BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012O23

Length=741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          286   1e-90   Nicotiana sylvestris
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          282   2e-89   Nicotiana tomentosiformis
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          281   4e-89   Solanum lycopersicum
emb|CDP08773.1|  unnamed protein product                                281   5e-89   Coffea canephora [robusta coffee]
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          279   4e-88   Solanum tuberosum [potatoes]
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                278   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          277   2e-87   Vitis vinifera
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    277   2e-87   Nicotiana sylvestris
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          277   2e-87   Nicotiana tomentosiformis
ref|XP_002511907.1|  caax prenyl protease ste24, putative               277   2e-87   Ricinus communis
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    277   3e-87   Nicotiana sylvestris
gb|EPS68077.1|  hypothetical protein M569_06696                         268   4e-87   Genlisea aurea
gb|KDO86286.1|  hypothetical protein CISIN_1g014430mg                   272   9e-87   Citrus sinensis [apfelsine]
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          275   2e-86   Phoenix dactylifera
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          274   5e-86   Elaeis guineensis
ref|XP_002302601.1|  CAAX protease family protein                       273   8e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          273   1e-85   Sesamum indicum [beniseed]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          272   3e-85   Citrus sinensis [apfelsine]
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          271   4e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             272   6e-85   
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          270   9e-85   Populus euphratica
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          270   1e-84   Phoenix dactylifera
ref|XP_002320821.1|  CAAX protease family protein                       270   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          270   1e-84   Elaeis guineensis
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             270   2e-84   Prunus persica
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          270   2e-84   Nelumbo nucifera [Indian lotus]
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     269   3e-84   Eucalyptus grandis [rose gum]
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          269   3e-84   Pyrus x bretschneideri [bai li]
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                270   3e-84   
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          269   4e-84   Eucalyptus grandis [rose gum]
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    269   5e-84   Gossypium arboreum [tree cotton]
gb|KJB41392.1|  hypothetical protein B456_007G102500                    268   6e-84   Gossypium raimondii
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          268   1e-83   Amborella trichopoda
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          267   2e-83   Prunus mume [ume]
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          267   2e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007051723.1|  Peptidase family M48 family protein                266   5e-83   
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          265   2e-82   Fragaria vesca subsp. vesca
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          265   2e-82   
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          263   4e-82   Cucumis melo [Oriental melon]
gb|ADE76166.1|  unknown                                                 256   7e-82   Picea sitchensis
gb|AFK35300.1|  unknown                                                 256   9e-82   Lotus japonicus
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          263   9e-82   
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          263   1e-81   Cucumis sativus [cucumbers]
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          261   3e-81   Glycine max [soybeans]
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             261   3e-81   Phaseolus vulgaris [French bean]
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          261   5e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          261   6e-81   
gb|KHM99334.1|  CAAX prenyl protease 1 like                             260   1e-80   Glycine soja [wild soybean]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          259   2e-80   Glycine max [soybeans]
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          257   1e-79   Tarenaya hassleriana [spider flower]
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  257   2e-79   Medicago truncatula
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          256   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          256   3e-79   Camelina sativa [gold-of-pleasure]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        256   4e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAL07084.1|  putative CAAX prenyl protease                           256   4e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07191.1|  BnaCnng02060D                                          256   5e-79   
emb|CDY48517.1|  BnaA09g00060D                                          256   5e-79   Brassica napus [oilseed rape]
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          256   5e-79   Brassica rapa
ref|XP_002874990.1|  ATSTE24                                            256   5e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          254   1e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             254   2e-78   Capsella rubella
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    254   2e-78   Brassica rapa
emb|CDX91888.1|  BnaC03g31900D                                          254   2e-78   
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     254   3e-78   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    254   3e-78   Arabis alpina [alpine rockcress]
emb|CDX74353.1|  BnaA03g26940D                                          254   3e-78   
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    253   4e-78   Tarenaya hassleriana [spider flower]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             254   7e-78   
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          252   1e-77   Oryza brachyantha
ref|NP_001047739.1|  Os02g0680400                                       251   2e-77   
gb|EEC73787.1|  hypothetical protein OsI_08473                          251   2e-77   Oryza sativa Indica Group [Indian rice]
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          251   3e-77   Setaria italica
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          250   1e-76   Sorghum bicolor [broomcorn]
emb|CAL26913.1|  CAAX peptidase                                         248   4e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          248   6e-76   Brachypodium distachyon [annual false brome]
ref|XP_001783632.1|  predicted protein                                  246   4e-75   
ref|NP_001131195.1|  uncharacterized protein LOC100192503               245   5e-75   Zea mays [maize]
ref|XP_001780822.1|  predicted protein                                  244   1e-74   
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       243   4e-74   
gb|AFW63375.1|  CAAX prenyl protease 1                                  246   2e-73   
emb|CAB80941.1|  putative CAAX prenyl protease                          241   4e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    239   2e-72   Brassica rapa
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         238   5e-72   Jatropha curcas
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          236   3e-71   Fragaria vesca subsp. vesca
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       234   1e-70   Zea mays [maize]
ref|NP_001152504.1|  CAAX prenyl protease 1                             234   2e-70   Zea mays [maize]
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600             229   7e-69   Selaginella moellendorffii
gb|AIC32889.1|  STE24                                                   228   4e-68   Puccinellia tenuiflora
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          203   1e-58   Fragaria vesca subsp. vesca
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                     194   3e-56   
gb|KJB41393.1|  hypothetical protein B456_007G102500                    194   1e-55   Gossypium raimondii
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   193   4e-55   Citrus sinensis [apfelsine]
gb|KHN29321.1|  CAAX prenyl protease 1 like                             174   5e-48   Glycine soja [wild soybean]
gb|AAB61028.1|  A_IG002N01.21 gene product                              162   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   155   4e-41   Citrus sinensis [apfelsine]
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                   155   1e-40   
gb|AFW68434.1|  hypothetical protein ZEAMMB73_431227                    148   2e-39   
gb|KEH18809.1|  CAAX prenyl protease-like protein                       152   2e-39   Medicago truncatula
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672              150   2e-38   Volvox carteri f. nagariensis
emb|CCI48758.1|  unnamed protein product                                146   4e-37   Albugo candida
emb|CCA18761.1|  CAAX prenyl protease 1 putative                        145   2e-36   Albugo laibachii Nc14
ref|XP_004348317.1|  CAAX prenyl protease 1                             140   7e-35   Capsaspora owczarzaki ATCC 30864
ref|XP_002900396.1|  CAAX prenyl protease 1                             139   2e-34   Phytophthora infestans T30-4
ref|XP_002292916.1|  predicted protein                                  137   5e-34   Thalassiosira pseudonana CCMP1335
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                  137   5e-34   Capitella teleta
gb|ETI52023.1|  hypothetical protein F443_04763                         137   8e-34   Phytophthora parasitica P1569
gb|ETL98448.1|  hypothetical protein L917_04490                         137   8e-34   Phytophthora parasitica
gb|ETO80780.1|  hypothetical protein F444_04815                         137   9e-34   Phytophthora parasitica P1976
gb|ETL45293.1|  hypothetical protein L916_04606                         137   9e-34   Phytophthora parasitica
gb|ETK91894.1|  hypothetical protein L915_04651                         137   9e-34   Phytophthora parasitica
ref|XP_008902128.1|  hypothetical protein PPTG_09033                    137   1e-33   Phytophthora parasitica INRA-310
ref|XP_009501173.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   1e-33   Phalacrocorax carbo [common cormorant]
ref|XP_008935450.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-33   Merops nubicus
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864             136   2e-33   Phytophthora sojae
ref|XP_010116516.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   2e-33   Chlamydotis macqueenii
ref|XP_009059971.1|  hypothetical protein LOTGIDRAFT_209825             135   3e-33   Lottia gigantea
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog          135   4e-33   Aplysia californica
ref|XP_009949557.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-33   Leptosomus discolor
gb|KGO76072.1|  Peptidase M48                                           134   6e-33   Penicillium italicum
ref|XP_010158796.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   2e-32   Eurypyga helias
gb|EMP29923.1|  CAAX prenyl protease 1 like protein                     130   2e-32   Chelonia mydas [green seaturtle]
gb|KGO40189.1|  Peptidase M48                                           133   2e-32   Penicillium expansum
gb|KFH71808.1|  hypothetical protein MVEG_02102                         133   2e-32   Mortierella verticillata NRRL 6337
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                     132   2e-32   Ophiophagus hannah
ref|XP_005428744.1|  PREDICTED: CAAX prenyl protease 1 homolog          132   3e-32   Geospiza fortis
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    132   3e-32   Fukomys damarensis [Damara mole rat]
ref|XP_002565802.1|  Pc22g18990                                         132   3e-32   Penicillium rubens Wisconsin 54-1255
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    132   3e-32   Fukomys damarensis [Damara mole rat]
dbj|BAG51388.1|  unnamed protein product                                128   4e-32   Homo sapiens [man]
ref|XP_005651455.1|  hypothetical protein COCSUDRAFT_27312              132   4e-32   Coccomyxa subellipsoidea C-169
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    132   4e-32   Python bivittatus
ref|XP_010721597.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   4e-32   Meleagris gallopavo [common turkey]
gb|EPZ36837.1|  Peptidase M48 domain-containing protein                 129   6e-32   Rozella allomycis CSF55
gb|KFP73521.1|  CAAX prenyl protease 1                                  128   6e-32   Apaloderma vittatum
ref|XP_009876903.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   6e-32   Apaloderma vittatum
ref|XP_009685466.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   7e-32   Struthio camelus australis
ref|XP_010284930.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   7e-32   Phaethon lepturus
ref|XP_007892978.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   7e-32   Callorhinchus milii [Australian ghost shark]
ref|XP_004705331.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   8e-32   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_001623710.1|  predicted protein                                  131   9e-32   Nematostella vectensis
gb|EKV19760.1|  CaaX prenyl protease Ste24                              131   1e-31   Penicillium digitatum PHI26
ref|XP_005353368.1|  PREDICTED: CAAX prenyl protease 1 homolog          131   1e-31   
ref|XP_009491273.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   1e-31   Pelecanus crispus
ref|XP_009685465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   1e-31   Struthio camelus australis
ref|XP_009813244.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   1e-31   Gavia stellata
ref|XP_007066142.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    130   1e-31   
ref|XP_005029095.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   1e-31   
ref|XP_002485210.1|  CaaX prenyl protease Ste24                         130   1e-31   Talaromyces stipitatus ATCC 10500
emb|CDM27808.1|  CAAX prenyl protease 1                                 130   1e-31   Penicillium roqueforti FM164
gb|KFV87620.1|  CAAX prenyl protease 1                                  130   2e-31   Struthio camelus australis
ref|XP_006033777.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-31   
ref|XP_417720.1|  PREDICTED: CAAX prenyl protease 1 homolog             130   2e-31   Gallus gallus [bantam]
ref|XP_007950886.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-31   Orycteropus afer afer
ref|XP_005029094.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   2e-31   Anas platyrhynchos [duck]
ref|XP_004426071.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-31   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005309438.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   2e-31   Chrysemys picta bellii
ref|XP_010217187.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-31   Tinamus guttatus
gb|EOA94667.1|  CAAX prenyl protease 1-like protein                     130   2e-31   Anas platyrhynchos [duck]
gb|KGL80196.1|  CAAX prenyl protease 1                                  130   2e-31   Tinamus guttatus
ref|XP_005309437.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   2e-31   Chrysemys picta bellii
ref|XP_006269945.1|  PREDICTED: CAAX prenyl protease 1 homolog          130   2e-31   Alligator mississippiensis
ref|XP_005309436.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   2e-31   Chrysemys picta bellii
ref|XP_002377095.1|  CaaX prenyl protease Ste24                         129   2e-31   Aspergillus flavus NRRL3357
ref|XP_007492913.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   3e-31   Monodelphis domestica
ref|XP_004665222.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   3e-31   Jaculus jaculus
ref|XP_001381205.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    130   3e-31   Monodelphis domestica
ref|XP_010593553.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   3e-31   Loxodonta africana [African bush elephant]
gb|KFP47980.1|  CAAX prenyl protease 1                                  129   3e-31   Cathartes aura
ref|XP_006113335.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   3e-31   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009822213.1|  hypothetical protein H257_00958                    130   3e-31   Aphanomyces astaci
ref|XP_009991374.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   3e-31   Tauraco erythrolophus
ref|XP_004450692.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   3e-31   
gb|EPS28736.1|  hypothetical protein PDE_03682                          129   3e-31   Penicillium oxalicum 114-2
gb|KFU93569.1|  CAAX prenyl protease 1                                  129   4e-31   Chaetura pelagica
emb|CBJ27157.1|  CaaX prenyl protease Ste24                             129   4e-31   Ectocarpus siliculosus
ref|XP_008929891.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   
ref|XP_010187899.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   Mesitornis unicolor
ref|XP_002194902.2|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   Taeniopygia guttata
ref|XP_009095809.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   
gb|KFQ39196.1|  CAAX prenyl protease 1                                  129   4e-31   Mesitornis unicolor
gb|KFO78045.1|  CAAX prenyl protease 1                                  129   4e-31   Cuculus canorus
ref|XP_010207607.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   Colius striatus
gb|EME39248.1|  hypothetical protein DOTSEDRAFT_75093                   129   4e-31   Dothistroma septosporum NZE10
gb|KFW75388.1|  CAAX prenyl protease 1                                  129   4e-31   Manacus vitellinus
ref|XP_009701667.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   Cariama cristata
ref|XP_009575599.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   4e-31   Fulmarus glacialis
ref|XP_006113334.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   4e-31   Pelodiscus sinensis [Chinese softshell turtle]
gb|KFV92102.1|  CAAX prenyl protease 1                                  129   5e-31   Fulmarus glacialis
gb|EMF09871.1|  CaaX prenyl protease                                    129   5e-31   Sphaerulina musiva SO2202
ref|XP_008149410.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Eptesicus fuscus
ref|XP_009074890.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Acanthisitta chloris
ref|XP_003415368.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   5e-31   Loxodonta africana [African bush elephant]
ref|XP_010001210.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Chaetura pelagica
ref|XP_004740737.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   5e-31   Mustela putorius furo [black ferret]
ref|XP_010086478.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Pterocles gutturalis
gb|KFP82009.1|  CAAX prenyl protease 1                                  129   5e-31   Acanthisitta chloris
gb|KFP66604.1|  CAAX prenyl protease 1                                  129   5e-31   Cariama cristata
gb|KFP21746.1|  CAAX prenyl protease 1                                  129   5e-31   Egretta garzetta
gb|KFO58257.1|  CAAX prenyl protease 1                                  129   5e-31   Corvus brachyrhynchos
gb|KFM12524.1|  CAAX prenyl protease 1                                  129   5e-31   Aptenodytes forsteri
ref|XP_005083884.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Mesocricetus auratus [Syrian golden hamster]
ref|XP_001821320.1|  CAAX prenyl protease 1                             129   5e-31   Aspergillus oryzae RIB40
ref|XP_008630820.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   
gb|KFR09506.1|  CAAX prenyl protease 1                                  129   5e-31   Opisthocomus hoazin [hoatzin]
gb|KFO89161.1|  CAAX prenyl protease 1                                  129   5e-31   Buceros rhinoceros silvestris
gb|KFP23371.1|  CAAX prenyl protease 1                                  129   5e-31   Colius striatus
ref|XP_010133525.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Buceros rhinoceros silvestris
gb|KFV03217.1|  CAAX prenyl protease 1                                  129   5e-31   Pterocles gutturalis
gb|KFV07913.1|  CAAX prenyl protease 1                                  129   5e-31   Tauraco erythrolophus
gb|KFQ91415.1|  CAAX prenyl protease 1                                  129   5e-31   Nipponia nippon
ref|XP_005529940.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005492450.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   5e-31   
ref|XP_003225003.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   
ref|XP_002715233.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   
ref|XP_009931337.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   Opisthocomus hoazin [hoatzin]
ref|XP_009284932.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   Aptenodytes forsteri
ref|XP_005058383.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   Ficedula albicollis
gb|EFB13524.1|  hypothetical protein PANDA_017398                       129   6e-31   Ailuropoda melanoleuca
ref|XP_004614273.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   6e-31   Sorex araneus [Eurasian shrew]
gb|KFY19341.1|  hypothetical protein V493_08005                         129   6e-31   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
gb|KFV40539.1|  CAAX prenyl protease 1                                  128   7e-31   Tyto alba [Schleiereule]
ref|XP_009969340.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   7e-31   Tyto alba [Schleiereule]
gb|ERE83119.1|  putative CAAX prenyl protease 1 like protein            128   7e-31   Cricetulus griseus [Chinese hamsters]
ref|XP_010345849.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   7e-31   Saimiri boliviensis boliviensis
ref|XP_009909817.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   7e-31   Picoides pubescens
ref|XP_006886567.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-31   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006995844.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-31   Peromyscus maniculatus bairdii
ref|XP_008063695.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   7e-31   Carlito syrichta
ref|XP_009644178.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-31   Egretta garzetta
ref|XP_006867649.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-31   Chrysochloris asiatica
ref|XP_005607230.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   7e-31   Equus caballus [domestic horse]
ref|XP_003989947.2|  PREDICTED: CAAX prenyl protease 1 homolog          129   7e-31   
