDP37902.1| hypothetical protein JCGZ_05341 [Jatropha curcas]
Length=654

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRA P +VADLRLP+PISTLE+G   L+DTMSFVD LP FRMKQWQ+   LF++ALS+CR
Sbjct  546  SRAFPGVVADLRLPIPISTLEQGAGRLLDTMSFVDALPPFRMKQWQVTAFLFIEALSVCR  605

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LT YMT RR++L +VLDGAQISAEEYE+MKDL+IPLGR P    +SGA
Sbjct  606  IPALTSYMTNRRMVLHQVLDGAQISAEEYEVMKDLMIPLGRDPR--ARSGA  654



>ref|XP_009602823.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Nicotiana tomentosiformis]
Length=576

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = -1

Query  690  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  511
            LIDTMSFVDPLP+FR+KQWQLIVLLFLDALSICRIP+LTPYMTGRR LLPKVLDGA ISA
Sbjct  492  LIDTMSFVDPLPAFRIKQWQLIVLLFLDALSICRIPVLTPYMTGRRTLLPKVLDGAHISA  551

Query  510  EEYEIMKDLIIPLGRVPEFTMQSGA  436
             EYEIMKDL+IPLGRVP+F+MQSG 
Sbjct  552  AEYEIMKDLVIPLGRVPQFSMQSGG  576



>ref|XP_002321396.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
 gb|EEF05523.2| hypothetical protein POPTR_0015s01330g [Populus trichocarpa]
Length=696

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 4/110 (4%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RA PV+VADLRLP+PISTLE+G A+L+ TMSFVD +P+FRMKQWQ+I LLF++ALS+CRI
Sbjct  591  RAFPVVVADLRLPIPISTLEQGAANLLGTMSFVDAVPAFRMKQWQVIALLFIEALSVCRI  650

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            P L  YM  RR+    V+DG ++SAEEYE+MKDL+IPLGR P+F+ QSGA
Sbjct  651  PALISYMDNRRM----VVDGVRMSAEEYEVMKDLMIPLGRAPQFSPQSGA  696



>ref|XP_010921352.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Elaeis guineensis]
Length=681

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RALP +V DL+LP P+STLEK +  L+DTMSFVD LPSFR++QWQ+IVLLFLDALS+ R+
Sbjct  572  RALPSIVMDLKLPTPVSTLEKFVGRLLDTMSFVDALPSFRIRQWQVIVLLFLDALSVHRL  631

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            P L P+MT R +LL KVL+ AQ+SAEEYE M+DLIIPLGR PE +MQSG 
Sbjct  632  PPLAPHMTNRNMLLHKVLNPAQVSAEEYESMRDLIIPLGRFPELSMQSGG  681



>ref|XP_010042212.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Eucalyptus grandis]
 gb|KCW84978.1| hypothetical protein EUGRSUZ_B01798 [Eucalyptus grandis]
Length=672

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP L++DLRLP+P+STLE+G+  L+DTM+F+D LP+ R KQWQ+IVLLF+DALS+CR
Sbjct  562  SRALPGLISDLRLPLPVSTLEQGLGRLLDTMTFMDALPALRTKQWQVIVLLFIDALSVCR  621

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P+LT +M+ R   L KVL  A++S EEYEIMKDL+IPLGR P+F+ QSGA
Sbjct  622  VPVLTAHMSNRHPSLQKVLQAARMSVEEYEIMKDLLIPLGRAPQFSAQSGA  672



>ref|XP_003537129.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Glycine max]
 gb|KHN37760.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA LRLP+P+ST+E+GMA L++TMSFVD LP+FR KQWQ++ LLF+DALS+CR
Sbjct  596  ARALPTLVAVLRLPIPVSTMEQGMACLLETMSFVDALPAFRTKQWQVVALLFIDALSVCR  655

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  YMT RR    +VL G+QI  EEYE++KDL +PLGR P  + QSGA
Sbjct  656  LPALISYMTDRRASFHRVLSGSQIGMEEYEVLKDLAVPLGRAPHISAQSGA  706



>ref|XP_004302308.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Fragaria vesca subsp. vesca]
Length=692

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +VA+L L VP   LEKGM  +++TMSF++ LP+FRMKQWQ+I LLF++ LS+CR
Sbjct  584  SRALPEIVAELGLAVP--NLEKGMGFMLNTMSFIEALPAFRMKQWQVIALLFIEGLSVCR  641

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P LTP+MT RR+L+ +VLDGA+IS EEYEIMKD +IPLGR P+F  QSGA
Sbjct  642  MPALTPHMTNRRVLIQRVLDGARISVEEYEIMKDFLIPLGRAPQFASQSGA  692



>ref|XP_002521936.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40460.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 92/111 (83%), Gaps = 2/111 (2%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R  P LVA+LRLP+P+STLE+G   L++TMSFVD LP+FR KQWQ+I LLF++ALS+CR
Sbjct  537  ARTFPGLVANLRLPIPVSTLEQGAGRLLETMSFVDALPAFRTKQWQVIALLFIEALSVCR  596

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP LT YMT RR++L +VLDGA ISAEEY+IMKD ++PLGR P+   +SGA
Sbjct  597  IPALTSYMTSRRMVLHQVLDGAHISAEEYDIMKDFMVPLGRDPQ--ARSGA  645



>ref|XP_003519102.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X1 [Glycine max]
Length=706

