BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012O11

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFW63178.1|  putative DEAD-box ATP-dependent RNA helicase fami...    118   1e-29   
ref|NP_001132565.1|  uncharacterized protein LOC100194030               115   1e-28   
gb|ADV04059.1|  DEAD/DEAH box helicase 8                                117   3e-28   Hevea brasiliensis [jebe]
gb|EPS59687.1|  hypothetical protein M569_15121                         112   5e-28   Genlisea aurea
ref|XP_010236834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   5e-28   
ref|XP_008339750.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   7e-28   
gb|EMT21717.1|  DEAD-box ATP-dependent RNA helicase 8                   119   8e-28   
ref|XP_008376043.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   1e-27   
ref|XP_002987276.1|  hypothetical protein SELMODRAFT_158648             118   1e-27   
ref|NP_001148960.1|  ATP-dependent RNA helicase dhh1                    119   1e-27   
gb|ACG29146.1|  ATP-dependent RNA helicase dhh1                         119   2e-27   Zea mays [maize]
ref|XP_002320116.2|  hypothetical protein POPTR_0014s07690g             119   2e-27   
dbj|BAJ90747.1|  predicted protein                                      119   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011023369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-27   Populus euphratica
ref|XP_011035912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-27   Populus euphratica
ref|XP_011093152.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    119   2e-27   
ref|XP_004953257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    119   2e-27   Setaria italica
dbj|BAH19526.1|  AT4G00660                                              117   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACL52527.1|  unknown                                                 116   2e-27   Zea mays [maize]
ref|XP_011091933.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    118   2e-27   Sesamum indicum [beniseed]
ref|XP_007051859.1|  RNAhelicase-like 8 isoform 2                       117   2e-27   
ref|NP_001047552.1|  Os02g0641800                                       118   3e-27   
ref|XP_010544383.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_010540276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   3e-27   
gb|KJB22345.1|  hypothetical protein B456_004G042200                    117   3e-27   Gossypium raimondii
ref|XP_009611007.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   3e-27   Nicotiana tomentosiformis
sp|Q6H7S2.2|RH8_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA h...    118   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009757253.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    118   3e-27   Nicotiana sylvestris
gb|KHN29373.1|  DEAD-box ATP-dependent RNA helicase 8                   117   4e-27   Glycine soja [wild soybean]
gb|KJB24711.1|  hypothetical protein B456_004G1574001                   117   4e-27   Gossypium raimondii
ref|XP_010105971.1|  DEAD-box ATP-dependent RNA helicase 8              117   4e-27   
emb|CDY51147.1|  BnaA09g51820D                                          117   5e-27   Brassica napus [oilseed rape]
ref|XP_009111462.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   5e-27   Brassica rapa
gb|EAY94957.1|  hypothetical protein OsI_16765                          117   5e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_006396262.1|  hypothetical protein EUTSA_v10028588mg             117   5e-27   Eutrema salsugineum [saltwater cress]
gb|KJB09834.1|  hypothetical protein B456_001G169800                    117   6e-27   Gossypium raimondii
ref|XP_009134538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   6e-27   Brassica rapa
gb|KHG12667.1|  DEAD-box ATP-dependent RNA helicase 8 -like protein     117   6e-27   Gossypium arboreum [tree cotton]
gb|KHG21931.1|  DEAD-box ATP-dependent RNA helicase 8                   117   6e-27   Gossypium arboreum [tree cotton]
gb|KHG21932.1|  DEAD-box ATP-dependent RNA helicase 8                   117   6e-27   Gossypium arboreum [tree cotton]
ref|XP_010456256.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   7e-27   Camelina sativa [gold-of-pleasure]
emb|CDX74342.1|  BnaA03g27050D                                          117   7e-27   
ref|XP_006287568.1|  hypothetical protein CARUB_v10000779mg             117   7e-27   Capsella rubella
gb|KDP28654.1|  hypothetical protein JCGZ_14425                         117   7e-27   Jatropha curcas
emb|CBI40324.3|  unnamed protein product                                117   7e-27   Vitis vinifera
gb|KJB22343.1|  hypothetical protein B456_004G042200                    117   8e-27   Gossypium raimondii
ref|XP_006445089.1|  hypothetical protein CICLE_v10019858mg             117   8e-27   Citrus clementina [clementine]
emb|CDP08841.1|  unnamed protein product                                117   8e-27   Coffea canephora [robusta coffee]
ref|XP_007220665.1|  hypothetical protein PRUPE_ppa004633mg             117   8e-27   Prunus persica
ref|XP_007051858.1|  RNAhelicase-like 8 isoform 1                       117   8e-27   
ref|XP_002511831.1|  dead box ATP-dependent RNA helicase, putative      117   8e-27   Ricinus communis
gb|KHF99913.1|  DEAD-box ATP-dependent RNA helicase 8                   117   8e-27   Gossypium arboreum [tree cotton]
ref|XP_010273108.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   8e-27   Nelumbo nucifera [Indian lotus]