ref|XP_004415415.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   8e-31   
gb|KFV63659.1|  CAAX prenyl protease 1                                  128   8e-31   Picoides pubescens
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   8e-31   Cricetulus griseus [Chinese hamsters]
ref|XP_007077458.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   8e-31   Panthera tigris altaica
ref|XP_003799067.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   8e-31   
ref|XP_002927608.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    129   8e-31   Ailuropoda melanoleuca
gb|EHB18901.1|  CAAX prenyl protease 1-like protein                     128   8e-31   Heterocephalus glaber [naked mole rat]
ref|XP_007114324.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   8e-31   
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897                 128   8e-31   Rhizopus microsporus
ref|XP_004025583.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   8e-31   
ref|XP_009891312.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   8e-31   Charadrius vociferus
gb|KGL99640.1|  CAAX prenyl protease 1                                  128   8e-31   Charadrius vociferus
gb|EDP50136.1|  CaaX prenyl protease Ste24                              128   8e-31   Aspergillus fumigatus A1163
ref|XP_006737576.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   8e-31   Leptonychotes weddellii
gb|KEY76113.1|  CaaX prenyl protease Ste24                              128   8e-31   Aspergillus fumigatus var. RP-2014
gb|KFP02851.1|  CAAX prenyl protease 1                                  128   9e-31   Calypte anna
gb|ELK19500.1|  CAAX prenyl protease 1 like protein                     128   9e-31   Pteropus alecto
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079                 128   9e-31   Rhizopus microsporus
ref|XP_009917539.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   9e-31   Haliaeetus albicilla
ref|XP_004678903.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   9e-31   Condylura cristata
ref|XP_003891707.2|  PREDICTED: CAAX prenyl protease 1 homolog          128   9e-31   
ref|XP_008063694.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   9e-31   Carlito syrichta
ref|XP_005437030.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   9e-31   
ref|XP_005235139.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   9e-31   
ref|XP_005898693.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Bos mutus
ref|XP_752066.2|  CaaX prenyl protease Ste24                            128   1e-30   Aspergillus fumigatus Af293
ref|XP_007453816.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Lipotes vexillifer [baiji]
ref|NP_001288163.1|  zinc metallopeptidase STE24                        128   1e-30   Equus caballus [domestic horse]
ref|XP_009917537.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Haliaeetus albicilla
ref|XP_009466806.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Nipponia nippon
ref|XP_007977465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Chlorocebus sabaeus
ref|XP_002750699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Callithrix jacchus [common marmoset]
ref|XP_011376276.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Pteropus vampyrus
dbj|BAA33727.1|  Ste24p                                                 128   1e-30   Homo sapiens [man]
ref|XP_004450691.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Dasypus novemcinctus
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   1e-30   Ursus maritimus [white bear]
gb|AIC62085.1|  ZMPSTE24                                                128   1e-30   synthetic construct
ref|NP_005848.2|  CAAX prenyl protease 1 homolog                        128   1e-30   Homo sapiens [man]
ref|XP_003937059.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Saimiri boliviensis boliviensis
ref|XP_539577.3|  PREDICTED: CAAX prenyl protease 1 homolog             128   1e-30   Canis lupus familiaris [dogs]
ref|XP_010352519.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   Rhinopithecus roxellana
ref|XP_513352.2|  PREDICTED: CAAX prenyl protease 1 homolog             128   1e-30   Pan troglodytes
ref|XP_010017682.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Nestor notabilis
ref|XP_006904034.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    128   1e-30   
ref|XP_010411361.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_008494648.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Calypte anna
ref|XP_003273371.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   Nomascus leucogenys [White-cheeked Gibbon]
ref|NP_001244375.1|  CAAX prenyl protease 1 homolog                     128   1e-30   
ref|XP_009561758.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
pdb|4AW6|A  Chain A, Crystal Structure Of The Human Nuclear Membr...    128   1e-30   
ref|NP_001126457.1|  CAAX prenyl protease 1 homolog                     128   1e-30   
gb|AAH37283.1|  Zinc metallopeptidase (STE24 homolog, S. cerevisiae)    128   1e-30   
ref|XP_004371951.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_004851105.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   
ref|XP_006758037.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
gb|KFQ43267.1|  CAAX prenyl protease 1                                  127   1e-30   
gb|KFP94249.1|  CAAX prenyl protease 1                                  127   1e-30   
ref|XP_004266443.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
gb|ELR54320.1|  CAAX prenyl protease 1-like protein                     128   1e-30   
ref|XP_004316653.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_004910060.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_006098203.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_005868719.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_006215922.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|NP_766288.1|  CAAX prenyl protease 1 homolog                        128   1e-30   
gb|AAK38172.1|  Zmpste24                                                128   1e-30   
ref|XP_005317922.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
emb|CAD31792.1|  farnesylated-proteins converting enzyme-1              128   1e-30   
ref|XP_010861023.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   
ref|NP_001179857.1|  CAAX prenyl protease 1 homolog                     128   1e-30   
ref|XP_007164766.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|XP_004851106.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   1e-30   
ref|XP_006188105.1|  PREDICTED: CAAX prenyl protease 1 homolog          128   1e-30   
ref|NP_001087923.1|  zinc metallopeptidase STE24                        128   1e-30   
ref|NP_001101444.1|  CAAX prenyl protease 1 homolog                     128   1e-30   
ref|XP_005139561.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   1e-30   
ref|XP_010861024.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    128   1e-30   
ref|XP_005514212.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    128   1e-30   
ref|XP_003765468.1|  PREDICTED: CAAX prenyl protease 1 homolog          129   1e-30   
ref|XP_010574592.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   2e-30   
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    127   2e-30   
ref|XP_010574593.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   2e-30   
ref|XP_006503082.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   2e-30   
ref|XP_010995251.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    127   2e-30   
dbj|GAM40464.1|  zinc metalloprotease                                   127   2e-30   
gb|KFY59517.1|  hypothetical protein V496_05652                         127   2e-30   
ref|XP_003462326.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   2e-30   
ref|XP_001214622.1|  hypothetical protein ATEG_05444                    127   2e-30   
ref|XP_011121081.1|  hypothetical protein AOL_s00076g226                127   2e-30   
ref|XP_004001889.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   3e-30   
ref|XP_006061988.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   3e-30   
ref|XP_005970531.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   3e-30   
ref|XP_008589089.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   3e-30   
gb|ESS30154.1|  CAAX metallo endopeptidase                              122   3e-30   
gb|KFG61038.1|  CAAX metallo endopeptidase                              122   3e-30   
ref|XP_007754023.1|  STE24 endopeptidase                                127   3e-30   
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296              127   3e-30   
ref|XP_005410609.1|  PREDICTED: CAAX prenyl protease 1 homolog          127   4e-30   
ref|XP_008589087.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    127   4e-30   
ref|XP_006165004.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    127   4e-30   
ref|XP_002148969.1|  CaaX prenyl protease Ste24                         126   4e-30   
ref|XP_001271650.1|  CaaX prenyl protease Ste24                         126   4e-30   
gb|EEH10632.1|  CaaX prenyl protease                                    126   4e-30   
gb|EGC45621.1|  CaaX prenyl protease                                    126   4e-30   
gb|KIW82886.1|  hypothetical protein Z517_02129                         126   4e-30   
gb|EER44696.1|  CaaX prenyl protease                                    126   4e-30   
ref|XP_008724234.1|  hypothetical protein G647_10020                    126   5e-30   
ref|XP_004646026.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   5e-30   
pdb|2YPT|A  Chain A, Crystal Structure Of The Human Nuclear Membr...    126   5e-30   
ref|NP_001017255.1|  zinc metallopeptidase STE24                        126   6e-30   
ref|XP_002796885.1|  CAAX prenyl protease                               126   6e-30   
gb|AAX78522.1|  CaaX prenyl protease                                    126   6e-30   
ref|XP_004591591.1|  PREDICTED: CAAX prenyl protease 1 homolog          126   6e-30   
ref|XP_001267265.1|  CaaX prenyl protease Ste24                         126   7e-30   
ref|XP_006631345.1|  PREDICTED: CAAX prenyl protease 1 homolog          125   7e-30   
ref|XP_002181639.1|  predicted protein                                  125   7e-30   
ref|XP_010759714.1|  hypothetical protein PADG_04087                    125   7e-30   
ref|XP_007536149.1|  PREDICTED: CAAX prenyl protease 1 homolog          125   8e-30   
emb|CAK04159.1|  novel protein (zgc:55655)                              125   8e-30   
gb|KIX97886.1|  hypothetical protein Z520_06664                         125   8e-30   
gb|KIW71892.1|  hypothetical protein PV04_00120                         125   8e-30   
gb|KIW01377.1|  hypothetical protein PV09_07145                         125   8e-30   
emb|CEJ80463.1|  hypothetical protein VHEMI00644                        125   9e-30   
ref|XP_001540370.1|  CaaX prenyl protease                               125   1e-29   
tpg|DAA01789.1|  TPA: CaaX prenyl protease                              125   1e-29   
ref|XP_011115562.1|  hypothetical protein H072_10056                    125   1e-29   
ref|XP_007584901.1|  putative prenyl protease protein                   125   1e-29   
ref|XP_004082296.1|  PREDICTED: CAAX prenyl protease 1 homolog          125   1e-29   
ref|XP_003850777.1|  CAAX prenyl protease 1                             125   1e-29   
ref|XP_009028164.1|  hypothetical protein HELRODRAFT_193946             128   1e-29   
gb|KFX89268.1|  hypothetical protein V490_07139                         125   1e-29   
ref|XP_009152612.1|  STE24 endopeptidase                                125   1e-29   
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                      125   1e-29   
gb|ELR10214.1|  STE24 endopeptidase                                     125   1e-29   
emb|CDH48818.1|  prenyl protease                                        125   2e-29   
ref|XP_001949388.2|  PREDICTED: CAAX prenyl protease 1 homolog          124   2e-29   
ref|XP_003880033.1|  putative peptidase family M48 domain-contain...    124   2e-29   
gb|AFI71084.1|  putative CAAX prenyl protease                           119   2e-29   
gb|KFZ20107.1|  hypothetical protein V502_03363                         124   2e-29   
ref|XP_002174544.2|  CAA Xprenyl protease                               124   2e-29   
ref|XP_010733223.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   2e-29   
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                   124   2e-29   
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759              124   2e-29   
pdb|4IL3|A  Chain A, Crystal Structure Of S. Mikatae Ste24p             124   2e-29   
gb|KFY04966.1|  hypothetical protein V491_09229                         126   2e-29   
gb|EJT41596.1|  STE24-like protein                                      124   2e-29   
gb|EHN01607.1|  Ste24p                                                  124   2e-29   
gb|KFY38041.1|  hypothetical protein V494_04536                         124   2e-29   
ref|XP_008861314.1|  hypothetical protein H310_00342                    124   3e-29   
ref|XP_002627156.1|  CaaX prenyl protease                               124   3e-29   
ref|NP_956186.1|  CAAX prenyl protease 1 homolog                        124   3e-29   
ref|XP_010877922.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   3e-29   
gb|AAI65348.1|  Zmpste24 protein                                        124   3e-29   
gb|KIX06592.1|  hypothetical protein Z518_04568                         124   3e-29   
emb|CEP19164.1|  hypothetical protein                                   124   3e-29   
gb|AJR68004.1|  Ste24p                                                  124   3e-29   
gb|AJR60934.1|  Ste24p                                                  124   4e-29   
ref|XP_010788908.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   4e-29   
ref|XP_002842311.1|  hypothetical protein                               124   4e-29   
ref|XP_007751798.1|  STE24 endopeptidase                                124   4e-29   
gb|KIW94481.1|  hypothetical protein Z519_04457                         124   4e-29   
ref|XP_003453270.1|  PREDICTED: CAAX prenyl protease 1 homolog          124   4e-29   
gb|EDN63433.1|  zinc metalloprotease                                    124   4e-29   
dbj|GAN04268.1|  metallopeptidase                                       123   4e-29   
gb|AJR63874.1|  Ste24p                                                  124   4e-29   
gb|AJR67380.1|  Ste24p                                                  124   4e-29   
gb|AJR61585.1|  Ste24p                                                  124   4e-29   
gb|AJR59949.1|  Ste24p                                                  124   4e-29   
gb|EDZ71132.1|  YJR117Wp-like protein                                   123   4e-29   
gb|EDV12854.1|  CAAX prenyl protease 1                                  123   4e-29   
gb|AJR60606.1|  Ste24p                                                  123   4e-29   
gb|AJR63219.1|  Ste24p                                                  123   4e-29   
gb|EWG95205.1|  Ste24p                                                  123   4e-29   
ref|XP_009222333.1|  CAAX prenyl protease 1                             123   4e-29   
ref|NP_012651.1|  Ste24p                                                123   4e-29   
ref|XP_006798596.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   4e-29   
ref|XP_004540520.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   4e-29   
gb|EHN06284.1|  Ste24p                                                  123   4e-29   
gb|KIW26412.1|  hypothetical protein PV07_09509                         123   5e-29   
ref|XP_005925764.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   5e-29   
emb|CAY80831.1|  Ste24p                                                 123   5e-29   
ref|XP_002492040.1|  Highly conserved zinc metalloprotease              123   5e-29   
gb|AFI71082.1|  putative CAAX prenyl protease                           118   5e-29   
gb|KIV94338.1|  hypothetical protein PV10_02112                         123   5e-29   
gb|AJR62890.1|  Ste24p                                                  123   5e-29   
ref|XP_002843395.1|  CAAX prenyl protease 1                             123   6e-29   
ref|XP_008283596.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   6e-29   
gb|EYE94778.1|  CaaX prenyl protease Ste24                              123   6e-29   
ref|XP_011104176.1|  ste24p                                             123   6e-29   
ref|XP_007244663.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   6e-29   
gb|KFZ02509.1|  hypothetical protein V501_09542                         125   6e-29   
ref|XP_006008854.1|  PREDICTED: CAAX prenyl protease 1 homolog          123   6e-29   
emb|CDK25391.1|  unnamed protein product                                123   7e-29   
gb|EGD96703.1|  CaaX prenyl protease                                    123   7e-29   
gb|EGE06070.1|  CAAX prenyl protease                                    123   7e-29   
ref|XP_002584079.1|  hypothetical protein UREG_04768                    123   8e-29   
ref|XP_003236858.1|  CaaX prenyl protease                               122   8e-29   
gb|KFY09356.1|  hypothetical protein V492_05514                         125   8e-29   
gb|EWG42807.1|  STE24 endopeptidase                                     122   9e-29   
gb|KFY76197.1|  hypothetical protein V499_04041                         124   1e-28   
ref|XP_007787411.1|  hypothetical protein EPUS_00192                    122   1e-28   
ref|XP_002369947.1|  peptidase family M48 domain-containing protein     122   1e-28   
ref|XP_007780353.1|  STE24 endopeptidase                                122   1e-28   
ref|XP_007834407.1|  hypothetical protein PFICI_07635                   122   1e-28   
ref|XP_001401563.1|  CAAX prenyl protease 1                             122   1e-28   
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946                 122   1e-28   
gb|AJR71904.1|  Ste24p                                                  122   1e-28   
emb|CAG10466.1|  unnamed protein product                                122   1e-28   
emb|CDF87226.1|  BN860_01640g1_1                                        122   1e-28   
ref|XP_002553545.1|  KLTH0E01298p                                       122   1e-28   
emb|CDH09260.1|  probable CAAX prenyl protease 1                        122   1e-28   
emb|CDH15706.1|  probable CAAX prenyl protease 1                        122   1e-28   
ref|XP_003023010.1|  hypothetical protein TRV_02831                     123   1e-28   
ref|XP_007376706.1|  hypothetical protein SPAPADRAFT_62544              122   1e-28   
ref|XP_008886307.1|  CAAX metallo endopeptidase                         122   1e-28   
ref|NP_001133548.1|  CAAX prenyl protease 1 homolog                     122   2e-28   
ref|XP_460632.1|  DEHA2F06248p                                          122   2e-28   
gb|KIV77520.1|  hypothetical protein PV11_09310                         122   2e-28   
gb|EFZ21267.1|  hypothetical protein SINV_07351                         121   2e-28   
ref|XP_003815473.1|  PREDICTED: CAAX prenyl protease 1 homolog          122   2e-28   
ref|XP_003709694.1|  CAAX prenyl protease 1                             121   2e-28   
gb|KHJ35024.1|  putative peptidase family m48                           121   2e-28   
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                  121   2e-28   
ref|XP_453545.1|  hypothetical protein                                  121   2e-28   
ref|XP_011175799.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   2e-28   
gb|AJR64199.1|  Ste24p                                                  121   2e-28   
ref|XP_008307531.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   2e-28   
emb|CDQ71667.1|  unnamed protein product                                121   3e-28   
dbj|GAA95272.1|  hypothetical protein E5Q_01928                         121   3e-28   
ref|XP_003962545.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   3e-28   
gb|KFY87676.1|  hypothetical protein V500_06835                         123   3e-28   
gb|EMT68098.1|  CAAX prenyl protease 1                                  121   3e-28   
gb|ELQ35873.1|  CAAX prenyl protease 1                                  121   3e-28   
ref|XP_001939034.1|  CaaX prenyl protease                               121   3e-28   
ref|XP_007720431.1|  STE24 endopeptidase                                121   3e-28   
ref|XP_008398126.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   3e-28   
ref|XP_008611054.1|  hypothetical protein SDRG_07015                    121   3e-28   
gb|EXM07215.1|  STE24 endopeptidase                                     121   3e-28   
gb|KEQ90314.1|  hypothetical protein AUEXF2481DRAFT_9558                121   3e-28   
ref|XP_007574196.1|  PREDICTED: CAAX prenyl protease 1 homolog          121   4e-28   
gb|EPE10297.1|  caax prenyl protease 1                                  121   4e-28   
gb|EWZ02551.1|  STE24 endopeptidase                                     121   4e-28   
gb|ENH68811.1|  CAAX prenyl protease 1                                  120   4e-28   
ref|XP_003677696.1|  hypothetical protein NCAS_0H00350                  121   4e-28   
emb|CDO93753.1|  unnamed protein product                                120   4e-28   
gb|EXL53967.1|  STE24 endopeptidase                                     120   4e-28   
gb|EGU84979.1|  hypothetical protein FOXB_04560                         120   4e-28   
ref|XP_005801358.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   4e-28   
ref|XP_001239931.1|  hypothetical protein CIMG_09552                    120   4e-28   
emb|CCT67513.1|  probable zinc metallo-protease                         120   4e-28   
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154     120   5e-28   
ref|XP_003300873.1|  hypothetical protein PTT_12236                     120   5e-28   
gb|KEY67837.1|  hypothetical protein S7711_04975                        120   5e-28   
dbj|GAA82676.1|  CaaX prenyl protease Ste24                             120   5e-28   
gb|KFA62896.1|  hypothetical protein S40285_02256                       120   5e-28   
gb|KEQ83545.1|  CAAX prenyl protease 1                                  120   5e-28   
ref|XP_011415720.1|  PREDICTED: CAAX prenyl protease 1 homolog          120   6e-28   
ref|XP_003067440.1|  CAAX prenyl protease, putative                     120   6e-28   
ref|XP_003349500.1|  hypothetical protein SMAC_03088                    120   6e-28   
gb|KDB15160.1|  putative zinc metallo-protease                          120   6e-28   
gb|EIE81350.1|  hypothetical protein RO3G_06055                         120   6e-28   
emb|CCE28602.1|  probable zinc metallo-protease                         120   6e-28   
emb|CCG83629.1|  CaaX prenyl protease Ste24                             120   6e-28   
ref|XP_007737162.1|  STE24 endopeptidase                                120   6e-28   
ref|XP_002427421.1|  caax prenyl protease ste24, putative               120   6e-28   
gb|KIL91310.1|  hypothetical protein FAVG1_04924                        120   7e-28   
gb|KDO33073.1|  hypothetical protein SPRG_01888                         120   7e-28   
emb|CCC09083.1|  unnamed protein product                                120   8e-28   