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA LRLP+P+S +E+GMA L++TMSFVD LP+FR KQWQ++ LLF+DALS+CR
Sbjct  596  ARALPALVAVLRLPIPVSIMEQGMACLLETMSFVDALPAFRTKQWQVVALLFIDALSVCR  655

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  YMT RR    +VL G+QI  EEYE++KDL++PLGR P  + QSGA
Sbjct  656  LPALISYMTDRRASFHRVLSGSQIRMEEYEVLKDLVVPLGRAPHISSQSGA  706



>gb|KHN23219.1| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 like 
[Glycine soja]
Length=706

 Score =   156 bits (395),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA LRLP+P+S +E+GMA L++TMSFVD LP+FR KQWQ++ LLF+DALS+CR
Sbjct  596  ARALPALVAVLRLPIPVSIMEQGMACLLETMSFVDALPAFRTKQWQVVALLFIDALSVCR  655

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  YMT RR    +VL G+QI  EEYE++KDL++PLGR P  + QSGA
Sbjct  656  LPALISYMTDRRASFHRVLSGSQIRMEEYEVLKDLVVPLGRAPHISSQSGA  706



>ref|XP_006575272.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Glycine max]
Length=716

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP LVA LRLP+P+S +E+GMA L++TMSFVD LP+FR KQWQ++ LLF+DALS+CR
Sbjct  606  ARALPALVAVLRLPIPVSIMEQGMACLLETMSFVDALPAFRTKQWQVVALLFIDALSVCR  665

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  YMT RR    +VL G+QI  EEYE++KDL++PLGR P  + QSGA
Sbjct  666  LPALISYMTDRRASFHRVLSGSQIRMEEYEVLKDLVVPLGRAPHISSQSGA  716



>gb|KEH41826.1| RNA polymerase II subunit B1 CTD phosphatase RPAP2, putative 
[Medicago truncatula]
Length=702

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V +LRLP+P+  LE+ M  L+DTMSFVD LP+FRMKQWQ++VLLF+DALS+ R
Sbjct  592  ARALPAVVEELRLPIPVDILEQAMVRLLDTMSFVDALPAFRMKQWQVVVLLFVDALSVSR  651

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  YMT RR L  KVL G+QI  EEY+++KD I+PLGR P F+ QSGA
Sbjct  652  VPTLISYMTDRRDLFLKVLSGSQIGKEEYDVLKDFIVPLGRAPHFSSQSGA  702



>ref|XP_009366054.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Pyrus x bretschneideri]
Length=704

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R LP +V+ LRLP P+S+LE+ M+ +++TM+FVD LP+FRMKQW+++VLLFL+ LS+CR
Sbjct  594  ARTLPGIVSQLRLPTPVSSLEQEMSRMLETMTFVDALPAFRMKQWKVVVLLFLEGLSVCR  653

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L P M  RR+L  KVLDG++I+AE YE+MKD IIPLGR P+F+ QSGA
Sbjct  654  IPALGPCMPDRRMLFHKVLDGSEITAEHYELMKDHIIPLGRAPKFSAQSGA  704



>ref|XP_008781193.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Phoenix dactylifera]
Length=689

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RALP  V DL+LP P+STLEK +  L+DTMSFVD LPSFR++QW++IVLLFLDALS+ R+
Sbjct  580  RALPSFVMDLKLPTPVSTLEKFVGQLLDTMSFVDTLPSFRIRQWRVIVLLFLDALSVHRL  639

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            P L P+MT + +LL KVL+ AQ+SAEEYE M+DLIIPL R  E +MQSG 
Sbjct  640  PSLAPHMTNKNMLLHKVLNPAQVSAEEYESMRDLIIPLSRFLELSMQSGG  689



>ref|XP_010551019.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Tarenaya hassleriana]
Length=719

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 90/111 (81%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R+LP L  DLRLP+PIS LEKG+ SL++TM+F + +P+ RMKQWQ+IVLLF+DALS+ R
Sbjct  613  ARSLPGLTTDLRLPIPISELEKGLGSLLETMTFTEAIPALRMKQWQVIVLLFMDALSVSR  672

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +PLLT Y++       KVL+GA I  EEYE+MKDL++PLGRVP+F+ +SGA
Sbjct  673  LPLLTHYISN----TSKVLEGAGIGTEEYEVMKDLLMPLGRVPQFSSRSGA  719



>ref|XP_010674526.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
 ref|XP_010674527.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Beta vulgaris subsp. vulgaris]
Length=730

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP L+ADL+LP P+S LE  +A L+DTMSFVD LP FRMKQWQ+IVLLFLDALS+CR
Sbjct  631  ARALPGLIADLKLPTPVSLLEHELAHLLDTMSFVDALPPFRMKQWQVIVLLFLDALSVCR  690

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLG  469
            IP L  Y+T RRIL+PKVL GAQ+  EEYEIMKDL+IPLG
Sbjct  691  IPGLPAYLTSRRILIPKVLKGAQLRPEEYEIMKDLMIPLG  730



>ref|XP_008388442.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Malus domestica]
Length=706

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R LP +V+ LRL  PIS+LE+ M+ +++TM+FVD LP+FRMKQW+++VLL L+ LS+CR
Sbjct  596  ARTLPGVVSQLRLATPISSLEQEMSCMLETMTFVDALPAFRMKQWKVVVLLLLEGLSVCR  655