gb|KJB41288.1|  hypothetical protein B456_007G097600                    117   8e-27   Gossypium raimondii
emb|CDX91901.1|  BnaC03g32030D                                          117   8e-27   
ref|XP_008438061.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   8e-27   Cucumis melo [Oriental melon]
ref|XP_009340166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   9e-27   Pyrus x bretschneideri [bai li]
ref|XP_004133869.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   9e-27   Cucumis sativus [cucumbers]
ref|XP_004306806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   9e-27   Fragaria vesca subsp. vesca
ref|XP_002875020.1|  hypothetical protein ARALYDRAFT_490504             117   9e-27   
ref|XP_010053686.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   9e-27   Eucalyptus grandis [rose gum]
emb|CAA09199.1|  RNA helicase                                           117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191975.2|  DEAD-box ATP-dependent RNA helicase 8                 117   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270379.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-26   Vitis vinifera
gb|AAC13628.1|  similar to ATP-dependent RNA helicases                  116   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006587858.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-26   
ref|XP_006827696.1|  hypothetical protein AMTR_s00009p00258110          116   1e-26   Amborella trichopoda
ref|XP_006341720.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-26   Solanum tuberosum [potatoes]
ref|XP_004248580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   1e-26   Solanum lycopersicum
gb|KGN56528.1|  Dead box ATP-dependent RNA helicase                     117   1e-26   Cucumis sativus [cucumbers]
ref|XP_002301349.1|  DEAD/DEAH box helicase family protein              116   1e-26   
ref|NP_001053408.1|  Os04g0533000                                       116   1e-26   
ref|XP_007139882.1|  hypothetical protein PHAVU_008G066400g             116   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006652567.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    116   1e-26   Oryza brachyantha
ref|XP_004976343.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-26   Setaria italica
gb|EMS61023.1|  DEAD-box ATP-dependent RNA helicase 8                   115   2e-26   Triticum urartu
ref|XP_008681228.1|  PREDICTED: uncharacterized protein LOC100194...    116   2e-26   
ref|XP_006587857.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    116   2e-26   Glycine max [soybeans]
ref|XP_008681227.1|  PREDICTED: uncharacterized protein LOC100194...    116   2e-26   
emb|CBI34696.3|  unnamed protein product                                115   2e-26   Vitis vinifera
emb|CDY07205.1|  BnaCnng02200D                                          115   2e-26   
ref|XP_004240107.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   3e-26   Solanum lycopersicum
ref|XP_007135053.1|  hypothetical protein PHAVU_010G0977000g            114   3e-26   Phaseolus vulgaris [French bean]
ref|XP_006345594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   3e-26   Solanum tuberosum [potatoes]
ref|XP_001765911.1|  predicted protein                                  114   3e-26   
ref|XP_009794053.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   3e-26   Nicotiana sylvestris
ref|XP_007135054.1|  hypothetical protein PHAVU_010G0977000g            114   3e-26   Phaseolus vulgaris [French bean]
ref|XP_004510805.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    115   4e-26   Cicer arietinum [garbanzo]
gb|EYU32082.1|  hypothetical protein MIMGU_mgv1a005052mg                115   4e-26   Erythranthe guttata [common monkey flower]
ref|XP_001766771.1|  predicted protein                                  114   4e-26   
ref|XP_010513761.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010255444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_002271357.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   5e-26   Vitis vinifera
dbj|BAJ94923.1|  predicted protein                                      114   6e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010676491.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   7e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN27312.1|  DEAD-box ATP-dependent RNA helicase 8                   114   7e-26   Glycine soja [wild soybean]
gb|EYU35077.1|  hypothetical protein MIMGU_mgv1a005045mg                114   7e-26   Erythranthe guttata [common monkey flower]
ref|XP_003580213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   7e-26   Brachypodium distachyon [annual false brome]
ref|XP_009384494.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   8e-26   
gb|EMT23815.1|  DEAD-box ATP-dependent RNA helicase 6                   114   8e-26   
ref|XP_003623900.1|  DEAD-box ATP-dependent RNA helicase                114   9e-26   Medicago truncatula
gb|ABG66172.1|  ATP-dependent RNA helicase ste13, putative, expre...    113   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010940461.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   9e-26   Elaeis guineensis
ref|XP_004492712.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   1e-25   Cicer arietinum [garbanzo]
ref|XP_010671975.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   1e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN04661.1|  DEAD-box ATP-dependent RNA helicase 8                   113   1e-25   Glycine soja [wild soybean]