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDEPDKKTD
Sbjct  405  SHPPLVERLAAIDEPDKKTD  424



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   282 bits (722),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR FEFQADAFAKKLGYA PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRTFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDEP+KKTD
Sbjct  405  SHPPLVERLAAIDEPEKKTD  424



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQEENLS+MNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQEENLSSMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKKT+
Sbjct  405  SHPPLVERLAAIDESDKKTE  424



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY+L LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYSLALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DEPDKK D
Sbjct  405  SHPPLVERLAALDEPDKKAD  424



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA PLRAGLVKLQEENLSAMNTD WYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAPLRAGLVKLQEENLSAMNTDHWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKKT+
Sbjct  405  SHPPLVERLAAIDESDKKTE  424



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLI+FQHTV+
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLILFQHTVM  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSRAFEFQADAFAKKLGYA PLRAGL+KLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFSLNLVSRAFEFQADAFAKKLGYATPLRAGLIKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKKTD
Sbjct  405  SHPPLVERLAAIDEADKKTD  424



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSGDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DEPDKK D
Sbjct  405  SHPPLVERLAALDEPDKKED  424



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  264  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  323

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  324  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHY  383

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AIDE DKKTD
Sbjct  384  SHPPLVERLTAIDEHDKKTD  403



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AIDE DKKTD
Sbjct  405  SHPPLVERLTAIDEIDKKTD  424



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSF+AVQILTFLQFGGYTLVRNS DLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFVAVQILTFLQFGGYTLVRNSTDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DEPDKK D
Sbjct  405  SHPPLVERLAALDEPDKKED  424



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AIDE DKKTD
Sbjct  405  SHPPLVERLTAIDEHDKKTD  424



>gb|EPS68077.1| hypothetical protein M569_06696, partial [Genlisea aurea]
Length=177

 Score =   268 bits (685),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 135/142 (95%), Gaps = 2/142 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS+DLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  36   ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSRDLFQSFGFDTQPVLIGLIIFQHTVI  95

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSRAFEFQADAFAKKLGY  PLRAGL+KLQEENLSAMNTDPWYSAYHY
Sbjct  96   PLQHLVSFSLNLVSRAFEFQADAFAKKLGYGGPLRAGLIKLQEENLSAMNTDPWYSAYHY  155

Query  379  SHPPLVERLAAIDEP--DKKTD  320
            SHPPLVERLAAID+   DKK +
Sbjct  156  SHPPLVERLAAIDDDAHDKKRE  177



>gb|KDO86286.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=309

 Score =   272 bits (695),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  170  ELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  229

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  230  PIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  289

Query  379  SHPPLVERLAAIDEPDKK  326
            SHPPLVERLAAIDEPDKK
Sbjct  290  SHPPLVERLAAIDEPDKK  307



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   275 bits (703),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYATALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA++EPD+K +
Sbjct  405  SHPPLVERLAALEEPDRKKE  424



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   274 bits (700),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFESFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA++EPD+K +
Sbjct  405  SHPPLVERLAALEEPDRKKE  424



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGY   LRAGLVKLQEENLS+MNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYGSALRAGLVKLQEENLSSMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKK D
Sbjct  405  SHPPLVERLAAIDEADKKAD  424



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTM+SFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLI+FQHTVI
Sbjct  285  ELGHWKLNHTMFSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLILFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSRAFEFQADAFAKKLGY  PLRAGL+KLQEENLSAMNTD WYSAYHY
Sbjct  345  PLQHLVSFLLNLVSRAFEFQADAFAKKLGYGAPLRAGLIKLQEENLSAMNTDHWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDEPDKKTD
Sbjct  405  SHPPLVERLAAIDEPDKKTD  424



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKK  326
            SHPPLVERLAAIDEPDKK
Sbjct  405  SHPPLVERLAAIDEPDKK  422



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLF+SFGF+TQP+LIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFESFGFDTQPILIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLV+FGLNLVSR FEFQADAFAKKLGYA  LRAGL+KLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVNFGLNLVSRTFEFQADAFAKKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAI+EPD K +
Sbjct  405  SHPPLVERLAAIEEPDSKKE  424



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  324  ELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  383

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  384  PIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  443

Query  379  SHPPLVERLAAIDEPDKK  326
            SHPPLVERLAAIDEPDKK
Sbjct  444  SHPPLVERLAAIDEPDKK  461



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR GLVKLQEENLS+MNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKK D
Sbjct  405  SHPPLVERLAAIDESDKKAD  424



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A++EP  K +
Sbjct  405  SHPPLVERLTALEEPGSKKE  424



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR GLVKLQEENLS+MNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRGGLVKLQEENLSSMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE DKK D
Sbjct  405  SHPPLVERLAAIDESDKKAD  424



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT LQFGGYTLVRNSKDLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTLLQFGGYTLVRNSKDLFQSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYAAALRSGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA++EP  K +
Sbjct  405  SHPPLVERLAALEEPGSKKE  424



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF+TQPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGFDTQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFALNLVSRSFEFQADAFAKKLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID+PDKK D
Sbjct  405  SHPPLVERLDAIDKPDKKAD  424



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LTFLQFGGYTLVRNSKDLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQVLTFLQFGGYTLVRNSKDLFESFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P QHLVSFGLNLVSR+FEFQADAFAKKLG A PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PFQHLVSFGLNLVSRSFEFQADAFAKKLGLAKPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DE +KK +
Sbjct  405  SHPPLVERLAALDESNKKEE  424



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  272  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFKSFGFDTQPVLIGLIIFQHTVI  331

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  332  PLQHLVSFALNLVSRSFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHY  391

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID+ DKK D
Sbjct  392  SHPPLVERLAAIDKSDKKED  411



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF+TQPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGFDTQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QH+VSF LNLVSR+FEFQADAFAKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHIVSFALNLVSRSFEFQADAFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID+PDKK D
Sbjct  405  SHPPLVERLAAIDKPDKKAD  424



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS +LF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  297  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSNLFRSFGFDTQPVLIGLIIFQHTVI  356

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LR  LVKLQEENLSAMNTDPWYSAYHY
Sbjct  357  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYTSSLRVALVKLQEENLSAMNTDPWYSAYHY  416

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DEPDKK D
Sbjct  417  SHPPLVERLAALDEPDKKAD  436



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  284  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFKSFGFDTQPVLIGLIIFQHTVI  343

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  344  PLQHLVSFALNLVSRSFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHY  403

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID+ DKK D
Sbjct  404  SHPPLVERLAAIDKSDKKED  423



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID  DKK +
Sbjct  405  SHPPLVERLAAIDAADKKEE  424



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID  DKK +
Sbjct  405  SHPPLVERLAAIDAADKKEE  424



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 133/138 (96%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSFIAVQI+TFLQFGGYTLVRNSKDLF SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTLYSFIAVQIITFLQFGGYTLVRNSKDLFLSFGFKTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFAKKLGY+ PLRA L+KLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYSTPLRAALIKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKK  326
            SHPPLVERLAA+D  DKK
Sbjct  405  SHPPLVERLAALDTADKK  422



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS  LFQSFGF+TQPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGFDTQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLV+F LNLVSR+FEFQADAFAK+LGYA  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVNFALNLVSRSFEFQADAFAKRLGYASALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID+PDKK D
Sbjct  405  SHPPLVERLDAIDKPDKKAD  424



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIA+QILTFLQFGGYTLVRNSKDLF+SFGF++QP+LIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAIQILTFLQFGGYTLVRNSKDLFESFGFDSQPILIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLV+FGLNLVSRAFEFQADAFAKKLGYA  LRAGL+KLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVNFGLNLVSRAFEFQADAFAKKLGYAKALRAGLIKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+AI+E D K +
Sbjct  405  SHPPLVERLSAIEEADSKKE  424



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 135/151 (89%), Gaps = 11/151 (7%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKL-----------QEENLSAM  413
            P+QHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKL           QEENLSAM
Sbjct  345  PIQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQVTELEFSPLFQEENLSAM  404

Query  412  NTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
            NTDPWYSAYHYSHPPLVERLAAIDEPDKK D
Sbjct  405  NTDPWYSAYHYSHPPLVERLAAIDEPDKKED  435



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILT +QFGGYTLVRNS  LFQSFGF+TQPV+IGLIIFQHT+I
Sbjct  287  ELGHWKLNHTMYSFIAVQILTLMQFGGYTLVRNSSSLFQSFGFDTQPVIIGLIIFQHTII  346

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHLVSF LNLVSRAFEFQADAFAK LGYA  LRAGLV+LQEENLSAMNTDPWYSAYHY
Sbjct  347  PVQHLVSFALNLVSRAFEFQADAFAKALGYAASLRAGLVRLQEENLSAMNTDPWYSAYHY  406

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAIDE  KKTD
Sbjct  407  SHPPLVERLAAIDEETKKTD  426