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L P+M  RR L  KVLDG+QI+AE YE+MKD I+PLGR PEF+ QSGA
Sbjct  656  IPALGPHMPDRRTLFHKVLDGSQITAEXYELMKDHILPLGRAPEFSAQSGA  706



>ref|XP_009335520.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Pyrus x bretschneideri]
Length=705

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R LP +V+ LRL  PIS+LE+ M+ +++TM+FVD LP+FRMKQW+++VLL L+ LS+CR
Sbjct  595  ARTLPGVVSQLRLATPISSLEQEMSCMLETMTFVDALPAFRMKQWKVVVLLLLEGLSVCR  654

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L P+M  RR L  KVLDG+QI+AE YE+MKD ++PLGR PEF+ QSGA
Sbjct  655  IPALGPHMPDRRTLFDKVLDGSQITAEHYELMKDHMLPLGRAPEFSAQSGA  705



>gb|EPS64466.1| hypothetical protein M569_10314, partial [Genlisea aurea]
Length=597

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V++LRLP PIS LE+GM  L+DTMSF+DPLPS R KQWQ IVLLFL+ALS+ R
Sbjct  498  ARALPGVVSELRLPTPISILEQGMGRLLDTMSFIDPLPSLRTKQWQAIVLLFLNALSVSR  557

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLG  469
            IP L+ Y+  RR  + KVL+GA I  EE+E+MKDLIIPLG
Sbjct  558  IPALSKYLEDRRASIQKVLEGAGIGVEEFEVMKDLIIPLG  597



>ref|XP_008454119.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
 ref|XP_008454120.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis melo]
Length=661

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+P L ++L+L  PIS LE GMA L+DTM+F+D LP+FRMKQWQ+IVLLF++ALS+CR
Sbjct  551  TRAIPGLASELKLSTPISRLEYGMAHLLDTMTFLDALPAFRMKQWQVIVLLFMEALSVCR  610

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L  +M+  R L  KVLD AQI ++EYEIMKD I+PLG   + ++++ A
Sbjct  611  IPSLASHMSSSRNLYHKVLDRAQIQSDEYEIMKDHILPLGLTAQLSVENDA  661



>ref|XP_007016928.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
 gb|EOY34547.1| F2P16.20-like protein isoform 3, partial [Theobroma cacao]
Length=703

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V DLRLP+PISTLE+GM  LIDT+SF++ LP+FRMKQWQ+IVLLF+DALS+CR
Sbjct  618  SRALPAIVTDLRLPIPISTLEQGMGHLIDTISFMEALPAFRMKQWQVIVLLFIDALSVCR  677

Query  588  IPLLTPYMTGRRILLPKVLDGAQIS  514
            IP LTP+MT  R+LL KVLDGAQIS
Sbjct  678  IPALTPHMTNGRMLLHKVLDGAQIS  702



>ref|XP_004157008.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
Length=632

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+P L ++L L  PIS LE GMA L+DTM+F+D LP+FRMKQWQ+IVLLF++ALS+ R
Sbjct  522  TRAIPGLASELNLSTPISRLENGMAHLLDTMTFLDALPAFRMKQWQVIVLLFIEALSVSR  581

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L  +M+  R L  KVLD AQI ++EYEIM+D I+PLGR  + + ++ A
Sbjct  582  IPSLASHMSSSRNLYHKVLDRAQIRSDEYEIMRDHILPLGRTAQLSDENDA  632



>gb|KFK26439.1| hypothetical protein AALP_AA8G248600 [Arabis alpina]
Length=791

 Score =   139 bits (349),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 63/111 (57%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +  DLRLP+ IS LEKG+ SL++TMS    +PSF+M+QW +IVLLFLDALS+ R
Sbjct  685  ARALPRVATDLRLPIAISELEKGLGSLLETMSLTGAVPSFKMEQWLVIVLLFLDALSVSR  744

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     K+L+G+ I +EEYE+MKD+++PLGRVP+F  +SGA
Sbjct  745  IPRIAPYVCNRN----KILEGSGIGSEEYELMKDILLPLGRVPQFASRSGA  791



>ref|XP_004152151.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Cucumis sativus]
 gb|KGN52984.1| hypothetical protein Csa_4G009360 [Cucumis sativus]
Length=662

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+P L ++L L  PIS LE GMA L+DTM+F+D LP+FRMKQWQ+IVLLF++ALS+ R
Sbjct  552  TRAIPGLASELNLSTPISRLENGMAHLLDTMTFLDALPAFRMKQWQVIVLLFIEALSVSR  611

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L  +M+  R L  KVLD AQI ++EYEIM+D I+PLGR  + + ++ A
Sbjct  612  IPSLASHMSSSRNLYHKVLDRAQIRSDEYEIMRDHILPLGRTAQLSDENDA  662



>ref|NP_198028.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAU90076.1| At5g26760 [Arabidopsis thaliana]
 gb|AED93597.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=430

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V  LRLP+ IS LEKG+ SL++TMS    +PSFR+K+W +IVLLFLDALS+ R
Sbjct  324  ARALPRVVTHLRLPIAISELEKGLGSLLETMSLTGAVPSFRVKEWLVIVLLFLDALSVSR  383