gb|KHN04659.1|  DEAD-box ATP-dependent RNA helicase 8                   113   1e-25   Glycine soja [wild soybean]
gb|AES80120.2|  DEAD-box ATP-dependent RNA helicase-like protein        114   1e-25   Medicago truncatula
ref|XP_003528863.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Glycine max [soybeans]
emb|CDY54061.1|  BnaA02g36470D                                          112   2e-25   Brassica napus [oilseed rape]
ref|XP_003623903.1|  DEAD-box ATP-dependent RNA helicase                113   2e-25   Medicago truncatula
ref|XP_003623902.1|  DEAD-box ATP-dependent RNA helicase                114   2e-25   
ref|XP_003521117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Glycine max [soybeans]
ref|XP_006662493.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   
ref|XP_006339542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Solanum tuberosum [potatoes]
gb|KHN27313.1|  DEAD-box ATP-dependent RNA helicase 8                   113   2e-25   Glycine soja [wild soybean]
ref|XP_006848084.1|  hypothetical protein AMTR_s00029p00205680          112   2e-25   Amborella trichopoda
ref|XP_003528862.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Glycine max [soybeans]
ref|XP_006576347.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Glycine max [soybeans]
ref|XP_006576348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   
ref|XP_009389244.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004229903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   2e-25   Solanum lycopersicum
emb|CDP09769.1|  unnamed protein product                                113   2e-25   Coffea canephora [robusta coffee]
gb|ABR16163.1|  unknown                                                 112   3e-25   Picea sitchensis
sp|Q109G2.2|RH12_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    113   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67267.1|  hypothetical protein OsI_34232                          113   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006583310.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   3e-25   
ref|NP_001065000.2|  Os10g0503700                                       112   3e-25   
ref|XP_009408278.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005831668.1|  hypothetical protein GUITHDRAFT_71963              112   3e-25   Guillardia theta CCMP2712
emb|CAA09198.1|  RNA helicase                                           106   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794179.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   6e-25   
emb|CDY45702.1|  BnaCnng13670D                                          108   8e-25   Brassica napus [oilseed rape]
ref|XP_010908424.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   9e-25   Elaeis guineensis
ref|XP_004982679.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    111   9e-25   
ref|XP_010905111.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    111   9e-25   Elaeis guineensis
ref|XP_002464412.1|  hypothetical protein SORBIDRAFT_01g017760          111   1e-24   
ref|NP_001150170.1|  ATP-dependent RNA helicase dhh1                    111   1e-24   
ref|XP_002464413.1|  hypothetical protein SORBIDRAFT_01g017770          111   1e-24   Sorghum bicolor [broomcorn]
gb|KDD74992.1|  DEAD/DEAH box helicase                                  110   1e-24   Helicosporidium sp. ATCC 50920
ref|NP_001140760.1|  putative DEAD-box ATP-dependent RNA helicase...    111   1e-24   Zea mays [maize]
ref|XP_005849570.1|  hypothetical protein CHLNCDRAFT_56077              110   1e-24   Chlorella variabilis
ref|XP_008794547.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    110   1e-24   Phoenix dactylifera
ref|XP_005646927.1|  cytoplasmic DExD/H-box RNA helicase                110   2e-24   Coccomyxa subellipsoidea C-169
ref|XP_002769152.1|  ATP-dependent RNA helicase, putative               107   2e-24   Perkinsus marinus ATCC 50983
emb|CDY48935.1|  BnaA09g39020D                                          110   2e-24   Brassica napus [oilseed rape]
ref|XP_008873462.1|  DEAD-box ATP-dependent RNA helicase 6              109   2e-24   Aphanomyces invadans
gb|KDO28289.1|  DEAD-box ATP-dependent RNA helicase 8                   109   2e-24   Saprolegnia parasitica CBS 223.65
gb|EYU29737.1|  hypothetical protein MIMGU_mgv1a005117mg                110   2e-24   Erythranthe guttata [common monkey flower]
ref|XP_008605548.1|  DEAD-box ATP-dependent RNA helicase 8              109   2e-24   Saprolegnia diclina VS20
gb|EMT21677.1|  DEAD-box ATP-dependent RNA helicase 12                  110   3e-24   
ref|XP_009829781.1|  DEAD-box ATP-dependent RNA helicase 8              109   3e-24   Aphanomyces astaci
ref|XP_009116788.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   3e-24   
ref|XP_002876600.1|  hypothetical protein ARALYDRAFT_486601             110   3e-24   
emb|CDX71756.1|  BnaC08g31180D                                          109   3e-24   
emb|CAA09203.1|  RNA helicase                                           109   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005855068.1|  hypothetical protein NGA_0350100                   104   3e-24   Nannochloropsis gaditana CCMP526
ref|NP_191683.1|  DEAD-box ATP-dependent RNA helicase 12                109   4e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778709.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   4e-24   Phoenix dactylifera