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSFIAVQILTFLQFGGYTLVRNS  LFQSFGF+TQPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTLYSFIAVQILTFLQFGGYTLVRNSSSLFQSFGFDTQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QH+VSF LNLVSR+FEFQADAFAKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHIVSFALNLVSRSFEFQADAFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID+P KK D
Sbjct  405  SHPPLVERLAAIDKPXKKAD  424



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIALQILTLLQFGGYTLVRNSSDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D  DKK +
Sbjct  405  SHPPLVERLAALDLADKKEE  424



>gb|ADE76166.1| unknown [Picea sitchensis]
Length=228

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSF+A+Q+LT LQFGGYTLVRNSKDLF+SFGF+TQPVL+GL+IFQHT++
Sbjct  89   ELGHWKLNHTMYSFVAMQVLTLLQFGGYTLVRNSKDLFESFGFQTQPVLVGLLIFQHTIM  148

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+ HLVSF LNLVSRAFEFQAD FAK LGY  PLRAGL+KLQEENLS MNTDPWYSAYHY
Sbjct  149  PIHHLVSFALNLVSRAFEFQADGFAKNLGYGAPLRAGLIKLQEENLSTMNTDPWYSAYHY  208

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D  DKK +
Sbjct  209  SHPPLVERLAALDRSDKKEE  228



>gb|AFK35300.1| unknown [Lotus japonicus]
Length=229

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+QILT LQFGG+TLVRNS DLFQSFGF+TQPVLIGLI+FQHTVI
Sbjct  90   ELGHWKLNHTVYTFVAMQILTLLQFGGFTLVRNSTDLFQSFGFDTQPVLIGLILFQHTVI  149

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQADAFAK LGYA  LR GLV+LQEENLSAMNTDPWYSAYHY
Sbjct  150  PLQQLVSFGLNLVSRSFEFQADAFAKNLGYAAELRLGLVRLQEENLSAMNTDPWYSAYHY  209

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID+ DKK D
Sbjct  210  SHPPLVERLEAIDKSDKKAD  229



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF TQPVLIGLI+FQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAIQILTLLQFGGYTLVRNSSDLFRSFGFNTQPVLIGLILFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D  DKK +
Sbjct  405  SHPPLVERLAALDLADKKEE  424



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIA+QILT LQFGGYTLVRNS DLF+SFGF TQPVLIGLI+FQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAIQILTLLQFGGYTLVRNSSDLFRSFGFNTQPVLIGLILFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSF LNLVSR+FEFQADAFA+KLGY+ PLRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFALNLVSRSFEFQADAFAQKLGYSAPLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D  DKK +
Sbjct  405  SHPPLVERLAALDLADKKEE  424



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLYRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+DEPDKK D
Sbjct  405  SHPPLVERLAALDEPDKKED  424



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DLF+SFGF+T+PVLIGLI+FQHTVI
Sbjct  285  ELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLFRSFGFDTEPVLIGLILFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQADAFAKKLGYA  LR+GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQQLVSFGLNLVSRSFEFQADAFAKKLGYASELRSGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLA +DEPDKK D
Sbjct  405  SHPPLVERLAVLDEPDKKND  424



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 132/141 (94%), Gaps = 1/141 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFE-TQPVLIGLIIFQHTV  563
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLF+SFGF  TQPVLIGLIIFQHTV
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFESFGFHGTQPVLIGLIIFQHTV  344

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
            IPLQHLV+F LNLVSR+FEFQADAFAK LGYA  L+ GLVKLQEENLSAMNTDPWYSAYH
Sbjct  345  IPLQHLVNFALNLVSRSFEFQADAFAKNLGYASELKCGLVKLQEENLSAMNTDPWYSAYH  404

Query  382  YSHPPLVERLAAIDEPDKKTD  320
            YSHPPLVERLAA+DE DKK D
Sbjct  405  YSHPPLVERLAALDETDKKQD  425



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   261 bits (666),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+FIA+QILT LQFGGYTLVRNS DLFQSFGF+TQPVLIGLIIFQHTVI
Sbjct  291  ELGHWKLNHTLYTFIAMQILTLLQFGGYTLVRNSTDLFQSFGFDTQPVLIGLIIFQHTVI  350

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+Q LVSFGLNLVSR+FEFQAD FAKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  351  PVQQLVSFGLNLVSRSFEFQADGFAKKLGYSSALRAGLVKLQEENLSAMNTDPWYSAYHY  410

Query  379  SHPPLVERLAAIDEPDK--KTD  320
            SHPPLVERLAA+DEPDK  K+D
Sbjct  411  SHPPLVERLAALDEPDKLDKSD  432



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSTDLYRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D+PDKK D
Sbjct  405  SHPPLVERLAALDKPDKKED  424



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   259 bits (663),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+QILT LQFGGYTLVRNS DL++SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTVYTFVAMQILTLLQFGGYTLVRNSADLYRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLA +DEPDKK D
Sbjct  405  SHPPLVERLAVLDEPDKKED  424



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/139 (89%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIA+QIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAMQILAFLQFGGYTLVRNSSDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSR+FEFQADAFA KLGY+  LR  LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAVKLGYSQDLRNALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKT  323
            SHPPLVERL AID  DKKT
Sbjct  405  SHPPLVERLEAIDGEDKKT  423



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+FIA+QILT LQFGGYTLVRNS DLFQSFGF+TQPVLIGLI+FQHTVI
Sbjct  285  ELGHWKLNHTVYTFIAMQILTLLQFGGYTLVRNSTDLFQSFGFDTQPVLIGLILFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQAD FAKKLGY+  LRAGLVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQQLVSFGLNLVSRSFEFQADGFAKKLGYSSSLRAGLVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDK  329
            SHPPLVERLAA+D PDK
Sbjct  405  SHPPLVERLAALDIPDK  421



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGQDKKTD  424



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGQDKKTD  424



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQILT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGQDKKTD  424



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFSSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YS YHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSTYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  +KKTD
Sbjct  405  SHPPLVERLRAIDGDEKKTD  424



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGQDKKTD  424



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP +SAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLHSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGEDKKTD  424



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL F QFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFCQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGLDKKTD  424



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   254 bits (648),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  405  SHPPLVERLRAIDGQDKKTD  424



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSF+AVQ+L FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFVAVQVLAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+Q LVSF LNLVSR+FEFQADAFA KL YA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PVQRLVSFCLNLVSRSFEFQADAFAVKLDYAKDLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAID  D KTD
Sbjct  405  SHPPLVERLAAIDGLDPKTD  424



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   254 bits (650),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  355  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  414

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVKLQEENLSAMNTDP YSAYHY
Sbjct  415  PLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQEENLSAMNTDPLYSAYHY  474

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL AID  DKKTD
Sbjct  475  SHPPLVERLRAIDGQDKKTD  494



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKL+HT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGFE QPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLSHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+A+++PD K +
Sbjct  405  SHPPLVERLSALEDPDSKKE  424



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGFE QPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+A+++ D K +
Sbjct  405  SHPPLVERLSALEDADSKKE  424



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGFE QPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+A+++ D K +
Sbjct  405  SHPPLVERLSALEDADSKKE  424



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSFIAVQ+L FLQFGGYTLVRNSKDLF+SFGFE QP++IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTVYSFIAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPIIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PLQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+++ D K +
Sbjct  405  SHPPLVERLQALEDSDSKKE  424



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVRNSKDLF+SFGFE QP++IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRNSKDLFESFGFEDQPIIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+++ D K +
Sbjct  405  SHPPLVERLQALEDSDSKKE  424



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSF+AVQ+LTF+QFGGYTLVRNSKDLF+SFGFE QPV+IGLIIF HT+I
Sbjct  285  ELGHWKLNHTAYSFVAVQLLTFMQFGGYTLVRNSKDLFESFGFEDQPVIIGLIIFMHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LR  LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+A+++ D K +
Sbjct  405  SHPPLVERLSALEDLDSKKE  424



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSF+AVQ+LTFLQFGGYTLVRNSKDLF+SFGFE Q V+IGLIIF HT+I
Sbjct  285  ELGHWKLNHTAYSFVAVQLLTFLQFGGYTLVRNSKDLFESFGFEDQSVIIGLIIFMHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PVQHLLSFCLNLVSRAFEFQADAFAKNLGYAPELRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKK  326
            SHPPLVERL+AI++ D K
Sbjct  405  SHPPLVERLSAIEDLDSK  422



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKL+HTMYSF+A+Q+LT LQFGGYTLVRNS  LF SFGF TQPVLIGLI+FQHT++
Sbjct  289  ELGHWKLSHTMYSFLAMQVLTLLQFGGYTLVRNSSGLFLSFGFSTQPVLIGLILFQHTIM  348

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P  HLVSF LNL+SRAFEFQADAFA+ LGY  PLRAGL+KLQEENLSAMNTDPWYSAYH+
Sbjct  349  PFHHLVSFALNLLSRAFEFQADAFARSLGYREPLRAGLIKLQEENLSAMNTDPWYSAYHH  408

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+DE  KKTD
Sbjct  409  SHPPLVERLQALDETSKKTD  428



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVR+SKDLF SFGF+ QPV+IGLIIFQHT+I
Sbjct  285  ELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRSSKDLFGSFGFKDQPVIIGLIIFQHTII  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+++ D K +
Sbjct  405  SHPPLVERLQALEDSDSKKE  424



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKL+HTMYSF+A+Q+LT LQFGGYTLVRNS DLF SFGF TQPVLIGLI+FQHT++
Sbjct  289  ELGHWKLSHTMYSFLAMQVLTLLQFGGYTLVRNSTDLFLSFGFTTQPVLIGLILFQHTIM  348

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P  HLVSF LNLVSRAFEFQADAFA+ LGY   LRAGL+KLQEENLSAMNTDPWYSAYHY
Sbjct  349  PFHHLVSFALNLVSRAFEFQADAFARSLGYKDSLRAGLIKLQEENLSAMNTDPWYSAYHY  408

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+DE  KK +
Sbjct  409  SHPPLVERLQALDEASKKEE  428



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNH +YSF+AVQ+L FLQFGGYTLVRNSKDLFQSFGFE QP++ GLIIFQHT I
Sbjct  285  ELGHWKLNHIVYSFVAVQLLMFLQFGGYTLVRNSKDLFQSFGFEDQPIITGLIIFQHTRI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKL EENLSAMNTDPWYSAYHY
Sbjct  345  PIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLHEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+++ D K +
Sbjct  405  SHPPLVERLQALEDSDAKKN  424



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+YSF+AVQ+L FLQFGGYTLVR+SKDLF SFGF+ QPV+IGLIIFQHT+I
Sbjct  488  ELGHWKLNHTVYSFVAVQLLMFLQFGGYTLVRSSKDLFGSFGFKDQPVIIGLIIFQHTII  547

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKLQEENLSAMNTDPWYSAYHY
Sbjct  548  PIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLQEENLSAMNTDPWYSAYHY  607

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL A+++ D K +
Sbjct  608  SHPPLVERLQALEDSDSKKE  627



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 128/168 (76%), Gaps = 28/168 (17%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  292  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  351

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK--------------------  440
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVK                    
Sbjct  352  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQVREDNNRTQTVTSICVTH  411

Query  439  --------LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
                    LQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  412  LNGFFVGILQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  459



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 127/171 (74%), Gaps = 31/171 (18%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQIL FLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTTYSFIAVQILAFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVK--------------------  440
            PLQHLVSFGLNLVSRAFEFQADAFA  LGYA  LR  LVK                    
Sbjct  345  PLQHLVSFGLNLVSRAFEFQADAFAVNLGYAKDLRPALVKLQVRETAEIKTQTVYTRVVP  404

Query  439  -----------LQEENLSAMNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
                       LQEENLSAMNTDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  405  CHNGCCFCCGFLQEENLSAMNTDPLYSAYHYSHPPLVERLRAIDGEDKKTD  455



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            E+GHWKLNHTMY FIAVQIL+FLQFGGYTLVRNS DLF+SFGF+TQPVL+GLII+Q+ +I
Sbjct  284  EMGHWKLNHTMYFFIAVQILSFLQFGGYTLVRNSSDLFRSFGFDTQPVLVGLIIYQYIMI  343

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QHL+  GLN VSR+FE+QADAF+KKLGY  PLR+GLVKLQ ENL AMNTDPW+SAYH+
Sbjct  344  PVQHLLFLGLNRVSRSFEYQADAFSKKLGYCSPLRSGLVKLQVENLEAMNTDPWFSAYHH  403

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHP LVERLA ++EPDKK D
Sbjct  404  SHPCLVERLAELNEPDKKED  423



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNH++Y FI+ QI T L FGGY L+RNS  LFQSFGF+TQPV+IGLIIFQ+T+ 
Sbjct  285  ELGHWKLNHSVYLFISRQIRTLLHFGGYALLRNSSSLFQSFGFDTQPVIIGLIIFQYTIT  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+Q+LV+F  NLVSRAFEFQADAFAKKLGYA  LRA LV+LQEENLSAMNTDPWYSAYHY
Sbjct  345  PIQYLVNFARNLVSRAFEFQADAFAKKLGYASSLRASLVRLQEENLSAMNTDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAAI E DKK D
Sbjct  405  SHPPLVERLAAIGETDKKAD  424



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 12/152 (8%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTL------------VRNSKDLFQSFGFETQPV  596
            ELGHWKLNH +YSF+AVQ+L FLQFGGYTL            VRNSKDLFQSFGFE QP+
Sbjct  285  ELGHWKLNHIVYSFVAVQLLMFLQFGGYTLLLMFLQFGGYTLVRNSKDLFQSFGFEDQPI  344

Query  595  LIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSA  416
            + GLIIFQHT IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKL EENLSA
Sbjct  345  ITGLIIFQHTRIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLHEENLSA  404

Query  415  MNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
            MNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  405  MNTDPWYSAYHYSHPPLVERLQALEDSDAKKN  436



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 12/152 (8%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTL------------VRNSKDLFQSFGFETQPV  596
            ELGHWKLNH +YSF+AVQ+L FLQFGGYTL            VRNSKDLFQSFGFE QP+
Sbjct  273  ELGHWKLNHIVYSFVAVQLLMFLQFGGYTLLLMFLQFGGYTLVRNSKDLFQSFGFEDQPI  332

Query  595  LIGLIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSA  416
            + GLIIFQHT IP+QHL+SF LNLVSRAFEFQADAFAK LGYA  LRA LVKL EENLSA
Sbjct  333  ITGLIIFQHTRIPIQHLLSFCLNLVSRAFEFQADAFAKNLGYAPQLRAALVKLHEENLSA  392

Query  415  MNTDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
            MNTDPWYSAYHYSHPPLVERL A+++ D K +
Sbjct  393  MNTDPWYSAYHYSHPPLVERLQALEDSDAKKN  424



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIA Q LT LQ  GYT VRNSKDLF SFGF TQPVLIGL +FQHT+ 
Sbjct  285  ELGHWKLNHTTYSFIAGQFLTLLQCVGYTFVRNSKDLFHSFGFTTQPVLIGLQLFQHTLT  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PL H+  F +NLVSRAFEFQAD FA +LGYALPLR GL+KLQEENLSAMNTDPWYS YHY
Sbjct  345  PLLHVAGFVMNLVSRAFEFQADNFAGELGYALPLRGGLIKLQEENLSAMNTDPWYSTYHY  404

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLAA+D+  KKT+
Sbjct  405  SHPPLVERLAALDKFQKKTE  424