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY++ R     K+L+G+ I  EEYE MKD+++PLGRVP+F  +SGA
Sbjct  384  IPRIAPYISNR----DKILEGSGIGNEEYETMKDILLPLGRVPQFATRSGA  430



>ref|XP_006394906.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
 gb|ESQ32192.1| hypothetical protein EUTSA_v10003721mg [Eutrema salsugineum]
Length=720

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +  DLRLP+ IS LEKG+ SL++TMS    +PSFR++QW++IVL+FLDALS+ R
Sbjct  613  ARALPKVATDLRLPIAISELEKGLGSLLETMSLTGAVPSFRVEQWRVIVLVFLDALSVTR  672

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     KVL+G+ I  EEYE MKD+++PLGR+P+F ++SGA
Sbjct  673  IPRIAPYICNRN---NKVLEGSGIGNEEYETMKDILLPLGRIPQFAIRSGA  720



>ref|NP_974839.1| uncharacterized protein [Arabidopsis thaliana]
 sp|F4K1B1.1|RPAP2_ARATH RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Arabidopsis thaliana]
 gb|AED93598.1| uncharacterized protein AT5G26760 [Arabidopsis thaliana]
Length=735

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +V  LRLP+ IS LEKG+ SL++TMS    +PSFR+K+W +IVLLFLDALS+ R
Sbjct  629  ARALPRVVTHLRLPIAISELEKGLGSLLETMSLTGAVPSFRVKEWLVIVLLFLDALSVSR  688

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY++ R     K+L+G+ I  EEYE MKD+++PLGRVP+F  +SGA
Sbjct  689  IPRIAPYISNR----DKILEGSGIGNEEYETMKDILLPLGRVPQFATRSGA  735



>gb|ABR17753.1| unknown [Picea sitchensis]
Length=668

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V  LRLP PIS+LE+ +   ++TM+F+D +P FRM QW++IV+LFLDALS+  
Sbjct  558  SRALPAVVQSLRLPTPISSLEQALGRFLNTMTFIDAIPPFRMNQWRVIVVLFLDALSVHH  617

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP L P +  +R L+ KVL+ A+++ EEY+ MK+L+IPLGR P F+ QSG 
Sbjct  618  IPSLGPQIMNKRPLIHKVLEAAEMTYEEYKTMKELLIPLGRCPRFSSQSGG  668



>ref|XP_010921354.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X3 [Elaeis guineensis]
Length=593

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -1

Query  690  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRRILLPKVLDGAQISA  511
            L+DTMSFVD LPSFR++QWQ+IVLLFLDALS+ R+P L P+MT R +LL KVL+ AQ+SA
Sbjct  509  LLDTMSFVDALPSFRIRQWQVIVLLFLDALSVHRLPPLAPHMTNRNMLLHKVLNPAQVSA  568

Query  510  EEYEIMKDLIIPLGRVPEFTMQSGA  436
            EEYE M+DLIIPLGR PE +MQSG 
Sbjct  569  EEYESMRDLIIPLGRFPELSMQSGG  593



>ref|XP_010493937.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=879

 Score =   133 bits (334),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +   LRLP+ IS LEKG+ SL++TMS    +PSF++K+W +IVLLFLDALS+ R
Sbjct  773  ARALPRVATYLRLPIAISELEKGLGSLLETMSLTGAVPSFKIKEWLVIVLLFLDALSVSR  832

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY++ R     K+L+G+ I  EEYE MKD+++PLGRVP+F  +SGA
Sbjct  833  IPRIAPYISNR----DKILEGSGIGNEEYETMKDILLPLGRVPQFATRSGA  879



>ref|XP_010421540.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Camelina sativa]
Length=890

 Score =   132 bits (333),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/111 (55%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +   LRLP+ IS LEKG+ SL++TMS    +PSF++K+W +IVLLFLDALS+ R
Sbjct  784  ARALPRVATYLRLPIAISELEKGLGSLLETMSLTGAVPSFKIKEWLVIVLLFLDALSVSR  843

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY++ R     K+L+G+ I  EEYE MKD+++PLGRVP+F  +SGA
Sbjct  844  IPRIAPYISNR----DKILEGSGIGNEEYETMKDILLPLGRVPQFATRSGA  890



>emb|CDY05542.1| BnaA02g31490D [Brassica napus]
Length=827

 Score =   130 bits (326),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+  +   L+LPVPIS LEKG+ SL++TMS    +PSFR++QW ++VLLFLDALS+CR
Sbjct  721  ARAVSTVATVLKLPVPISELEKGLGSLLETMSLTGAVPSFRVEQWLVVVLLFLDALSVCR  780

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     KVL+G+ I  EEYE MK++++PLGRVP+F    GA
Sbjct  781  IPRIAPYLLNRN----KVLEGSGIGNEEYETMKEILLPLGRVPQFATLCGA  827



>ref|XP_009129907.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brassica rapa]
Length=852

 Score =   129 bits (324),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 60/111 (54%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+  +   L+LPVPIS LEKG+ SL++TMS    +PSFR++QW ++VLLFLDALS+CR
Sbjct  746  ARAVSTVATVLKLPVPISELEKGLGSLLETMSLTGAVPSFRVEQWLVVVLLFLDALSVCR  805

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     KVL+G+ I  EEYE MK++++PLGRVP+F    GA
Sbjct  806  IPRIAPYLLNRN----KVLEGSGIGNEEYETMKEILLPLGRVPQFATLCGA  852