ref|XP_006290970.1|  hypothetical protein CARUB_v10017085mg             109   4e-24   Capsella rubella
ref|XP_009104295.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   4e-24   Brassica rapa
ref|XP_010413440.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010469048.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010512458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    109   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002769153.1|  RNA helicase, putative                             108   6e-24   Perkinsus marinus ATCC 50983
ref|XP_002771414.1|  RNA helicase, putative                             108   6e-24   Perkinsus marinus ATCC 50983
ref|XP_002771413.1|  RNA helicase, putative                             108   6e-24   Perkinsus marinus ATCC 50983
ref|XP_002909411.1|  DEAD/DEAH box RNA helicase, putative               108   6e-24   Phytophthora infestans T30-4
ref|XP_002767329.1|  RNA helicase, putative                             108   7e-24   Perkinsus marinus ATCC 50983
ref|XP_003294872.1|  hypothetical protein DICPUDRAFT_93301              108   7e-24   Dictyostelium purpureum
ref|XP_002767330.1|  DEAD box ATP-dependent RNA helicase, putative      107   7e-24   Perkinsus marinus ATCC 50983
ref|XP_009514016.1|  hypothetical protein PHYSODRAFT_283996             108   7e-24   Phytophthora sojae
ref|XP_629938.1|  hypothetical protein DDB_G0291804                     108   8e-24   Dictyostelium discoideum AX4
ref|XP_009400273.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ95381.1|  predicted protein                                      108   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006402503.1|  hypothetical protein EUTSA_v10005922mg             108   1e-23   Eutrema salsugineum [saltwater cress]
ref|XP_010234885.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    108   1e-23   Brachypodium distachyon [annual false brome]
ref|XP_004336605.1|  atpdependent rna helicase ddx6, putative           107   2e-23   Acanthamoeba castellanii str. Neff
ref|XP_008913632.1|  DEAD-box ATP-dependent RNA helicase 8              107   2e-23   Phytophthora parasitica INRA-310
ref|XP_011129036.1|  putative DEAD box ATP-dependent RNA helicase       106   2e-23   Gregarina niphandrodes
emb|CCI48817.1|  unnamed protein product                                106   3e-23   Albugo candida
gb|EJU02445.1|  DEAD-domain-containing protein                          107   3e-23   Dacryopinax primogenitus
emb|CCA22119.1|  predicted protein putative                             106   3e-23   Albugo laibachii Nc14
dbj|GAM18218.1|  hypothetical protein SAMD00019534_013930               105   4e-23   Acytostelium subglobosum LB1
ref|XP_006397768.1|  hypothetical protein EUTSA_v10001405mg             105   4e-23   
ref|XP_004350316.1|  putative RNA helicase                              105   5e-23   Cavenderia fasciculata
ref|NP_182105.1|  DEAD-box ATP-dependent RNA helicase 6                 106   6e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDY58787.1|  BnaA07g38020D                                          106   6e-23   Brassica napus [oilseed rape]
gb|AAK63966.1|  At2g45810/F4I18.21                                      106   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880201.1|  hypothetical protein ARALYDRAFT_483719             106   6e-23   
dbj|GAM20363.1|  hypothetical protein SAMD00019534_035380               105   6e-23   Acytostelium subglobosum LB1
gb|EWM20640.1|  RNA helicase,ATP-dependent, DEAD-box type               105   7e-23   Nannochloropsis gaditana
emb|CCO29368.1|  ATP-dependent RNA helicase DDX6/DHH1                   101   8e-23   Rhizoctonia solani AG-1 IB
ref|XP_001881258.1|  predicted protein                                  105   9e-23   Laccaria bicolor S238N-H82
gb|KFG56064.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6             104   1e-22   Toxoplasma gondii FOU
gb|EFZ13584.1|  hypothetical protein SINV_12815                       99.0    1e-22   
emb|CCL98213.1|  predicted protein                                      105   1e-22   Fibroporia radiculosa
gb|EUC65189.1|  ATP-dependent RNA helicase dhh1                         103   1e-22   Rhizoctonia solani AG-3 Rhs1AP
gb|EIE82813.1|  ATP-dependent RNA helicase dhh1                         104   1e-22   Rhizopus delemar RA 99-880
ref|XP_010518223.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   1e-22   Camelina sativa [gold-of-pleasure]
gb|KIO14251.1|  hypothetical protein M404DRAFT_12103                    105   1e-22   Pisolithus tinctorius Marx 270
emb|CDY27357.1|  BnaC04g50480D                                          105   1e-22   Brassica napus [oilseed rape]
emb|CEP17217.1|  hypothetical protein                                   105   1e-22   Parasitella parasitica
ref|XP_002473400.1|  eukaryotic translation initiation factor 4A-...    105   1e-22   
emb|CEG81286.1|  Putative Atp-dependent rna helicase dhh1               105   1e-22   Rhizopus microsporus
emb|CDY37067.1|  BnaA04g26450D                                          105   1e-22   Brassica napus [oilseed rape]
ref|XP_010506559.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   1e-22   Camelina sativa [gold-of-pleasure]
gb|EFN88325.1|  Putative ATP-dependent RNA helicase me31b             98.6    2e-22   Harpegnathos saltator
emb|CEI85652.1|  Putative DEAD/DEAH box helicase                        105   2e-22   Rhizopus microsporus