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSF+AVQ+LTFLQFGGYTLVRNSKDLF+SFGF+ QPV+IGLIIF HT+I
Sbjct  284  ELGHWKLNHTTYSFVAVQLLTFLQFGGYTLVRNSKDLFESFGFDDQPVIIGLIIFMHTII  343

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+QH++SF LNLVSRAFEFQADAFAK LGYA  LR  LVKLQEEN  AMNTDP YSAYH+
Sbjct  344  PVQHVLSFCLNLVSRAFEFQADAFAKNLGYAPELRGALVKLQEENSFAMNTDPGYSAYHF  403

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVE   A+++ D K +
Sbjct  404  SHPPLVEGFFALEDLDTKKE  423



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWK NH +YS IA QI   L  GGYTLVR+   LFQSFGF T+P++I LIIFQ+ + 
Sbjct  285  ELGHWKRNHIVYSLIANQICALLYIGGYTLVRHWSSLFQSFGFHTRPLIIALIIFQYAIT  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P+Q+LV F  NLVSRAFE+QADAFAKKLGYA  +RA LV+LQEENL+AMN DPWYSAYHY
Sbjct  345  PIQNLVYFAGNLVSRAFEYQADAFAKKLGYASSIRASLVRLQEENLAAMNIDPWYSAYHY  404

Query  379  SHPPLVERLAAIDEPDKK  326
            +HP LVERLAAI + DK+
Sbjct  405  THPTLVERLAAIGKMDKE  422



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 105/140 (75%), Gaps = 24/140 (17%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSF+AVQ+LTF+QFGGYTLVRNSKDLF+SFGFE QPV+IGLII      
Sbjct  239  ELGHWKLNHTAYSFVAVQVLTFMQFGGYTLVRNSKDLFESFGFEDQPVIIGLII------  292

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
                              F ADAFAK LGYA  LR  LVKLQEENLSAMNTDPWYSAYHY
Sbjct  293  ------------------FMADAFAKNLGYAPELRGALVKLQEENLSAMNTDPWYSAYHY  334

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERL+A+++ D K D
Sbjct  335  SHPPLVERLSALEDLDSKKD  354



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQE  431
            PLQHLVSFGLNLVSR+FEFQADAFAKKLGY   LRAGLVKLQ+
Sbjct  345  PLQHLVSFGLNLVSRSFEFQADAFAKKLGYGSALRAGLVKLQK  387



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEEN  425
            P+QHLVSFGLNLVSR+FEFQADAFAKKLGYA  LRAGLVKLQ  N
Sbjct  345  PIQHLVSFGLNLVSRSFEFQADAFAKKLGYASALRAGLVKLQVIN  389



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 95/140 (68%), Gaps = 38/140 (27%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT+Y+F+A+Q                                      HTVI
Sbjct  274  ELGHWKLNHTVYTFVAMQ--------------------------------------HTVI  295

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PLQ LVSFGLNLVSR+FEFQAD FAKKLGYA  LR GLVKLQEENLSAMNTDPWYSAYHY
Sbjct  296  PLQQLVSFGLNLVSRSFEFQADGFAKKLGYASGLRGGLVKLQEENLSAMNTDPWYSAYHY  355

Query  379  SHPPLVERLAAIDEPDKKTD  320
            SHPPLVERLA +DEPDKK D
Sbjct  356  SHPPLVERLAVLDEPDKKED  375



>gb|AAB61028.1| A_IG002N01.21 gene product [Arabidopsis thaliana]
Length=316

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 92/150 (61%), Gaps = 48/150 (32%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHT YSFIAVQ                                      HTVI
Sbjct  205  ELGHWKLNHTTYSFIAVQ--------------------------------------HTVI  226

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ----------EENLSAMN  410
            PLQHLVSFGLNLVSRAFEFQADAFA KLGYA  LR  LVKLQ          EENLSAMN
Sbjct  227  PLQHLVSFGLNLVSRAFEFQADAFAVKLGYAKDLRPALVKLQVREDNNRTQTEENLSAMN  286

Query  409  TDPWYSAYHYSHPPLVERLAAIDEPDKKTD  320
            TDP YSAYHYSHPPLVERL AID  DKKTD
Sbjct  287  TDPLYSAYHYSHPPLVERLRAIDGEDKKTD  316



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNHTMYSFIAVQ+LT LQFGGYTLVRNS DLF+SFGF+TQPVLIGLIIFQHTVI
Sbjct  285  ELGHWKLNHTMYSFIAVQVLTLLQFGGYTLVRNSTDLFRSFGFDTQPVLIGLIIFQHTVI  344

Query  559  PLQHLVSFGLNLVSRAFEFQA  497
            P+QHLVSFGLNLVSR+FEFQ 
Sbjct  345  PIQHLVSFGLNLVSRSFEFQV  365



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHW LNHT+   I  QI  F  F  ++   N+  L++SFGFETQP+LIG ++FQ    
Sbjct  295  ELGHWYLNHTVKILIISQIHNFFLFFVFSQFINNTSLYRSFGFETQPILIGFMLFQFIYA  354

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P++++V+F +N++SR  EF+ADA+AKKLGY + LR+GL+K+Q +NL  +N DPWYSAYH+
Sbjct  355  PVENVVAFLMNILSRKHEFEADAYAKKLGYGVQLRSGLIKIQIKNLGNLNNDPWYSAYHF  414

Query  379  SHPPLVERLAAIDEPD  332
            SHPPL ERL+AI++ D
Sbjct  415  SHPPLPERLSAIEKID  430



>gb|AFW68434.1| hypothetical protein ZEAMMB73_431227 [Zea mays]
Length=247

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = -3

Query  718  NHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVIPLQHLVS  539
            N TM +F+AVQ+L  LQFGGYTLVRNSK LF+SFGFE QP++IGLIIFQHT+IP+QHL+S
Sbjct  5    NQTM-TFVAVQLLMILQFGGYTLVRNSKVLFESFGFEDQPIIIGLIIFQHTIIPIQHLLS  63

Query  538  FGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQ  434
            F LNLVS+AFEFQADAFAK LGYA  LRA LVKLQ
Sbjct  64   FCLNLVSKAFEFQADAFAKNLGYAPQLRAALVKLQ  98



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWKLNH +  ++A+Q +  L  GG+TL RNS DLFQSFGF +QPV+IGLII+     
Sbjct  297  ELGHWKLNHFVPLYVAMQFVPLLNGGGFTLARNSTDLFQSFGFHSQPVIIGLIIYLLIAA  356

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            PL ++V FG N + R+ EFQADAFA KLGY   LR+ LVK Q ENL   N DPWY AY  
Sbjct  357  PLNYIVMFGRNHLFRSIEFQADAFAVKLGYKSALRSVLVKKQMENLMEFNADPWYYAYRV  416

Query  379  SHPPLVERLAAIDEPDKKTD  320
              PP V RL A+DE DKK D
Sbjct  417  IQPPAVLRLTAMDELDKKAD  436



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 95/148 (64%), Gaps = 9/148 (6%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET---------QPVLIG  587
            ELGHWKL HT   FI  Q++   QF  YTLVRNS  L  +FGF +          P  I 
Sbjct  312  ELGHWKLFHTPQLFIVNQVVLVSQFCLYTLVRNSTALPAAFGFGSGEAVGASGLAPAFIS  371

Query  586  LIIFQHTVIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNT  407
            LI+FQ  V PL  ++ +  N+VSR FEFQADAFA   G+   LR+ L+K++EEN  AM+ 
Sbjct  372  LILFQFIVSPLDEVIHYASNVVSRRFEFQADAFAVHTGHGTELRSALLKMEEENKGAMHV  431

Query  406  DPWYSAYHYSHPPLVERLAAIDEPDKKT  323
            DPWYS+YHYSHPPLV+RL AID   KK 
Sbjct  432  DPWYSSYHYSHPPLVDRLKAIDSAVKKA  459



>emb|CCI48758.1| unnamed protein product [Albugo candida]
Length=493

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 96/141 (68%), Gaps = 3/141 (2%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF--ETQPVLIGLIIFQHT  566
            ELGHWKL HT  S I  Q+ TF     + L  N  DLF SFGF  +++PV+IG ++F  T
Sbjct  351  ELGHWKLWHTGQSLIFQQVYTFACLYLFGLCMNDADLFASFGFAVKSKPVMIGFLLFTQT  410

Query  565  V-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSA  389
            +  P+ HL+SF L L +R  EFQADAFA  LG+A  L+ GL K+  ENLS MN D WYSA
Sbjct  411  LWAPVNHLLSFMLTLNTRKNEFQADAFATDLGHAKALQTGLTKISIENLSNMNPDKWYSA  470

Query  388  YHYSHPPLVERLAAIDEPDKK  326
            YHY HPPL+ERL+AI + ++K
Sbjct  471  YHYDHPPLLERLSAIKQRERK  491



>emb|CCA18761.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
 emb|CCA25203.1| CAAX prenyl protease 1 putative [Albugo laibachii Nc14]
Length=493

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 3/141 (2%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQ--PVLIGLIIFQHT  566
            ELGHWKL HT  S I  Q+ TF     + L  N  DLF +FGF T+  PV+IG ++F  T
Sbjct  351  ELGHWKLWHTGQSLIFQQVYTFACLYLFGLCMNDADLFANFGFATKSKPVMIGFLLFTQT  410

Query  565  V-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSA  389
            +  P+ H++SF L L +R  EFQADAFA  LG+A  L+ GL K+  ENLS MN D WYSA
Sbjct  411  LWAPVNHVLSFMLTLNTRKNEFQADAFATDLGHAKALQTGLTKISTENLSNMNPDKWYSA  470

Query  388  YHYSHPPLVERLAAIDEPDKK  326
            YHY HPPL+ERL+AI + + K
Sbjct  471  YHYDHPPLLERLSAIKQRESK  491



>ref|XP_004348317.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93739.1| CAAX prenyl protease 1 [Capsaspora owczarzaki ATCC 30864]
Length=519

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKLNHT+ +F+  Q + F+ F  ++L  + + L+ SFGF +++PV IG+ ++FQ  
Sbjct  381  ELGHWKLNHTLKNFVFSQFMNFVSFALFSLFVSYQPLYTSFGFPDSRPVFIGMFLVFQFV  440

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P+  ++ F + ++SR +EFQADAFA KLG+   LR  LVKLQ+ NLS M+ DP YS Y
Sbjct  441  FQPMNTVLQFLMTVLSRRYEFQADAFAAKLGHGGHLRTALVKLQKNNLSDMDPDPLYSMY  500

Query  385  HYSHPPLVERLAAI  344
            HYSHPPLVERL AI
Sbjct  501  HYSHPPLVERLNAI  514



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF     +PV+IG ++F  
Sbjct  342  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSAKPVIIGFLLFSQ  401

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+A+ L++GL KL  ENLS MN D  YS
Sbjct  402  TMWAPVEHVLSFLMTLNTRKNEFQADAFAVDLGHAVALKSGLTKLAIENLSNMNPDVLYS  461

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  462  AYHYSHPPLVERLNAITARAKKS  484



>ref|XP_002292916.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90112.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=425

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 98/144 (68%), Gaps = 5/144 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF--ETQPV--LIGLIIFQ  572
            ELGHWK+ HT+ +F+  Q+ T   F  + L  NS +L+++FGF  E++PV  LI L+ F 
Sbjct  281  ELGHWKMGHTLINFVITQLYTGASFYAFALCYNSHELYRAFGFNDESRPVPTLIALLFFF  340

Query  571  HTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWY  395
             T+  P+   +SF + + SR  EF+AD F+ KLG +  L++GL K+  ENL AM  DPWY
Sbjct  341  STIWAPIDKALSFAMTVHSRRCEFEADEFSVKLGMSQGLQSGLCKIHLENLGAMLPDPWY  400

Query  394  SAYHYSHPPLVERLAAIDEPDKKT  323
            S YHYSHPPLVERL+A+ + DKK+
Sbjct  401  STYHYSHPPLVERLSAMMKMDKKS  424



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 94/137 (69%), Gaps = 1/137 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGL-IIFQHTV  563
            ELGHWKL+H + + +  Q  TF  F  + L+ N  +L+++FGF +QP LIGL IIFQ   
Sbjct  323  ELGHWKLSHNLKNLVIGQFNTFFCFMVFGLLMNRSELYEAFGFTSQPTLIGLLIIFQFIF  382

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   L+SF + ++SR FEF+AD FAK LG A PLR+ LVKL ++NL    +D  YS +H
Sbjct  383  SPYNELLSFCMTVLSRKFEFEADRFAKSLGRAAPLRSALVKLNKDNLGFPISDWLYSTWH  442

Query  382  YSHPPLVERLAAIDEPD  332
            YSHPPL+ER+ A+++ +
Sbjct  443  YSHPPLIERMKALEKEE  459



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q+     F  + L  N  +LF SFGF    ++PV+IG ++F  
Sbjct  341  ELGHWKLWHTAQGFVIQQVYILASFYVFGLCMNDAELFASFGFAGDSSKPVIIGFLLFSQ  400

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  401  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDVLYS  460

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KK+
Sbjct  461  AYHYSHPPLVERLNAITARAKKS  483



>ref|XP_009501173.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Phalacrocorax 
carbo]
Length=157

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  18   ELGHWKLGHTVKNIIISQINSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  77

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  78   FSPYNEVLSFCLTVLSRQFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  137

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  138  HYSHPPLLERLQALKDAKQE  157



>ref|XP_008935450.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Merops nubicus]
Length=157

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  18   ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  77

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L   L+KL ++NL    +D  +S +
Sbjct  78   FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYTALIKLNKDNLGFPVSDWIFSMW  137

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  138  HYSHPPLLERLQALKDAKQE  157



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF---ETQPVLIGLIIFQH  569
            ELGHWKL HT   F+  Q      F  + L  N  +LF SFGF     +PV+IG ++F  
Sbjct  325  ELGHWKLWHTAQGFVIQQAYILASFYVFGLCMNDAELFASFGFAGDSAKPVIIGFLLFSQ  384

Query  568  TV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYS  392
            T+  P++H++SF + L +R  EFQADAFA  LG+ + L++GL KL  ENLS MN D  YS
Sbjct  385  TMWAPVEHVLSFLITLNTRKNEFQADAFAVDLGHDVALKSGLTKLAIENLSNMNPDELYS  444

Query  391  AYHYSHPPLVERLAAIDEPDKKT  323
            AYHYSHPPLVERL AI    KKT
Sbjct  445  AYHYSHPPLVERLNAITARAKKT  467



>ref|XP_010116516.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Chlamydotis 
macqueenii]
Length=157

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  18   ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYDTQPTLIGLMIIFQFI  77

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  78   FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  137

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  138  HYSHPPLLERLQALKDAKQE  157



>ref|XP_009059971.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
 gb|ESO88920.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
Length=467

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGL-IIFQHTV  563
            ELGHWKLNH + + +  QI TFL F  + L+ N K+LF +FGF TQP LIGL IIFQ   
Sbjct  330  ELGHWKLNHNLKNLVIGQINTFLCFMMFALLMNRKELFTAFGFTTQPTLIGLLIIFQFIF  389

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   ++SF +  +SR FEFQAD FAK L  A  L++ L+KL ++NL    +D  YS +H
Sbjct  390  SPYNEVLSFCMTALSRKFEFQADDFAKTLHRANKLKSALIKLNKDNLGFPISDWLYSTWH  449