>emb|CDY25002.1| BnaC02g40060D [Brassica napus]
Length=772

 Score =   128 bits (322),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 82/111 (74%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RA+  +   L+LPVPIS LEKG+ SL++T+S    +PSFR++QW ++VLLFLDALS+CR
Sbjct  666  ARAVSTVATVLKLPVPISELEKGLGSLLETLSLTGAVPSFRVEQWLVVVLLFLDALSVCR  725

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     KVL+G+ I  EEYE MK++++PLGRVP+F    GA
Sbjct  726  IPRIAPYLLNRS----KVLEGSGIGNEEYETMKEILLPLGRVPQFATLCGA  772



>ref|XP_006290171.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
 gb|EOA23069.1| hypothetical protein CARUB_v10003849mg [Capsella rubella]
Length=743

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +   LRLP+ IS LEKG+ SL++TMS    +PS +MK+W +IVLLFLDALS+ R
Sbjct  637  ARALPRVATYLRLPIAISELEKGLGSLLETMSLTGAVPSLKMKEWLVIVLLFLDALSVSR  696

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IPL+ PY++     + K+L+G+ I  +EYE+MKD+ +PLGRVP+F  +SGA
Sbjct  697  IPLIAPYLSN----INKILEGSGIGNDEYEMMKDIFLPLGRVPQFATRSGA  743



>gb|AAB61054.1| contains similarity to myosin heavy chain [Arabidopsis thaliana]
Length=1133

 Score =   127 bits (320),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 24/135 (18%)
 Frame = -1

Query  768   SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
             +RALP +V  LRLP+ IS LEKG+ SL++TMS    +PSFR+K+W +IVLLFLDALS+ R
Sbjct  999   ARALPRVVTHLRLPIAISELEKGLGSLLETMSLTGAVPSFRVKEWLVIVLLFLDALSVSR  1058

Query  588   IPLLTPYMTGR-------------RILLP-----------KVLDGAQISAEEYEIMKDLI  481
             IP + PY++ R             R L             ++L+G+ I  EEYE MKD++
Sbjct  1059  IPRIAPYISNRDKVCSSQLEHNKWRTLTEFNLLINVGEKYQILEGSGIGNEEYETMKDIL  1118

Query  480   IPLGRVPEFTMQSGA  436
             +PLGRVP+F  +SGA
Sbjct  1119  LPLGRVPQFATRSGA  1133



>ref|XP_006841578.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
 gb|ERN03253.1| hypothetical protein AMTR_s00003p00194360 [Amborella trichopoda]
Length=591

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +VA+++LP PISTLE  +  L+DTM+F + LP FRMKQW +IVLLFLDALS+  
Sbjct  489  ARALPGVVANIKLPTPISTLEVALGRLLDTMTFTEALPPFRMKQWHVIVLLFLDALSVHI  548

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIP  475
            +P L  ++  RR L+ K+L+ AQ+S EEY IM+DL +P
Sbjct  549  VPALEQHIASRRTLVHKMLEDAQVSNEEYNIMRDLFLP  586



>ref|XP_009389521.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Musa acuminata subsp. malaccensis]
Length=668

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RAL  LV ++ LPVP+STLE+ +  L+DTMSFVD LPSF+++QWQ++VLLFLDALS+ R+
Sbjct  563  RALSGLVMEISLPVPLSTLERTVGCLLDTMSFVDALPSFKLEQWQVVVLLFLDALSVHRL  622

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L   +T   +LL KVL+ A++S++EY+ M+DL  PLGR
Sbjct  623  PSLASEVTNMDLLLHKVLNPAEVSSQEYDSMRDLFTPLGR  662



>gb|KDO45358.1| hypothetical protein CISIN_1g0087651mg, partial [Citrus sinensis]
Length=520

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R  P LVADLRL +P+STLEKG+  L++TMSF+DPLP+F++KQWQ+I +LFLDALS+CR
Sbjct  444  ARTFPALVADLRLRIPVSTLEKGLEGLLNTMSFIDPLPAFKVKQWQVITVLFLDALSVCR  503

Query  588  IPLLTPYMTGRRILLPK  538
            IP LTP+MT R +LL K
Sbjct  504  IPALTPHMTNRTMLLRK  520



>gb|KDO45359.1| hypothetical protein CISIN_1g0087651mg, partial [Citrus sinensis]
Length=397

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R  P LVADLRL +P+STLEKG+  L++TMSF+DPLP+F++KQWQ+I +LFLDALS+CR
Sbjct  321  ARTFPALVADLRLRIPVSTLEKGLEGLLNTMSFIDPLPAFKVKQWQVITVLFLDALSVCR  380

Query  588  IPLLTPYMTGRRILLPK  538
            IP LTP+MT R +LL K
Sbjct  381  IPALTPHMTNRTMLLRK  397



>ref|XP_001782029.1| predicted protein [Physcomitrella patens]
 gb|EDQ53172.1| predicted protein [Physcomitrella patens]
Length=863

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SRALP +V  LRLPVP+STLE  M  LI  MSFV+ LP    KQW+++V++ LDALS+ R
Sbjct  753  SRALPEVVRALRLPVPMSTLEVAMGKLIKNMSFVEALPPLSTKQWRMLVIVLLDALSVQR  812