ref|XP_007719915.1|  ATP-dependent RNA helicase DHH1                    105   2e-22   Capronia coronata CBS 617.96
ref|XP_002164714.2|  PREDICTED: probable ATP-dependent RNA helica...    104   2e-22   Hydra vulgaris
ref|XP_009142369.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   2e-22   Brassica rapa
ref|XP_002951166.1|  DEAD-box RNA helicase, ATP-dependent, cytopl...    103   2e-22   Volvox carteri f. nagariensis
ref|XP_006294022.1|  hypothetical protein CARUB_v10023015mg             105   2e-22   Capsella rubella
ref|XP_001692202.1|  cytoplasmic DExD/H-box RNA helicase                103   2e-22   Chlamydomonas reinhardtii
ref|XP_003062040.1|  predicted protein                                  103   2e-22   Micromonas pusilla CCMP1545
ref|XP_010508105.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    105   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007731184.1|  ATP-dependent RNA helicase DHH1                    105   2e-22   Capronia epimyces CBS 606.96
ref|XP_006397771.1|  hypothetical protein EUTSA_v10001405mg             105   2e-22   
gb|EPB90373.1|  ATP-dependent RNA helicase dhh1                         105   2e-22   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG63343.1|  Putative Atp-dependent rna helicase dhh1               105   2e-22   Rhizopus microsporus
ref|XP_008042303.1|  DEAD-domain-containing protein                     104   2e-22   Trametes versicolor FP-101664 SS1
dbj|GAN00930.1|  conserved hypothetical protein                         104   2e-22   Mucor ambiguus
gb|KIJ36696.1|  hypothetical protein M422DRAFT_232268                   105   2e-22   Sphaerobolus stellatus SS14
ref|XP_007384334.1|  DEAD-domain-containing protein                     104   2e-22   Punctularia strigosozonata HHB-11173 SS5
ref|XP_007393350.1|  hypothetical protein PHACADRAFT_182411             103   2e-22   Phanerochaete carnosa HHB-10118-sp
gb|KIJ98785.1|  hypothetical protein K443DRAFT_194552                   104   2e-22   Laccaria amethystina LaAM-08-1
gb|KJA23157.1|  hypothetical protein HYPSUDRAFT_138278                  104   3e-22   Hypholoma sublateritium FD-334 SS-4
ref|XP_001832628.1|  ATP-dependent RNA helicase dhh1                    104   3e-22   Coprinopsis cinerea okayama7#130
ref|XP_009268120.1|  ATP-dependent RNA helicase dhh1                    104   3e-22   Wallemia ichthyophaga EXF-994
gb|KIM70603.1|  hypothetical protein SCLCIDRAFT_156787                  104   3e-22   Scleroderma citrinum Foug A
emb|CDJ38983.1|  ATP-dependent RNA helicase, putative                   103   3e-22   Eimeria tenella
gb|EMD35619.1|  hypothetical protein CERSUDRAFT_96734                   104   3e-22   Gelatoporia subvermispora B
emb|CBJ26145.1|  DEAD box helicase                                      102   3e-22   Ectocarpus siliculosus
emb|CDJ63514.1|  ATP-dependent RNA helicase, putative                   103   3e-22   Eimeria necatrix
gb|EPB84122.1|  ATP-dependent RNA helicase DHH1                         104   3e-22   Mucor circinelloides f. circinelloides 1006PhL
emb|CEG82997.1|  Putative ATP-dependent RNA helicase DHH1               104   3e-22   Rhizopus microsporus
dbj|GAN04011.1|  eukaryotic translation initiation factor 4A-like...    104   3e-22   Mucor ambiguus
dbj|GAC99235.1|  hypothetical protein PHSY_006835                       106   3e-22   Pseudozyma hubeiensis SY62
ref|XP_002677495.1|  dead box ATP-dependent RNA helicase                105   3e-22   Naegleria gruberi strain NEG-M
emb|CEJ02025.1|  Putative ATP-dependent RNA helicase DHH1               104   3e-22   Rhizopus microsporus
emb|CEG71520.1|  Putative ATP-dependent RNA helicase DHH1               104   3e-22   Rhizopus microsporus
gb|ESA01456.1|  hypothetical protein GLOINDRAFT_333744                  104   3e-22   
gb|KIW14976.1|  ATP-dependent RNA helicase DHH1                         104   3e-22   Exophiala spinifera
emb|CEI93304.1|  Putative ATP-dependent RNA helicase DHH1               104   3e-22   Rhizopus microsporus
emb|CDJ30776.1|  ATP-dependent RNA helicase, putative                   103   3e-22   Eimeria mitis
ref|XP_007272025.1|  DEAD-domain-containing protein                     104   3e-22   Fomitiporia mediterranea MF3/22
ref|XP_009549682.1|  hypothetical protein HETIRDRAFT_67389              103   4e-22   Heterobasidion irregulare TC 32-1
ref|XP_009158872.1|  ATP-dependent RNA helicase dhh1                    104   4e-22   Exophiala dermatitidis NIH/UT8656
gb|EIE81845.1|  ATP-dependent RNA helicase DHH1                         104   4e-22   Rhizopus delemar RA 99-880
emb|CDO74578.1|  hypothetical protein BN946_scf184583.g5                103   4e-22   Trametes cinnabarina
gb|EIE83902.1|  ATP-dependent RNA helicase DHH1                         104   4e-22   Rhizopus delemar RA 99-880
ref|XP_005780551.1|  hypothetical protein EMIHUDRAFT_73141              103   4e-22   Emiliania huxleyi CCMP1516
ref|XP_008720081.1|  ATP-dependent RNA helicase dhh1                    104   4e-22   Cyphellophora europaea CBS 101466
emb|CEI99706.1|  Putative DEAD/DEAH box helicase                        103   4e-22   Rhizopus microsporus
gb|KDQ31787.1|  hypothetical protein PLEOSDRAFT_22618                   103   4e-22   Pleurotus ostreatus PC15
ref|XP_007301961.1|  DEAD-domain-containing protein                     104   4e-22   Stereum hirsutum FP-91666 SS1
ref|XP_007331967.1|  hypothetical protein AGABI1DRAFT_115242            103   4e-22   Agaricus bisporus var. burnettii JB137-S8