Query  382  YSHPPLVERLAAID  341
            +SHPPL+ERL A++
Sbjct  450  FSHPPLIERLNALE  463



>ref|XP_005100140.1| PREDICTED: CAAX prenyl protease 1 homolog [Aplysia californica]
Length=490

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 96/141 (68%), Gaps = 2/141 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLII-FQHTV  563
            ELGHW  +H +   I  QI  FL FG + ++   K LF +FGF+ QP +IGLII FQ  +
Sbjct  349  ELGHWYHSHVLKQLIISQINMFLCFGIFAVLMKEKVLFAAFGFDVQPTMIGLIIIFQFIL  408

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   ++SF L  ++R  EFQADAFA  +G++  LR+ L+KL E+NLS   +D  YSA+H
Sbjct  409  APYNEVLSFVLTYMTRKCEFQADAFAAGMGWSDTLRSALIKLNEDNLSFPLSDWLYSAWH  468

Query  382  YSHPPLVERLAAI-DEPDKKT  323
            +SHPPL++RL A+ D+PDKKT
Sbjct  469  FSHPPLLDRLRALHDQPDKKT  489



>ref|XP_009949557.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Leptosomus 
discolor]
 ref|XP_010309942.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Balearica 
regulorum gibbericeps]
Length=157

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  18   ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  77

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  78   FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  137

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  138  HYSHPPLLERLQALKDAKQE  157



>gb|KGO76072.1| Peptidase M48 [Penicillium italicum]
Length=456

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF + QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFVKEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEFQAD FA+KLGY+  L + L+KLQ +NLS M+ DP Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFQADEFAQKLGYSDKLASSLLKLQIQNLSTMDADPIYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>ref|XP_010158796.1| PREDICTED: CAAX prenyl protease 1 homolog [Eurypyga helias]
Length=219

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  80   ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  139

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  140  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  199

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  200  HYSHPPLLERLQALKDAKQE  219



>gb|EMP29923.1| CAAX prenyl protease 1 like protein [Chelonia mydas]
Length=265

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  126  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYETQPTLIGLMIIFQFI  185

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  186  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  245

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  246  HYSHPPLLERLQAL--KDAKQD  265



>gb|KGO40189.1| Peptidase M48 [Penicillium expansum]
 gb|KGO53048.1| Peptidase M48 [Penicillium expansum]
 gb|KGO63477.1| Peptidase M48 [Penicillium expansum]
Length=456

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF + QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFVKEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+AD FA+KLGY+  L + L+KLQ +NLS M+ DP Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFEADEFAQKLGYSDKLASSLLKLQIQNLSTMDADPIYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW  NHT+      Q+  F  F  ++   N++D++ SFGF ++ P  IG I+FQ+  
Sbjct  307  ELGHWACNHTLKMLAFGQVQLFAVFYLFSQFINNEDMYTSFGFMDSTPTFIGFILFQYLY  366

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P++ ++SF  N++SR +EFQADAFA+ LGYA  L +GL+KLQ +NL  MN D  +S YH
Sbjct  367  SPVESVISFITNMISRRYEFQADAFARDLGYAGSLASGLIKLQLKNLGTMNPDWLHSMYH  426

Query  382  YSHPPLVERLAAIDEP  335
             SHP LVERL AI++P
Sbjct  427  RSHPELVERLNAINQP  442



>gb|ETE70091.1| CAAX prenyl protease 1-like protein [Ophiophagus hannah]
Length=409

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  270  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLLIIFQFI  329

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  330  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  389

Query  385  HYSHPPLVERLAAIDE  338
            HYSHPPL+ERL A+ E
Sbjct  390  HYSHPPLLERLQALKE  405



>ref|XP_005428744.1| PREDICTED: CAAX prenyl protease 1 homolog [Geospiza fortis]
Length=409

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 97/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  270  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  329

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  330  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  389

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +P ++
Sbjct  390  HYSHPPLLERLQALKDPKQE  409



>ref|XP_010624212.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Fukomys 
damarensis]
Length=424

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  285  ELGHWKLGHTVKNIIISQMNSFLCFSLFAVLIRRKELFAAFGFYDSQPTLIGLLIIFQFI  344

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  345  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  404

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+  P +
Sbjct  405  HYSHPPLLERLQALKNPKQ  423



>ref|XP_002565802.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP99187.1| Pc22g18990 [Penicillium rubens Wisconsin 54-1255]
Length=456

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF   QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFINEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+ADAFA+ LGY+  L + L+KLQ +NLS M+ DP Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFEADAFAQNLGYSDKLASSLLKLQIQNLSTMDADPIYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>ref|XP_010624213.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Fukomys 
damarensis]
 gb|KFO32523.1| CAAX prenyl protease 1 like protein [Fukomys damarensis]
Length=475

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFSLFAVLIRRKELFAAFGFYDSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+  P +
Sbjct  456  HYSHPPLLERLQALKNPKQ  474



>dbj|BAG51388.1| unnamed protein product [Homo sapiens]
Length=235

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  96   ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  155

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  156  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  215

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  216  HYSHPPLLERLQAL  229



>ref|XP_005651455.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26911.1| hypothetical protein COCSUDRAFT_27312 [Coccomyxa subellipsoidea 
C-169]
Length=437

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 86/141 (61%), Gaps = 1/141 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHWKL HT+ + I  Q+     F  ++LV+ S  LF SFGF   QP  I   +F    
Sbjct  297  ELGHWKLGHTLKNLILTQMQMLCTFALFSLVKESTGLFTSFGFVNQQPAFIAYTLFSIIS  356

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V    N++SR FEFQADAFA  LG A  L+  L  L  +N SA+N DP YSAYH
Sbjct  357  APVNEVVGLLSNILSRRFEFQADAFAVSLGKAEELKQALKILDAKNRSAVNVDPLYSAYH  416

Query  382  YSHPPLVERLAAIDEPDKKTD  320
            +SHPPLVERL A+D   KK +
Sbjct  417  HSHPPLVERLTAVDAATKKGE  437



>ref|XP_007430031.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Python 
bivittatus]
Length=476

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  337  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLLIIFQFI  396

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  397  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  456

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+ E  +
Sbjct  457  HYSHPPLLERLQALKESKQ  475



>ref|XP_010721597.1| PREDICTED: CAAX prenyl protease 1 homolog [Meleagris gallopavo]
Length=316

 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  177  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  236

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  237  FSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  296

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  297  HYSHPPLLERLQALKDAKQE  316



>gb|EPZ36837.1| Peptidase M48 domain-containing protein [Rozella allomycis CSF55]
Length=276

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF--ETQPVLIGLIIFQHT  566
            ELGHWKL+HTM   +  Q + FL     +    ++ +F  FGF  +T PV++G I FQ+ 
Sbjct  135  ELGHWKLSHTMRRIVISQGIFFLNLYVLSQFILNEYIFNLFGFYGKTYPVVLGFIFFQYV  194

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P+ H+++F +N+VSR  E++ADAFA K GY+L L   L+K+  ENLS +N D WY  Y
Sbjct  195  SSPVDHMLNFAMNIVSRKHEYEADAFAVKHGYSLELVNALIKIHSENLSNLNPDRWYVTY  254

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HY HP L ER+ AI   D K +
Sbjct  255  HYCHPTLFERIEAITSVDIKQE  276



>gb|KFP73521.1| CAAX prenyl protease 1, partial [Apaloderma vittatum]
Length=258

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  119  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  178

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  179  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  238

Query  385  HYSHPPLVERLAAIDE  338
            HYSHPPL+ERL A+ +
Sbjct  239  HYSHPPLLERLQALKD  254



>ref|XP_009876903.1| PREDICTED: CAAX prenyl protease 1 homolog [Apaloderma vittatum]
Length=262

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  123  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  182

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  183  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  242

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  243  HYSHPPLLERLQALKDAKQE  262



>ref|XP_009685466.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Struthio 
camelus australis]
Length=380

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  241  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  300

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  301  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  360

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  361  HYSHPPLLERLQALKDAKQE  380



>ref|XP_010284930.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Phaethon 
lepturus]
 gb|KFQ67253.1| CAAX prenyl protease 1, partial [Phaethon lepturus]
Length=258

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  119  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  178

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  179  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  238

Query  385  HYSHPPLVERLAAIDE  338
            HYSHPPL+ERL A+ +
Sbjct  239  HYSHPPLLERLQALKD  254



>ref|XP_007892978.1| PREDICTED: CAAX prenyl protease 1 homolog [Callorhinchus milii]
Length=421

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 95/142 (67%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +F  F  + ++ + K+LF +FGF ++QP LIGL IIFQ  
Sbjct  282  ELGHWKLGHTVKNIVISQVNSFFCFFLFAVLMDRKELFSAFGFYDSQPTLIGLMIIFQFI  341

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL ++NL     D  YS +
Sbjct  342  FSPYNEVLSFCLTVLSRRFEFQADAFAKNLGKATDLYSSLIKLNKDNLGFPVADWLYSMW  401

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   DKK D
Sbjct  402  HYSHPPLLERLRALK--DKKED  421



>ref|XP_004705331.1| PREDICTED: CAAX prenyl protease 1 homolog [Echinops telfairi]
Length=432

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+QP LIGL IIFQ  
Sbjct  293  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFHAFGFYESQPTLIGLLIIFQFI  352

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  +NL    +D  YS +
Sbjct  353  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLDSALIKLNRDNLGFPVSDWLYSMW  412

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  413  HYSHPPLLERLQAL  426



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLII-FQHTV  563
            ELGHW L+H + + I  Q  T   F  + ++ + K L+++FGF +QPVLIGLII FQ   
Sbjct  313  ELGHWSLSHNLKNLIISQFNTLFCFLIFGILMHEKVLYEAFGFNSQPVLIGLIIIFQFVF  372

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   L+ F + +++R FEFQADAFAK+LG+A  LR+ L+KL ++NL     D  YSAYH
Sbjct  373  SPYNELLGFLMTILTRRFEFQADAFAKQLGFAPHLRSALIKLHQDNLGFPIADKLYSAYH  432

Query  382  YSHPPLVERLAAI  344
            YSHPPL+ERL A+
Sbjct  433  YSHPPLLERLRAL  445



>gb|EKV19760.1| CaaX prenyl protease Ste24 [Penicillium digitatum PHI26]
 gb|EKV20861.1| CaaX prenyl protease Ste24 [Penicillium digitatum Pd1]
Length=456

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF + QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFVKEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+   V   +N++SR FEF+AD FA KLGY+  L + L+KLQ +NLS M+ DP Y++YH
Sbjct  358  APMDAAVKLLMNILSRKFEFEADEFAHKLGYSDKLASSLLKLQIQNLSTMDADPIYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>ref|XP_005353368.1| PREDICTED: CAAX prenyl protease 1 homolog [Microtus ochrogaster]
Length=475

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   K LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTIKNIIISQINSFLCFFLFGVLIGQKILFAAFGFYDSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNKDNLGFPVSDWLFSTW  455

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   DKK D
Sbjct  456  HYSHPPLLERLQALR--DKKQD  475



>ref|XP_009491273.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Pelecanus 
crispus]
Length=309

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  170  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  229

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  230  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  289

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  290  HYSHPPLLERLQALKDAKQE  309



>ref|XP_009685465.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Struthio 
camelus australis]
Length=409

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  270  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  329

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  330  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  389

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  390  HYSHPPLLERLQALKDAKQE  409



>ref|XP_009813244.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Gavia stellata]
 gb|KFQ58206.1| CAAX prenyl protease 1, partial [Pelecanus crispus]
 gb|KFV44062.1| CAAX prenyl protease 1, partial [Gavia stellata]
Length=310

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  171  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  230

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  231  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  290

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  291  HYSHPPLLERLQALKDAKQE  310



>ref|XP_007066142.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Chelonia mydas]
Length=410

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  271  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYETQPTLIGLMIIFQFI  330

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  331  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  390

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  391  HYSHPPLLERLQAL--KDAKQD  410



>ref|XP_005029095.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Anas platyrhynchos]
Length=427

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDTKQE  427



>ref|XP_002485210.1| CaaX prenyl protease Ste24 [Talaromyces stipitatus ATCC 10500]
 gb|EED15257.1| CaaX prenyl protease Ste24 [Talaromyces stipitatus ATCC 10500]
Length=456

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGLIIFQHTV  563
            ELGHWKL HT   F   Q   F  F  +T   N+K LFQSFGF   QP++IG ++F   +
Sbjct  300  ELGHWKLGHTTKLFTIAQAHMFYIFALFTAFVNNKSLFQSFGFHNEQPIMIGFLLFSDAL  359

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V F +N++SR FEF+ADAFA  LG +  L   L+KLQ +NLS M+ D  Y++YH
Sbjct  360  APMDAVVKFLMNILSRKFEFEADAFAANLGQSKLLAQSLLKLQIQNLSTMDADWMYASYH  419

Query  382  YSHPPLVERLAAIDEPDKKTD  320
            YSHP L ERLAA+    K ++
Sbjct  420  YSHPILTERLAALGWKGKGSE  440



>emb|CDM27808.1| CAAX prenyl protease 1 [Penicillium roqueforti FM164]
Length=456

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 90/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N+K L+QSFGF   QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFINEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+AD FA+ LGY+  L + L+KLQ +NLS M+ DP Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFEADKFAQNLGYSDKLASSLLKLQIQNLSTMDADPIYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>gb|KFV87620.1| CAAX prenyl protease 1, partial [Struthio camelus australis]
Length=427

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>ref|XP_006033777.1| PREDICTED: CAAX prenyl protease 1 homolog [Alligator sinensis]
Length=460

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  321  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  380

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  381  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAEDLYSALIKLNKDNLGFPVSDWIFSMW  440

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  441  HYSHPPLLERLQALK--DSKQD  460



>ref|XP_417720.1| PREDICTED: CAAX prenyl protease 1 homolog [Gallus gallus]
Length=465

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  326  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  385

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  386  FSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  445

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  446  HYSHPPLLERLQALKDAKQE  465



>ref|XP_007950886.1| PREDICTED: CAAX prenyl protease 1 homolog [Orycteropus afer afer]
Length=475

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYESQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A++   +
Sbjct  456  HYSHPPLLERLQALESTKQ  474



>ref|XP_005029094.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Anas platyrhynchos]
Length=465

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  326  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  385

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  386  FSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  445

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  446  HYSHPPLLERLQALKDTKQE  465



>ref|XP_004426071.1| PREDICTED: CAAX prenyl protease 1 homolog [Ceratotherium simum 
simum]
Length=475

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SFGL ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFGLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  456  HYSHPPLLERLQAL  469



>ref|XP_005309438.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X4 [Chrysemys 
picta bellii]
Length=377

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  238  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYETQPTLIGLMIIFQFI  297

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  298  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  357

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  358  HYSHPPLLERLQALK--DAKQD  377



>ref|XP_010217187.1| PREDICTED: CAAX prenyl protease 1 homolog [Tinamus guttatus]
Length=451

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  312  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  371

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  372  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  431

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  432  HYSHPPLLERLQALKDTKQE  451



>gb|EOA94667.1| CAAX prenyl protease 1-like protein, partial [Anas platyrhynchos]
Length=467

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  328  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  387

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  388  FSPYNEILSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  447

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  448  HYSHPPLLERLQALKDTKQE  467



>gb|KGL80196.1| CAAX prenyl protease 1, partial [Tinamus guttatus]
Length=427

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDTKQE  427



>ref|XP_005309437.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Chrysemys 
picta bellii]
Length=430