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L  ++   R +L KVLD    S  EY++ +D+++PLGR P F+  SG 
Sbjct  813  LPRLGVHLMNNRSVLRKVLDSTGTSESEYDVFRDVLLPLGRSPTFSTLSGG  863



>ref|XP_003569080.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Brachypodium distachyon]
Length=746

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             ALPVL ++LR+ +P+S LE  +  LIDTMSFV+ LP  R +QWQL+VL+ LDALS+CR+
Sbjct  634  NALPVLTSNLRMQIPVSKLETTLGYLIDTMSFVEALPPLRSRQWQLMVLVLLDALSVCRL  693

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L P M+  + LL KVL+ +Q+S EEY+ M DL +P GR
Sbjct  694  PGLAPVMSDSK-LLQKVLNSSQVSREEYDSMVDLFLPFGR  732



>sp|A2Y040.1|RPAP2_ORYSI RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Indica Group]
 gb|EAY96450.1| hypothetical protein OsI_18345 [Oryza sativa Indica Group]
Length=726

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             ALPVLV++LR+ +P+S LE  +  L+DTMSFVD LPS R +QWQL+VL+ LDALS+ R+
Sbjct  618  NALPVLVSNLRMQIPVSKLEITLGYLLDTMSFVDALPSLRSRQWQLMVLVLLDALSLHRL  677

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L P M+  + LL K+L+ AQ+S EEY+ M DL++P GR
Sbjct  678  PALAPIMSDSK-LLQKLLNSAQVSREEYDSMIDLLLPFGR  716



>sp|Q6AVZ9.1|RPAP2_ORYSJ RecName: Full=Putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog; AltName: Full=RNA polymerase II-associated 
protein 2 homolog [Oryza sativa Japonica Group]
 gb|AAT94046.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE62232.1| hypothetical protein OsJ_17019 [Oryza sativa Japonica Group]
Length=726

 Score =   111 bits (277),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             ALPVLV++LR+ +P+S LE  +  L+DTMSFVD LPS R +QWQL+VL+ LDALS+ R+
Sbjct  618  NALPVLVSNLRMQIPVSKLEITLGYLLDTMSFVDALPSLRSRQWQLMVLVLLDALSLHRL  677

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L P M+  + LL K+L+ AQ+S EEY+ M DL++P GR
Sbjct  678  PALAPIMSDSK-LLQKLLNSAQVSREEYDSMIDLLLPFGR  716



>ref|XP_010921353.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog isoform X2 [Elaeis guineensis]
Length=664

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
            RALP +V DL+LP P+STLEK +  L+DTMSFVD LPSFR++QWQ+IVLLFLDALS+ R+
Sbjct  572  RALPSIVMDLKLPTPVSTLEKFVGRLLDTMSFVDALPSFRIRQWQVIVLLFLDALSVHRL  631

Query  585  PLLTPYMTGRRILLPKVLDG  526
            P L P+MT R +LL K   G
Sbjct  632  PPLAPHMTNRNMLLHKAAHG  651



>ref|NP_001137038.1| uncharacterized protein LOC100217208 [Zea mays]
 gb|ACF83133.1| unknown [Zea mays]
Length=324

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             A+PVL+++LRL +P+S LE  +  LIDTMSFVD LPS R +QWQ +VL+ LDALS+ ++
Sbjct  218  NAVPVLISNLRLQIPVSKLEITLGYLIDTMSFVDALPSLRSRQWQAVVLVMLDALSVHQL  277

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L P  +  + L+ K+L+ AQ+S EEY+ M DL +P GR
Sbjct  278  PALAPVFSNSK-LVQKMLNAAQVSREEYDSMVDLFLPFGR  316



>ref|XP_006654013.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog, partial [Oryza brachyantha]
Length=660

 Score =   108 bits (271),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             ALPVLV++ R+ +P+S LE  +  LIDTMSFVD LPS R +QWQ++VL+ LDALSI ++
Sbjct  552  NALPVLVSNWRMQIPVSKLEITLGYLIDTMSFVDALPSLRSRQWQVMVLVLLDALSIHQL  611

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L   M+  R LL K+L+ AQ+S EEY+ M DLI+P GR
Sbjct  612  PGLAQTMSDSR-LLHKLLNSAQVSREEYDSMIDLILPFGR  650



>emb|CDX80586.1| BnaC07g28580D [Brassica napus]
Length=607

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 4/99 (4%)
 Frame = -1

Query  732  LPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTPYMTGRR  553
            LP+ I  L KG+ SL++TMS    +PSFR++QWQ+IV + LDALS+CRIP + PY+  + 
Sbjct  513  LPIAIYELGKGLGSLVETMSLTWAVPSFRVEQWQVIVFVLLDALSVCRIPRIAPYIFNKN  572

Query  552  ILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
                KVL+G  I  E+YE MKD+++PLGRVP F  + G 
Sbjct  573  ----KVLEGRGIGNEDYETMKDILLPLGRVPRFDTRCGG  607



>ref|XP_008654513.1| PREDICTED: uncharacterized protein LOC100217208 isoform X1 [Zea 
mays]
 gb|AFW82703.1| hypothetical protein ZEAMMB73_107648 [Zea mays]
Length=725

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             A+PVL+++LRL +P+S LE  +  LIDTMSFVD LPS R +QWQ +VL+ LDALS+ ++
Sbjct  619  NAVPVLISNLRLQIPVSKLEITLGYLIDTMSFVDALPSLRSRQWQAVVLVMLDALSVHQL  678