gb|KDQ58786.1|  hypothetical protein JAAARDRAFT_34642                   104   5e-22   Jaapia argillacea MUCL 33604
ref|XP_008883618.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6        103   5e-22   
ref|XP_003885240.1|  Eukaryotic initiation factor, related              103   5e-22   Neospora caninum Liverpool
gb|KIW61171.1|  ATP-dependent RNA helicase dhh1                         103   5e-22   Exophiala xenobiotica
emb|CDJ48750.1|  ATP-dependent RNA helicase, putative                   102   5e-22   Eimeria brunetti
gb|EPR60983.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6             103   5e-22   Toxoplasma gondii GT1
gb|KIV96660.1|  ATP-dependent RNA helicase DHH1                         103   5e-22   Exophiala mesophila
ref|XP_002364513.1|  ATP-dependent RNA helicase, putative               103   5e-22   
gb|KIV81870.1|  ATP-dependent RNA helicase dhh1                         103   5e-22   Exophiala sideris
ref|XP_006463363.1|  hypothetical protein AGABI2DRAFT_194203            103   5e-22   Agaricus bisporus var. bisporus H97
emb|CDI86265.1|  ATP-dependent RNA helicase, putative                   102   5e-22   Eimeria praecox
ref|XP_009033849.1|  hypothetical protein AURANDRAFT_52587              102   5e-22   Aureococcus anophagefferens
gb|EPS95261.1|  hypothetical protein FOMPIDRAFT_101552                  103   5e-22   Fomitopsis pinicola FP-58527 SS1
emb|CEP14076.1|  hypothetical protein                                   103   6e-22   Parasitella parasitica
ref|XP_006681354.1|  hypothetical protein BATDEDRAFT_20569              102   6e-22   Batrachochytrium dendrobatidis JAM81
ref|XP_007367461.1|  eukaryotic translation initiation factor 4A-...    103   6e-22   Dichomitus squalens LYAD-421 SS1
ref|XP_007869359.1|  eukaryotic translation initiation factor 4A-...    103   6e-22   Gloeophyllum trabeum ATCC 11539
gb|KIK36386.1|  hypothetical protein CY34DRAFT_811305                   103   6e-22   Suillus luteus UH-Slu-Lm8-n1
gb|EST04933.1|  ATP-dependent RNA helicase                              103   6e-22   Kalmanozyma brasiliensis GHG001
gb|KDR80281.1|  hypothetical protein GALMADRAFT_136789                  103   6e-22   Galerina marginata CBS 339.88
gb|KEP55787.1|  ATP-dependent RNA helicase dhh1                         103   6e-22   Rhizoctonia solani 123E
gb|KIM91499.1|  hypothetical protein PILCRDRAFT_669                     103   6e-22   
dbj|GAC75080.1|  ATP-dependent RNA helicase                             103   7e-22   
ref|XP_007882290.1|  hypothetical protein PFL1_06556                    103   7e-22   
ref|XP_003027845.1|  hypothetical protein SCHCODRAFT_70659              102   7e-22   
ref|XP_002508100.1|  DEAD/DEAH box helicase                             103   7e-22   
dbj|GAK64657.1|  eukaryotic translation initiation factor 4A-like...    103   7e-22   
gb|ETS59938.1|  hypothetical protein PaG_05919                          103   7e-22   
ref|XP_011389806.1|  putative DExD/H-box ATP-dependent RNA helica...    103   7e-22   
gb|KEF62095.1|  ATP-dependent RNA helicase DHH1                         103   7e-22   
gb|KFH66615.1|  ATP-dependent RNA helicase dhh1                         103   7e-22   
gb|ELU41871.1|  ATP dependent RNA helicase (Dhh1), putative             102   7e-22   
gb|EGO03765.1|  hypothetical protein SERLA73DRAFT_83896                 102   8e-22   
ref|XP_005710129.1|  unnamed protein product                            102   8e-22   
gb|KII87922.1|  hypothetical protein PLICRDRAFT_54962                   103   8e-22   
emb|CCF52042.1|  probable ATP-dependent RNA helicase DHH1               103   8e-22   
emb|CBQ73743.1|  probable ATP-dependent RNA helicase DHH1               103   8e-22   
emb|CDJ58680.1|  ATP-dependent RNA helicase, putative                   102   8e-22   
gb|EPZ36415.1|  putative ATP-dependent RNA helicase ddx6                102   8e-22   
gb|KEQ91251.1|  hypothetical protein AUEXF2481DRAFT_70100               103   8e-22   
ref|XP_007672754.1|  hypothetical protein BAUCODRAFT_371348             103   9e-22   
gb|KIJ61858.1|  hypothetical protein HYDPIDRAFT_137104                  102   9e-22   
gb|KEQ69618.1|  DEAD-domain-containing protein                          103   9e-22   
gb|KIM24760.1|  hypothetical protein M408DRAFT_331594                   103   9e-22   
ref|XP_009042151.1|  hypothetical protein AURANDRAFT_39444              102   9e-22   
emb|CDI54154.1|  probable ATP-dependent RNA helicase DHH1               103   9e-22   
gb|KEQ62464.1|  DEAD-domain-containing protein                          103   9e-22   
gb|EFA85810.1|  putative RNA helicase                                   105   9e-22   
gb|KFH64831.1|  ATP-dependent RNA helicase dhh1                         103   9e-22   
gb|KIX01138.1|  ATP-dependent RNA helicase dhh1                         103   1e-21   
emb|CEL57930.1|  ATP-dependent RNA helicase DDX6/DHH1                   102   1e-21   
gb|KIP07293.1|  hypothetical protein PHLGIDRAFT_105879                  102   1e-21   
ref|XP_007850551.1|  atp-dependent rna helicase dhh1                    102   1e-21   
dbj|GAA99335.1|  hypothetical protein E5Q_06030                         104   1e-21   
gb|KEI39965.1|  hypothetical protein L969DRAFT_47510                    104   1e-21   
gb|KDN37738.1|  putative ATP-dependent RNA helicase DHH1                102   1e-21   