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  291  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYETQPTLIGLMIIFQFI  350

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  351  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  410

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  411  HYSHPPLLERLQALK--DAKQD  430



>ref|XP_006269945.1| PREDICTED: CAAX prenyl protease 1 homolog [Alligator mississippiensis]
Length=468

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  329  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYETQPTLIGLMIIFQFI  388

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  389  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAEDLYSALIKLNKDNLGFPVSDWIFSMW  448

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  449  HYSHPPLLERLQALK--DSKQD  468



>ref|XP_005309436.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Chrysemys 
picta bellii]
Length=467

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF ETQP LIGL IIFQ  
Sbjct  328  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQKELFAAFGFYETQPTLIGLMIIFQFI  387

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  388  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  447

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  448  HYSHPPLLERLQALK--DAKQD  467



>ref|XP_002377095.1| CaaX prenyl protease Ste24 [Aspergillus flavus NRRL3357]
 gb|EED53849.1| CaaX prenyl protease Ste24 [Aspergillus flavus NRRL3357]
Length=379

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N++ L+QSFGF   QP++IG ++F   +
Sbjct  221  ELGHWSLSHTTKLFGIAQFHMFYIFALFSVFVNNRSLYQSFGFINEQPIMIGFLLFSDAL  280

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEFQADAFA KLGY+  L + L+KLQ +NLS M+ D  Y++YH
Sbjct  281  APMDAVVKLLMNILSRKFEFQADAFAVKLGYSEKLASSLLKLQIQNLSTMDADWMYASYH  340

Query  382  YSHPPLVERLAAID-EPDKKTD**VEQPHAP  293
            YSHP L ERL A+  +  K TD   E    P
Sbjct  341  YSHPILSERLKALGWKGGKVTDYKAEDDEKP  371



>ref|XP_007492913.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Monodelphis 
domestica]
Length=472

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++ + K+LF +FGF ++QP LIGL IIFQ  
Sbjct  333  ELGHWKLGHTVKNIVISQMNSFLCFFLFAMLISRKELFAAFGFYDSQPTLIGLMIIFQFI  392

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  393  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  452

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  453  HYSHPPLLERLQALQ--DSKQD  472



>ref|XP_004665222.1| PREDICTED: CAAX prenyl protease 1 homolog [Jaculus jaculus]
Length=432

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+QP LIGL IIFQ  
Sbjct  293  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYESQPTLIGLLIIFQFI  352

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  353  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  412

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  413  HYSHPPLLERLQAL  426



>ref|XP_001381205.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Monodelphis 
domestica]
Length=474

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++ + K+LF +FGF ++QP LIGL IIFQ  
Sbjct  335  ELGHWKLGHTVKNIVISQMNSFLCFFLFAMLISRKELFAAFGFYDSQPTLIGLMIIFQFI  394

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  395  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  454

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  455  HYSHPPLLERLQALQ--DSKQD  474



>ref|XP_010593553.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Loxodonta 
africana]
Length=417

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+QP LIGL IIFQ  
Sbjct  278  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYESQPTLIGLLIIFQFI  337

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  +NL    +D  +S +
Sbjct  338  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNRDNLGFPVSDWLFSMW  397

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  398  HYSHPPLLERLQAL  411



>gb|KFP47980.1| CAAX prenyl protease 1 [Cathartes aura]
Length=377

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  238  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  297

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  298  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  357

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  358  HYSHPPLLERLQALKDAKQE  377



>ref|XP_006113335.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Pelodiscus 
sinensis]
Length=437

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   ++LF +FGF ETQP LIGL IIFQ  
Sbjct  298  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQRELFAAFGFYETQPTLIGLMIIFQFI  357

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  358  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKANDLYSALIKLNKDNLGFPVSDWIFSMW  417

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+ E  +
Sbjct  418  HYSHPPLLERLQALKEAKQ  436



>ref|XP_009822213.1| hypothetical protein H257_00958 [Aphanomyces astaci]
 gb|ETV87350.1| hypothetical protein H257_00958 [Aphanomyces astaci]
Length=479

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQ----PVLIGLIIFQ  572
            ELGHWKL HT+ + +  Q+     F  +    + +DLF SFGF++Q    PV+I L +F 
Sbjct  332  ELGHWKLWHTVQNLVVQQVYIGAMFAVFARCMHDRDLFASFGFDSQSVDLPVVISLTLFT  391

Query  571  HTV-IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWY  395
             TV  P+  L+ + +   +RA EFQADAFA  LG+  PL++ L K+  ENL+ MN D  Y
Sbjct  392  STVWAPVDKLLQYVVTANTRANEFQADAFAVDLGHGEPLQSALTKISLENLANMNPDTLY  451

Query  394  SAYHYSHPPLVERLAAIDE  338
            SAYHYSHPPLVERLAAI +
Sbjct  452  SAYHYSHPPLVERLAAISK  470



>ref|XP_009991374.1| PREDICTED: CAAX prenyl protease 1 homolog [Tauraco erythrolophus]
Length=358

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  219  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  278

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  279  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  338

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  339  HYSHPPLLERLQALKDTKQE  358



>ref|XP_004450692.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Dasypus 
novemcinctus]
Length=366

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  227  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  286

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  287  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  346

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+    +
Sbjct  347  HYSHPPLLERLQALKSTKQ  365



>gb|EPS28736.1| hypothetical protein PDE_03682 [Penicillium oxalicum 114-2]
Length=456

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHWKL+HT   F   Q   F  F  +++  N++ L+QSFGF + QP++IG ++F   +
Sbjct  298  ELGHWKLSHTTKLFGIAQFHMFYIFALFSVFVNNRSLYQSFGFVKDQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+ADAFA+ LG++  L A L+KLQ +NLS M+ D  Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFEADAFAQGLGFSNELAASLMKLQIQNLSTMDADWMYASYH  417

Query  382  YSHPPLVERLAAI  344
            YSHP L ERLAA+
Sbjct  418  YSHPILTERLAAL  430



>gb|KFU93569.1| CAAX prenyl protease 1, partial [Chaetura pelagica]
Length=427

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  408  HYSHPPLLERLQALK--DAKQD  427



>emb|CBJ27157.1| CaaX prenyl protease Ste24 [Ectocarpus siliculosus]
Length=474

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 88/134 (66%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRN-SKDLFQSFGFETQPVLIGLIIFQHTV  563
            ELGHWK++HT+  F+  Q      F  + L     + L  SFG+ T   LI L +F   +
Sbjct  332  ELGHWKMSHTLQGFVISQTYLLASFCAFGLATELGESLRLSFGYSTSATLITLYLFFAVM  391

Query  562  -IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P+ HL+   +N++SR  EF+ADA+A KLGY+  L++GLVKLQ ENL  MN DPWYSA+
Sbjct  392  WAPVDHLLGVFMNVLSRKNEFEADAYAVKLGYSKGLQSGLVKLQLENLGNMNPDPWYSAF  451

Query  385  HYSHPPLVERLAAI  344
            HYSHPPLVERL A+
Sbjct  452  HYSHPPLVERLQAM  465



>ref|XP_008929891.1| PREDICTED: CAAX prenyl protease 1 homolog [Manacus vitellinus]
Length=433

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  294  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFTAFGFYDTQPTLIGLMIIFQFI  353

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  354  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  413

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  414  HYSHPPLLERLQALKDAKQE  433



>ref|XP_010187899.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Mesitornis 
unicolor]
Length=425

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  286  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  345

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  346  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  405

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  406  HYSHPPLLERLQALKDAKQE  425



>ref|XP_002194902.2| PREDICTED: CAAX prenyl protease 1 homolog [Taeniopygia guttata]
Length=443

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  304  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  363

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  364  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  423

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  424  HYSHPPLLERLQALKDAKQE  443



>ref|XP_009095809.1| PREDICTED: CAAX prenyl protease 1 homolog [Serinus canaria]
Length=409

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  270  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  329

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  330  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  389

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  390  HYSHPPLLERLQALKDAKQE  409



>gb|KFQ39196.1| CAAX prenyl protease 1, partial [Mesitornis unicolor]
Length=426

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  407  HYSHPPLLERLQALKDAKQE  426



>gb|KFO78045.1| CAAX prenyl protease 1, partial [Cuculus canorus]
Length=407

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  268  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFTAFGFYDTQPTLIGLMIIFQFI  327

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  328  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  387

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  388  HYSHPPLLERLQALKDAKQE  407



>ref|XP_010207607.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Colius striatus]
Length=446

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  307  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  366

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  367  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  426

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  427  HYSHPPLLERLQALKDAKQE  446



>gb|EME39248.1| hypothetical protein DOTSEDRAFT_75093 [Dothistroma septosporum 
NZE10]
Length=462

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 88/139 (63%), Gaps = 1/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHWK+ HT              F  + +  N+  L+Q+FGF   +P++IG I+F   +
Sbjct  299  ELGHWKMGHTSKLLGISSFHLLYVFALFGVFINNGSLYQAFGFLRERPIIIGFILFNDVL  358

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   +V  G+N+++R FEF+ADAF KKLGYA  L A L+KLQ +NLS+M+ DP YS+YH
Sbjct  359  SPTDSVVKLGMNIMTRKFEFEADAFGKKLGYAKDLAASLIKLQIQNLSSMDADPLYSSYH  418

Query  382  YSHPPLVERLAAIDEPDKK  326
            YSHP L ERL A+    +K
Sbjct  419  YSHPILTERLKAVGWTSEK  437



>gb|KFW75388.1| CAAX prenyl protease 1, partial [Manacus vitellinus]
Length=427

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFTAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>ref|XP_009701667.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Cariama cristata]
Length=426

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  407  HYSHPPLLERLQALK--DAKQD  426



>ref|XP_009575599.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Fulmarus 
glacialis]
Length=426

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  407  HYSHPPLLERLQALKDAKQE  426



>ref|XP_006113334.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Pelodiscus 
sinensis]
Length=466

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   ++LF +FGF ETQP LIGL IIFQ  
Sbjct  327  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGQRELFAAFGFYETQPTLIGLMIIFQFI  386

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  387  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKANDLYSALIKLNKDNLGFPVSDWIFSMW  446

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+ E  +
Sbjct  447  HYSHPPLLERLQALKEAKQ  465



>gb|KFV92102.1| CAAX prenyl protease 1, partial [Fulmarus glacialis]
Length=427

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|EMF09871.1| CaaX prenyl protease [Sphaerulina musiva SO2202]
Length=465

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 88/133 (66%), Gaps = 1/133 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQ-PVLIGLIIFQHTV  563
            ELGHWK+ HT+          F  F  +++   +  LF++FGFE + P+LIG ++F   +
Sbjct  299  ELGHWKMGHTVKLLGISSFHLFYIFALFSVFIKNNSLFKAFGFEVERPILIGFLLFNEVL  358

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P   LV FG+N ++R FEF+ADAF+  LGYA  L A L+KLQ++NLS+M+ D  YSA+H
Sbjct  359  SPTDSLVKFGMNALTRKFEFEADAFSHSLGYASELAAALIKLQKQNLSSMDADWMYSAFH  418

Query  382  YSHPPLVERLAAI  344
            YSHP L ERL AI
Sbjct  419  YSHPILTERLKAI  431



>ref|XP_008149410.1| PREDICTED: CAAX prenyl protease 1 homolog [Eptesicus fuscus]
Length=473

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  334  ELGHWKLGHTIKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFFDSQPTLIGLLIIFQFI  393

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  394  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  453

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  454  HYSHPPLIERLQAL  467



>ref|XP_009074890.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Acanthisitta 
chloris]
Length=426

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKQLGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  407  HYSHPPLLERLQALKDSKQE  426



>ref|XP_003415368.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Loxodonta 
africana]
Length=475

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF E+QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYESQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL  +NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNRDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  456  HYSHPPLLERLQAL  469



>ref|XP_010001210.1| PREDICTED: CAAX prenyl protease 1 homolog [Chaetura pelagica]
Length=460

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  321  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  380

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  381  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  440

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  441  HYSHPPLLERLQALK--DAKQD  460



>ref|XP_004740737.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004783002.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
Length=475

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFHTSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAID  341
            HYSHPPL+ERL A++
Sbjct  456  HYSHPPLLERLQALE  470



>ref|XP_010086478.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Pterocles 
gutturalis]
Length=425

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  286  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  345

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  346  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  405

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  406  HYSHPPLLERLQALKDAKQE  425



>gb|KFP82009.1| CAAX prenyl protease 1, partial [Acanthisitta chloris]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKQLGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDSKQE  427



>gb|KFP66604.1| CAAX prenyl protease 1, partial [Cariama cristata]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  408  HYSHPPLLERLQALK--DAKQD  427



>gb|KFP21746.1| CAAX prenyl protease 1, partial [Egretta garzetta]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|KFO58257.1| CAAX prenyl protease 1, partial [Corvus brachyrhynchos]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|KFM12524.1| CAAX prenyl protease 1, partial [Aptenodytes forsteri]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>ref|XP_005083884.1| PREDICTED: CAAX prenyl protease 1 homolog [Mesocricetus auratus]
Length=475

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   K LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQKVLFAAFGFYDSQPTLIGLLIIFQFV  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG +  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMSKDLYSALIKLNKDNLGFPVSDWLFSTW  455

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  456  HYSHPPLLERLQALK--DTKQD  475



>ref|XP_001821320.1| CAAX prenyl protease 1 [Aspergillus oryzae RIB40]
 dbj|BAE59318.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT78461.1| metalloprotease [Aspergillus oryzae 3.042]
 gb|KDE82767.1| metalloprotease [Aspergillus oryzae 100-8]
Length=456

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 95/151 (63%), Gaps = 2/151 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L+HT   F   Q   F  F  +++  N++ L+QSFGF   QP++IG ++F   +
Sbjct  298  ELGHWSLSHTTKLFGIAQFHMFYIFALFSVFVNNRSLYQSFGFINEQPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEFQADAFA KLGY+  L + L+KLQ +NLS M+ D  Y++YH
Sbjct  358  APMDAVVKLLMNILSRKFEFQADAFAVKLGYSEKLASSLLKLQIQNLSTMDADWMYASYH  417

Query  382  YSHPPLVERLAAID-EPDKKTD**VEQPHAP  293
            YSHP L ERL A+  +  K TD   E    P
Sbjct  418  YSHPILSERLKALGWKGGKVTDYKAEDDEKP  448



>ref|XP_008630820.1| PREDICTED: CAAX prenyl protease 1 homolog [Corvus brachyrhynchos]
Length=449

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  310  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  369

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  370  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  429

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  430  HYSHPPLLERLQALKDAKQE  449



>gb|KFR09506.1| CAAX prenyl protease 1, partial [Opisthocomus hoazin]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|KFO89161.1| CAAX prenyl protease 1, partial [Buceros rhinoceros silvestris]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|KFP23371.1| CAAX prenyl protease 1, partial [Colius striatus]
Length=433

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  294  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  353

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  354  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  413

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  414  HYSHPPLLERLQALKDAKQE  433



>ref|XP_010133525.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Buceros rhinoceros 
silvestris]
Length=426

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  407  HYSHPPLLERLQALKDAKQE  426



>gb|KFV03217.1| CAAX prenyl protease 1, partial [Pterocles gutturalis]
Length=426

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  406

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  407  HYSHPPLLERLQALKDAKQE  426



>gb|KFV07913.1| CAAX prenyl protease 1, partial [Tauraco erythrolophus]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDTKQE  427