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            P L P  +  + L+ K+L+ AQ+S EEY+ M DL +P GR
Sbjct  679  PALAPVFSNSK-LVQKMLNAAQVSREEYDSMVDLFLPFGR  717



>ref|XP_002440538.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
 gb|EES18968.1| hypothetical protein SORBIDRAFT_09g002730 [Sorghum bicolor]
Length=746

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 75/105 (71%), Gaps = 1/105 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             A+PVL+++LRL +P+S LE  +  LIDTMSFV+ LPS R +QWQ +VL+ LDALS+ ++
Sbjct  640  NAVPVLISNLRLQIPVSKLEITLGYLIDTMSFVEALPSLRSRQWQAVVLVMLDALSVHQL  699

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFT  451
            P L P  +  + L+ K+L+ AQ+S EEY+ M DL +P GR  + T
Sbjct  700  PALAPVFSNSK-LVQKMLNAAQVSREEYDSMVDLFLPFGRSVQAT  743



>emb|CDX88239.1| BnaA06g28300D [Brassica napus]
Length=303

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 21/111 (19%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +RALP +  DLRLP+PIS L KG+                 ++QWQ+IV + LDALS+CR
Sbjct  214  ARALPRVATDLRLPIPISELGKGL-----------------VEQWQVIVFVLLDALSVCR  256

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            IP + PY+  R     KVL+G+ I  E+YE MKD+++PLGRVP+F  + G 
Sbjct  257  IPRIAPYIFNRN----KVLEGSGIGNEDYETMKDILLPLGRVPQFATRCGG  303



>gb|EMT25025.1| hypothetical protein F775_26015 [Aegilops tauschii]
Length=711

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            S ALPVLV+++R+ +P+S LE  +  LIDTMS VD LP+ R +QWQL+VL+ LDALS+ R
Sbjct  604  SNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLVDALPALRSRQWQLLVLVLLDALSVHR  663

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            +P L P ++  + L+ KVL+ AQ+S EEY+ + DLI+P GR
Sbjct  664  LPALAPVISDSK-LVHKVLNSAQVSREEYDSIVDLILPFGR  703



>ref|XP_008345660.1| PREDICTED: LOW QUALITY PROTEIN: putative RNA polymerase II subunit 
B1 CTD phosphatase RPAP2 homolog [Malus domestica]
Length=333

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            +R LP +V+ LRLP P+S+LE+ M+ +++TM+FVD LP+FRMKQW+++VLLFL+ LS+ R
Sbjct  252  ARTLPGVVSQLRLPTPVSSLEQEMSRMLETMTFVDALPAFRMKQWKVVVLLFLEGLSVXR  311

Query  588  IPLLTPYMTGRRILLPK  538
            IP L P M  RR+L  K
Sbjct  312  IPALGPCMPDRRMLFHK  328



>ref|XP_004960407.1| PREDICTED: putative RNA polymerase II subunit B1 CTD phosphatase 
RPAP2 homolog [Setaria italica]
Length=739

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = -1

Query  765  RALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRI  586
             ALPVLV++LRL +P+S LE  +  LIDTMSF DPLPS R +QWQL+VL+ LD LSI ++
Sbjct  633  NALPVLVSNLRLRIPVSKLEITLGYLIDTMSFFDPLPSLRSRQWQLVVLVMLDVLSIHQL  692

Query  585  PLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQ  445
            P L P ++  + L+ K+L+ AQ+S EEYE M DL +P GR  +  MQ
Sbjct  693  PALAPVVSNSK-LVQKMLNAAQVSREEYESMVDLFLPFGRSIQTFMQ  738



>gb|EMS49261.1| hypothetical protein TRIUR3_22581 [Triticum urartu]
Length=543

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 10/110 (9%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            S ALPVLV+++R+ +P+S LE  +  LIDTMS VD LP+ R +QWQL+VL+ LDALS+ +
Sbjct  427  SNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLVDALPALRSRQWQLLVLVLLDALSVHQ  486

Query  588  IPLLTPYMTGRRILLPKV---------LDGAQISAEEYEIMKDLIIPLGR  466
            +P L P ++  + L+ KV         L+ AQ+S EEY+ M DLI+P GR
Sbjct  487  LPALAPVISDSK-LVQKVAFLFRTSLILNSAQVSREEYDSMVDLILPFGR  535



>dbj|BAJ96888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=737

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            S ALPVLV+++R+ +P+S LE  +  LIDTMS VD LP+ R +QWQL+VL+ LDALS+ R
Sbjct  636  SNALPVLVSNMRMQIPVSKLETTLGYLIDTMSLVDALPALRSRQWQLLVLMLLDALSVHR  695

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGR  466
            +P L P ++  + L+ K+L+ AQ+S EEY+ M DLI+P GR
Sbjct  696  LPALAPVISDSK-LVQKILNSAQVSREEYDSMVDLILPFGR  735



>ref|XP_002874325.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50584.1| hypothetical protein ARALYDRAFT_326902 [Arabidopsis lyrata subsp. 
lyrata]
Length=1147

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 51/120 (43%), Positives = 74/120 (62%), Gaps = 17/120 (14%)
 Frame = -1