ref|XP_675212.1|  ATP-dependent RNA helicase                            101   1e-21   
ref|XP_007313871.1|  hypothetical protein SERLADRAFT_354128             102   1e-21   
ref|XP_007513343.1|  predicted protein                                  101   1e-21   
ref|XP_003848580.1|  hypothetical protein MYCGRDRAFT_101609             102   1e-21   
ref|XP_010544718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   2e-21   
gb|KIL61043.1|  hypothetical protein M378DRAFT_187630                   102   2e-21   
gb|EMS22443.1|  ATP-dependent rna helicase dhh1                         102   2e-21   
emb|CCA74550.1|  probable ATP-dependent RNA helicase DHH1               102   2e-21   
ref|XP_006957352.1|  DEAD-domain-containing protein                     102   2e-21   
gb|KIK34946.1|  hypothetical protein CY34DRAFT_97034                    100   2e-21   
gb|KEQ83372.1|  DEAD-domain-containing protein                          102   2e-21   
ref|XP_007352338.1|  DEAD-domain-containing protein                     102   2e-21   
gb|EGU12280.1|  ATP-dependent RNA helicase dhh1                         102   2e-21   
gb|KIO31446.1|  hypothetical protein M407DRAFT_5062                     102   2e-21   
gb|KIY70674.1|  DEAD-domain-containing protein                          101   2e-21   
ref|XP_668065.1|  ATP-dependent RNA helicase                            100   2e-21   
gb|KIM47033.1|  hypothetical protein M413DRAFT_16541                    102   2e-21   
gb|EGD94532.1|  ATP-dependent RNA helicase DHH1                         100   3e-21   
gb|KDQ06910.1|  hypothetical protein BOTBODRAFT_60364                   102   3e-21   
emb|CDR46917.1|  RHTO0S13e03356g1_1                                     102   3e-21   
gb|EPS67203.1|  hypothetical protein M569_07571                         101   3e-21   
ref|XP_001388425.1|  ATP-dependent RNA helicase                         100   3e-21   
ref|XP_008623418.1|  ATP-dependent RNA helicase ddx6                    100   3e-21   
ref|XP_742509.1|  ATP-dependent RNA helicase                            100   3e-21   
ref|XP_003010251.1|  hypothetical protein ARB_03506                     100   3e-21   
ref|XP_001270568.1|  ATP dependent RNA helicase (Dhh1), putative        101   3e-21   
gb|KIW87364.1|  ATP-dependent RNA helicase dhh1                         101   4e-21   
ref|XP_003237974.1|  ATP-dependent RNA helicase DHH1                    101   4e-21   
ref|XP_002584013.1|  hypothetical protein UREG_06980                    101   4e-21   
dbj|GAM83179.1|  hypothetical protein ANO11243_011650                   101   4e-21   
ref|XP_001395078.1|  ATP-dependent RNA helicase dhh1                    101   4e-21   
emb|CDH58577.1|  atp-dependent rna helicase dhh1                        101   4e-21   
ref|XP_007741840.1|  ATP-dependent RNA helicase DHH1                    101   4e-21   
ref|XP_008815898.1|  ATP-dependent RNA helicase ddx6                    100   4e-21   
gb|KIW74968.1|  ATP-dependent RNA helicase dhh1                         101   4e-21   
gb|EZF29913.1|  ATP-dependent RNA helicase dhh1                         101   4e-21   
gb|KDB22915.1|  ATP-dependent RNA helicase dhh1                         101   4e-21   
ref|XP_001248331.1|  conserved hypothetical protein                     101   4e-21   
ref|XP_001730716.1|  hypothetical protein MGL_2170                      101   4e-21   
gb|KIW28326.1|  ATP-dependent RNA helicase dhh1                         101   4e-21   
ref|XP_003065260.1|  ATP-dependent RNA helicase, putative               101   5e-21   
ref|XP_011139072.1|  PREDICTED: putative ATP-dependent RNA helica...    100   5e-21   
ref|XP_003173227.1|  ATP-dependent RNA helicase DHH1                    101   5e-21   
gb|EFW16869.1|  ATP-dependent RNA helicase dhh1                         101   5e-21   
ref|XP_729699.1|  ATP-dependent RNA Helicase                            100   5e-21   
emb|CCU99198.1|  unnamed protein product                                100   5e-21   
ref|XP_003018394.1|  hypothetical protein TRV_07588                     101   5e-21   
ref|XP_011335980.1|  PREDICTED: putative ATP-dependent RNA helica...    100   5e-21   
ref|XP_011166764.1|  PREDICTED: putative ATP-dependent RNA helica...    100   5e-21   
ref|XP_011062102.1|  PREDICTED: putative ATP-dependent RNA helica...    100   5e-21   
ref|XP_003704663.1|  PREDICTED: putative ATP-dependent RNA helica...    100   5e-21   
pdb|4CRW|B  Chain B, Complex Of Human Ddx6 (reca-c) And Cnot1 (mi...  97.1    5e-21   
gb|KIY02798.1|  ATP-dependent RNA helicase dhh1                         101   6e-21   
ref|XP_624586.2|  PREDICTED: putative ATP-dependent RNA helicase ...    100   6e-21   
ref|XP_003402776.1|  PREDICTED: putative ATP-dependent RNA helica...    100   6e-21   
gb|EHA20131.1|  hypothetical protein ASPNIDRAFT_209198                  102   6e-21   
ref|XP_011265969.1|  PREDICTED: putative ATP-dependent RNA helica...    100   6e-21   
ref|XP_001602897.1|  PREDICTED: putative ATP-dependent RNA helica...    100   6e-21   
ref|XP_008552788.1|  PREDICTED: putative ATP-dependent RNA helica...    100   6e-21   
emb|CDS11083.1|  Putative ATP-dependent RNA helicase DHH1               100   6e-21   
gb|ETW32271.1|  DEAD-box ATP-dependent RNA helicase 6                 99.0    6e-21   
gb|EFN61728.1|  Putative ATP-dependent RNA helicase me31b               100   6e-21   
gb|KFM58711.1|  putative ATP-dependent RNA helicase me31b               100   6e-21   