>gb|KFQ91415.1| CAAX prenyl protease 1, partial [Nipponia nippon]
Length=427

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>ref|XP_005529940.1| PREDICTED: CAAX prenyl protease 1 homolog [Pseudopodoces humilis]
Length=465

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  326  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  385

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  386  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  445

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  446  HYSHPPLLERLQALKDAKQE  465



>ref|XP_005492450.1| PREDICTED: CAAX prenyl protease 1 homolog [Zonotrichia albicollis]
Length=453

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  314  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  373

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  374  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  433

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  434  HYSHPPLLERLQALKDAKQE  453



>ref|XP_003225003.1| PREDICTED: CAAX prenyl protease 1 homolog [Anolis carolinensis]
Length=477

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + +  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  338  ELGHWKLGHTIKNIVISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLLIIFQFI  397

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL ++NL    +D  +S +
Sbjct  398  FSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  457

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+ E  +
Sbjct  458  HYSHPPLLERLQALKESKQ  476



>ref|XP_002715233.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryctolagus cuniculus]
Length=473

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  334  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  393

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL ++NL    +D  +S +
Sbjct  394  FSPYNEVLSFCLTVLSRRFEFQADAFAKNLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  453

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+  P +
Sbjct  454  HYSHPPLLERLQALKTPKQ  472



>ref|XP_009931337.1| PREDICTED: CAAX prenyl protease 1 homolog [Opisthocomus hoazin]
Length=451

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  312  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  371

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  372  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  431

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  432  HYSHPPLLERLQALKDAKQE  451



>ref|XP_009284932.1| PREDICTED: CAAX prenyl protease 1 homolog [Aptenodytes forsteri]
Length=501

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  362  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  421

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  422  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  481

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  482  HYSHPPLLERLQALKDAKQE  501



>ref|XP_005058383.1| PREDICTED: CAAX prenyl protease 1 homolog [Ficedula albicollis]
Length=465

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  326  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  385

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  386  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  445

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  446  HYSHPPLLERLQALKDAKQE  465



>gb|EFB13524.1| hypothetical protein PANDA_017398 [Ailuropoda melanoleuca]
Length=434

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T QP LIGL IIFQ  
Sbjct  296  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYTSQPTLIGLLIIFQFI  355

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  356  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  415

Query  385  HYSHPPLVERLAAID  341
            HYSHPPL+ERL A++
Sbjct  416  HYSHPPLLERLQALE  430



>ref|XP_004614273.1| PREDICTED: CAAX prenyl protease 1 homolog [Sorex araneus]
Length=475

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFSLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  456  HYSHPPLLERLQAL  469



>gb|KFY19341.1| hypothetical protein V493_08005 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=458

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQ-PVLIGLIIFQHTV  563
            ELGHW L HT   F   Q+  F  F  +++  N+K L+QSFGF TQ P++IG I+F   +
Sbjct  298  ELGHWSLGHTTRLFAISQVHFFYIFSLFSVFINNKSLYQSFGFHTQMPIIIGFILFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  ++   +N++SR +EFQAD FA+KLGY+  L   L+KLQ +NLS M+ D  Y+ YH
Sbjct  358  APMDTVIKLLMNILSRRYEFQADEFAQKLGYSSQLAKSLIKLQIQNLSTMDADWMYATYH  417

Query  382  YSHPPLVERLAAID-EPDKKTD**VEQPHAPGV  287
            +SHP L ERL A+    DK  +  VE+ +   V
Sbjct  418  FSHPILSERLGALGWHGDKSGESVVEEKNDTAV  450



>gb|KFV40539.1| CAAX prenyl protease 1, partial [Tyto alba]
Length=427

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>ref|XP_009969340.1| PREDICTED: CAAX prenyl protease 1 homolog, partial [Tyto alba]
Length=432

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  293  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  352

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  353  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  412

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  413  HYSHPPLLERLQALKDAKQE  432



>gb|ERE83119.1| putative CAAX prenyl protease 1 like protein [Cricetulus griseus]
Length=426

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF ++QP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQEVLFAAFGFYDSQPTLIGLLIIFQFV  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNKDNLGFPVSDWLFSTW  406

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  407  HYSHPPLLERLQALK--DTKQD  426



>ref|XP_010345849.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Saimiri 
boliviensis boliviensis]
Length=417

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  278  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  337

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  338  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  397

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  398  HYSHPPLLERLQAL  411



>ref|XP_009909817.1| PREDICTED: CAAX prenyl protease 1 homolog [Picoides pubescens]
Length=428

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  289  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  348

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  349  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAQDLYSALIKLNKDNLGFPVSDWIFSMW  408

Query  385  HYSHPPLVERLAAIDE  338
            HYSHPPL+ERL A+ +
Sbjct  409  HYSHPPLLERLQALKD  424



>ref|XP_006886567.1| PREDICTED: CAAX prenyl protease 1 homolog [Elephantulus edwardii]
Length=474

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  335  ELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRKELFAAFGFYDSQPTLIGLLIIFQFI  394

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  395  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  454

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  455  HYSHPPLLERLQAL  468



>ref|XP_006995844.1| PREDICTED: CAAX prenyl protease 1 homolog [Peromyscus maniculatus 
bairdii]
Length=475

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF +TQP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQRVLFAAFGFYDTQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNKDNLGFPVSDWLFSTW  455

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  456  HYSHPPLLERLQAL  469



>ref|XP_008063695.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarsius 
syrichta]
Length=436

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  297  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDSQPTLIGLLIIFQFI  356

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  357  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  416

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  417  HYSHPPLLERLQAL  430



>ref|XP_009644178.1| PREDICTED: CAAX prenyl protease 1 homolog [Egretta garzetta]
Length=475

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  455

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  456  HYSHPPLLERLQALKDAKQE  475



>ref|XP_006867649.1| PREDICTED: CAAX prenyl protease 1 homolog [Chrysochloris asiatica]
Length=475

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   ++LF +FGF E+QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRRELFAAFGFYESQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  456  HYSHPPLLERLQAL  469



>ref|XP_005607230.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Equus caballus]
 ref|XP_008522392.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Equus przewalskii]
Length=426

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  287  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  346

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  347  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  406

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  407  HYSHPPLLERLQAL  420



>ref|XP_003989947.2| PREDICTED: CAAX prenyl protease 1 homolog [Felis catus]
Length=475

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF  +QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYNSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A++   +
Sbjct  456  HYSHPPLLERLQALESSKQ  474



>ref|XP_004415415.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004415416.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Odobenus 
rosmarus divergens]
Length=475

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYTSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAID  341
            HYSHPPL+ERL A++
Sbjct  456  HYSHPPLLERLQALE  470



>gb|KFV63659.1| CAAX prenyl protease 1, partial [Picoides pubescens]
Length=427

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 94/136 (69%), Gaps = 2/136 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGQKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKELGKAQDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDE  338
            HYSHPPL+ERL A+ +
Sbjct  408  HYSHPPLLERLQALKD  423



>ref|XP_003501864.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 ref|XP_007618844.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 gb|EGV97096.1| CAAX prenyl protease 1-like [Cricetulus griseus]
 gb|ERE83120.1| putative CAAX prenyl protease 1 like protein [Cricetulus griseus]
Length=475

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 4/142 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  QI +FL F  + ++   + LF +FGF ++QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTIKNIIISQINSFLCFFLFAVLIGQEVLFAAFGFYDSQPTLIGLLIIFQFV  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGMAKDLYSALIKLNKDNLGFPVSDWLFSTW  455

Query  385  HYSHPPLVERLAAIDEPDKKTD  320
            HYSHPPL+ERL A+   D K D
Sbjct  456  HYSHPPLLERLQALK--DTKQD  475



>ref|XP_007077458.1| PREDICTED: CAAX prenyl protease 1 homolog [Panthera tigris altaica]
Length=473

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF  +QP LIGL IIFQ  
Sbjct  334  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFSAFGFYNSQPTLIGLLIIFQFI  393

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  394  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  453

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A++   +
Sbjct  454  HYSHPPLLERLQALESSKQ  472



>ref|XP_003799067.1| PREDICTED: CAAX prenyl protease 1 homolog [Otolemur garnettii]
Length=446

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  307  ELGHWKLGHTVKNIIISQMNSFLCFFLFAILIGRKELFAAFGFYDSQPTLIGLLIIFQFI  366

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  367  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  426

Query  385  HYSHPPLVERLAAIDEPDK  329
            HYSHPPL+ERL A+    +
Sbjct  427  HYSHPPLLERLQALKSSKQ  445



>ref|XP_002927608.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Ailuropoda 
melanoleuca]
Length=475

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYTSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAID  341
            HYSHPPL+ERL A++
Sbjct  456  HYSHPPLLERLQALE  470



>gb|EHB18901.1| CAAX prenyl protease 1-like protein [Heterocephalus glaber]
Length=445

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  306  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIRRKELFAAFGFYDSQPTLIGLLIIFQFI  365

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  366  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAEDLYSALIKLNKDNLGFPVSDWLFSMW  425

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  426  HYSHPPLLERLQAL  439



>ref|XP_007114324.1| PREDICTED: CAAX prenyl protease 1 homolog [Physeter catodon]
Length=432

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  293  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  352

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  353  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  412

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  413  HYSHPPLLERLQAL  426



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 10/148 (7%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWK+ HT+   I  QI     F  ++L  N+K L+  FGF+T P LIG ++FQ    
Sbjct  291  ELGHWKMGHTLKLLIVNQIHLLSIFWLFSLFINNKQLYTDFGFDTMPTLIGFMLFQFIYS  350

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P++ ++ F  ++  R  E++ADA+A KLGYA  LR+ L+KL  +NL   N DPWYSA+++
Sbjct  351  PVESVIGFLQHVYQRKNEYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNH  410

Query  379  SHPPLVERLAAI------DEP----DKK  326
            SHP LVERL A+      D+P    DKK
Sbjct  411  SHPSLVERLNALGVEPTSDKPITVEDKK  438



>ref|XP_004025583.1| PREDICTED: CAAX prenyl protease 1 homolog [Gorilla gorilla gorilla]
Length=422

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  283  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  342

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  343  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  402

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  403  HYSHPPLLERLQAL  416



>ref|XP_009891312.1| PREDICTED: CAAX prenyl protease 1 homolog [Charadrius vociferus]
Length=431

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  292  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  351

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL ++NL    +D  +S +
Sbjct  352  FSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  411

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  412  HYSHPPLLERLQALKDAKQE  431



>gb|KGL99640.1| CAAX prenyl protease 1, partial [Charadrius vociferus]
Length=427

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 95/140 (68%), Gaps = 2/140 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRRFEFQADAFAKDLGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+ +  ++
Sbjct  408  HYSHPPLLERLQALKDAKQE  427



>gb|EDP50136.1| CaaX prenyl protease Ste24 [Aspergillus fumigatus A1163]
Length=479

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L HT   F   Q   F  F  +++  N+K L+QSFGF +  P++IG ++F   +
Sbjct  321  ELGHWSLGHTTKLFAIAQSHMFYIFALFSVFVNNKSLYQSFGFHQEMPIMIGFLLFSDAL  380

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+ADAFA KLGY+  L A L+KLQ +NLS M+ D  Y++YH
Sbjct  381  APMDAVVKLLMNVLSRKFEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYH  440

Query  382  YSHPPLVERLAAID-EPDKKTD**VEQPHAP  293
            YSHP L ERL A+  +  K TD   E    P
Sbjct  441  YSHPILTERLKALGWQGGKVTDAKTEDSERP  471



>ref|XP_006737576.1| PREDICTED: CAAX prenyl protease 1 homolog [Leptonychotes weddellii]
Length=475

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 2/135 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFET-QPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF T QP LIGL IIFQ  
Sbjct  336  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYTSQPTLIGLLIIFQFI  395

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  396  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  455

Query  385  HYSHPPLVERLAAID  341
            HYSHPPL+ERL A++
Sbjct  456  HYSHPPLLERLQALE  470



>gb|KEY76113.1| CaaX prenyl protease Ste24 [Aspergillus fumigatus var. RP-2014]
Length=456

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGLIIFQHTV  563
            ELGHW L HT   F   Q   F  F  +++  N+K L+QSFGF +  P++IG ++F   +
Sbjct  298  ELGHWSLGHTTKLFAIAQSHMFYIFALFSVFVNNKSLYQSFGFHQEMPIMIGFLLFSDAL  357

Query  562  IPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYH  383
             P+  +V   +N++SR FEF+ADAFA KLGY+  L A L+KLQ +NLS M+ D  Y++YH
Sbjct  358  APMDAVVKLLMNVLSRKFEFEADAFAVKLGYSEQLAASLLKLQIQNLSTMDADWMYASYH  417

Query  382  YSHPPLVERLAAID-EPDKKTD**VEQPHAP  293
            YSHP L ERL A+  +  K TD   E    P
Sbjct  418  YSHPILTERLKALGWQGGKVTDAKTEDSERP  448



>gb|KFP02851.1| CAAX prenyl protease 1, partial [Calypte anna]
Length=427

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 96/140 (69%), Gaps = 4/140 (3%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   ++LF +FGF +TQP LIGL IIFQ  
Sbjct  288  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDTQPTLIGLMIIFQFI  347

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAK+LG A  L + L+KL ++NL    +D  +S +
Sbjct  348  FSPYNEVLSFCLTVLSRQFEFQADAFAKELGKAKDLYSALIKLNKDNLGFPVSDWIFSMW  407

Query  385  HYSHPPLVERLAAIDEPDKK  326
            HYSHPPL+ERL A+   DKK
Sbjct  408  HYSHPPLLERLQALK--DKK  425



>gb|ELK19500.1| CAAX prenyl protease 1 like protein [Pteropus alecto]
Length=396

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGF-ETQPVLIGL-IIFQHT  566
            ELGHWKL HT+ + I  Q+ +FL F  + ++   K+LF +FGF ++QP LIGL IIFQ  
Sbjct  257  ELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI  316

Query  565  VIPLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAY  386
              P   ++SF L ++SR FEFQADAFAKKLG A  L + L+KL ++NL    +D  +S +
Sbjct  317  FSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMW  376

Query  385  HYSHPPLVERLAAI  344
            HYSHPPL+ERL A+
Sbjct  377  HYSHPPLLERLQAL  390



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 93/148 (63%), Gaps = 10/148 (7%)
 Frame = -3

Query  739  ELGHWKLNHTMYSFIAVQILTFLQFGGYTLVRNSKDLFQSFGFETQPVLIGLIIFQHTVI  560
            ELGHWK+ HT+   I  QI     F  ++L  N+K L+  FGF+T P LIG ++FQ    
Sbjct  291  ELGHWKMGHTLKLLIVNQIHLLSIFWLFSLFINNKQLYTDFGFDTMPTLIGFMLFQFIYS  350

Query  559  PLQHLVSFGLNLVSRAFEFQADAFAKKLGYALPLRAGLVKLQEENLSAMNTDPWYSAYHY  380
            P++ ++ F  ++  R  E++ADA+A KLGYA  LR+ L+KL  +NL   N DPWYSA+++
Sbjct  351  PVESVIGFLQHVYQRKNEYEADAYALKLGYASTLRSALIKLSVKNLGGFNVDPWYSAWNH  410

Query  379  SHPPLVERLAAI------DEP----DKK  326
            SHP LVERL A+      D+P    DKK
Sbjct  411  SHPSLVERLNALGVEPTSDKPITVEDKK  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210