Query  768   SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
             +RALP +   LRLP+ IS LEKG+ SL++TMS    +PSF++K+W +IVLLFLDALS+ +
Sbjct  1036  ARALPRVTTYLRLPIAISELEKGLGSLLETMSLTGAVPSFKIKEWLVIVLLFLDALSVSQ  1095

Query  588   IPLLTPYMTGRRILLPKVLDGAQISAEEYEIM---------KDLIIPLGRVPEFTMQSGA  436
               L+T            ++ G  +S     IM         +D+++PLGRVP+F  +SGA
Sbjct  1096  ARLVTVNFN--------IIKGESLSEFNLLIMLVKNIRFWKEDILLPLGRVPQFATRSGA  1147



>ref|XP_002990357.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
 gb|EFJ08626.1| hypothetical protein SELMODRAFT_447998 [Selaginella moellendorffii]
Length=608

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SR LP +V  L +  P+S +E+ +  L+ TM F   LP+F  K W++I  LFLDALS+ R
Sbjct  498  SRVLPDVVQALAIAEPLSVIERAVGRLLGTMHFSQALPAFTTKHWRMIAALFLDALSVHR  557

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L   MT  R LL K++  + ++  EYE  K+L++PLGR+P F    G 
Sbjct  558  LPGLGSQMTNNRALLRKLIIDSGMNDPEYESFKELLLPLGRLPAFASGGGG  608



>ref|XP_002979385.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
 gb|EFJ19793.1| hypothetical protein SELMODRAFT_444189 [Selaginella moellendorffii]
Length=608

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            SR LP +V  L +  P+S +E+ +  L+ TM F   LP+F  K W++I  LFLDALS+ R
Sbjct  498  SRVLPDVVQALAIAEPLSVIERAVGRLLGTMHFSQALPAFTTKHWRMIAALFLDALSVHR  557

Query  588  IPLLTPYMTGRRILLPKVLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            +P L   MT  R LL K++  + ++  EYE  K+L++PLGR+P F    G 
Sbjct  558  LPGLGGQMTNNRALLRKLIIDSGMNDPEYESFKELLLPLGRLPAFASGGGG  608



>ref|XP_007016930.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
 gb|EOY34549.1| F2P16.20-like protein isoform 5 [Theobroma cacao]
Length=708

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQL  628
            SRALP +V DLRLP+PISTLE+GM  LIDT+SF++ LP+FRMKQW++
Sbjct  629  SRALPAIVTDLRLPIPISTLEQGMGHLIDTISFMEALPAFRMKQWEI  675



>ref|XP_007016927.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
 gb|EOY34546.1| F2P16.20-like protein isoform 2 [Theobroma cacao]
Length=679

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIV  622
            SRALP +V DLRLP+PISTLE+GM  LIDT+SF++ LP+FRMKQW  +V
Sbjct  629  SRALPAIVTDLRLPIPISTLEQGMGHLIDTISFMEALPAFRMKQWCWMV  677



>gb|KDO45356.1| hypothetical protein CISIN_1g0087652mg, partial [Citrus sinensis]
 gb|KDO45357.1| hypothetical protein CISIN_1g0087652mg, partial [Citrus sinensis]
Length=34

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  537  VLDGAQISAEEYEIMKDLIIPLGRVPEFTMQSGA  436
            VLDGAQISAEEYE+MKD ++PLGR P+F+ QSGA
Sbjct  1    VLDGAQISAEEYEVMKDFLMPLGRAPQFSSQSGA  34



>gb|ACG46670.1| hypothetical protein [Zea mays]
Length=54

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -1

Query  690  LIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIPLLTP  571
            +IDT+SFVD LPS R +QWQ +VL+ LDALS+ ++P L P
Sbjct  1    MIDTLSFVDALPSLRSRQWQAVVLVMLDALSVHQLPALAP  40



>ref|XP_005844427.1| hypothetical protein CHLNCDRAFT_139124 [Chlorella variabilis]
 gb|EFN52325.1| hypothetical protein CHLNCDRAFT_139124 [Chlorella variabilis]
Length=905

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 33/101 (33%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = -1

Query  768  SRALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICR  589
            S ALP + A L+       +E+ +  L+ T+  V PLP+F+  QWQ++ +LFL ALS+ R
Sbjct  804  SAALPPVCAGLQAAAARGQVERSLDELLRTLRLVGPLPAFKASQWQVVAVLFLKALSLER  863

Query  588  IPLLTPYMTGRRIL--LPKVLDGAQISAEEYEIMKDLIIPL  472
             P L      R  +  L ++L     ++EE+  + +L+ P+
Sbjct  864  CPALREAFETRDGITRLNRLLASLSFTSEEFYAILELLCPV  904



>gb|KIY99645.1| hypothetical protein MNEG_8313 [Monoraphidium neglectum]
Length=104

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -1

Query  762  ALPVLVADLRLPVPISTLEKGMASLIDTMSFVDPLPSFRMKQWQLIVLLFLDALSICRIP  583
            ALP ++A LR+ VP S + + +++L+ T+    PLPS + +QWQ +V L L  LS  R+ 
Sbjct  5    ALPPVLAALRVKVPASDVSRHVSALVRTLDLSRPLPSLQARQWQAVVALLLAGLSWGRLE  64

Query  582  LLTPYMTGRR  553
             L P  +  R
Sbjct  65   GLRPVFSRAR  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100