gb|KGO65462.1|  Helicase, C-terminal                                    100   6e-21   
emb|CDM32408.1|  ATP-dependent RNA helicase dhh1                        100   6e-21   
ref|XP_002563374.1|  Pc20g08510                                         100   6e-21   
gb|EKV16720.1|  hypothetical protein PDIG_19090                         100   6e-21   
ref|XP_002384265.1|  DEAD-box RNA helicase Dhh1/Vad1, putative          100   7e-21   
gb|EZA56181.1|  Putative ATP-dependent RNA helicase me31b               100   7e-21   
pdb|2WAX|A  Chain A, Structure Of The Human Ddx6 C-Terminal Domai...  97.1    7e-21   
gb|EPS26561.1|  hypothetical protein PDE_01498                          100   7e-21   
gb|ETW32773.1|  DEAD-box ATP-dependent RNA helicase 6                 99.0    7e-21   
gb|KGO36130.1|  Helicase, C-terminal                                    100   7e-21   
gb|EKV21927.1|  hypothetical protein PDIP_01520                         100   7e-21   
gb|KDE02539.1|  ATP-dependent RNA helicase dhh1                         100   8e-21   
gb|EKC23739.1|  Putative ATP-dependent RNA helicase DDX6              95.9    8e-21   
ref|XP_001614505.1|  ATP-dependent RNA helicase                       99.8    8e-21   
ref|XP_004222076.1|  ATP-dependent RNA helicase                       99.8    8e-21   
ref|XP_002258841.1|  ATP-dependent RNA helicase                       99.8    9e-21   
gb|KIK99181.1|  hypothetical protein PAXRUDRAFT_23846                   100   9e-21   
ref|XP_001824396.1|  ATP-dependent RNA helicase dhh1                    100   9e-21   
ref|XP_002843312.1|  ATP-dependent RNA helicase DHH1                  99.4    9e-21   
ref|XP_002490121.1|  Cytoplasmic DExD/H-box helicase                  99.8    1e-20   
gb|EAW67412.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...  98.6    1e-20   
gb|KIJ15927.1|  hypothetical protein PAXINDRAFT_168904                  100   1e-20   
ref|XP_661064.1|  hypothetical protein AN3460.2                         102   1e-20   
ref|XP_001263902.1|  ATP dependent RNA helicase (Dhh1), putative        100   1e-20   
gb|KIW43309.1|  ATP-dependent RNA helicase DHH1                         100   1e-20   
ref|XP_755058.1|  DEAD-box RNA helicase Dhh1/Vad1                       100   1e-20   
ref|XP_001351278.1|  ATP-dependent RNA Helicase, putative             99.0    1e-20   
tpe|CBF82660.1|  TPA: ATP-dependent RNA helicase (Eurofung)           99.8    1e-20   
emb|CDO62632.1|  ATP-dependent RNA helicase DDX6, putative            99.0    1e-20   
ref|XP_011111674.1|  hypothetical protein H072_5868                     100   1e-20   
ref|XP_008727205.1|  ATP-dependent RNA helicase DHH1                  99.8    1e-20   
ref|XP_007756258.1|  ATP-dependent RNA helicase DHH1                  99.8    1e-20   
pdb|4CT4|B  Chain B, Cnot1 Mif4g Domain - Ddx6 Complex                98.2    1e-20   
gb|AAB94769.1|  putative RNA helicase RCK                             99.0    1e-20   
ref|XP_011118775.1|  hypothetical protein AOL_s00007g573              99.8    2e-20   
gb|KIW69375.1|  ATP-dependent RNA helicase DHH1                       99.8    2e-20   
ref|XP_001217579.1|  hypothetical protein ATEG_08993                  99.8    2e-20   
ref|XP_007931640.1|  hypothetical protein MYCFIDRAFT_205331           99.8    2e-20   
gb|EHJ66501.1|  putative DEAD box ATP-dependent RNA helicase          99.0    2e-20   
gb|EIF47922.1|  cytoplasmic d h-box helicase                          98.2    2e-20   
emb|CCX07757.1|  Similar to ATP-dependent RNA helicase dhh1; acc....    100   2e-20   
gb|ESX02130.1|  ATP-dependent RNA helicase DHH1                       99.0    2e-20   
ref|XP_001418212.1|  predicted protein                                98.6    2e-20   
gb|ELW63222.1|  putative ATP-dependent RNA helicase DDX6              98.6    2e-20   
ref|XP_004052289.1|  PREDICTED: probable ATP-dependent RNA helica...  98.2    2e-20   
ref|XP_005704518.1|  ATP-dependent RNA helicase                       99.4    2e-20   
gb|KFX41877.1|  ATP-dependent RNA helicase dhh1                         101   2e-20   
gb|EPQ01790.1|  Putative ATP-dependent RNA helicase DDX6              98.6    2e-20   
ref|XP_001535985.1|  hypothetical protein HCAG_09069                  98.6    2e-20   
ref|XP_006741680.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    2e-20   
ref|XP_003079824.1|  putative RNA helicase (ISS)                      98.2    2e-20   
ref|XP_007771542.1|  DEAD-domain-containing protein                   98.6    2e-20   
gb|EPY88048.1|  putative ATP-dependent RNA helicase DDX6              98.6    2e-20   
gb|EMS59803.1|  DEAD-box ATP-dependent RNA helicase 12                99.0    2e-20   
ref|XP_001632003.1|  predicted protein                                98.2    2e-20   
dbj|GAD99861.1|  ATP-dependent RNA helicase DHH1                      99.4    2e-20   
ref|XP_002486388.1|  DEAD-box RNA helicase Dhh1/Vad1, putative        99.0    2e-20   
ref|XP_004456392.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    2e-20   
ref|XP_461495.1|  DEHA2F26598p                                        99.0    2e-20   
gb|KFV74826.1|  putative ATP-dependent RNA helicase DDX6              99.0    2e-20   
ref|XP_011315526.1|  PREDICTED: putative ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_009906613.1|  PREDICTED: probable ATP-dependent RNA helica...  99.0    3e-20   
ref|XP_006689634.1|  dead Box protein Dhh1p                           99.0    3e-20   
ref|XP_005271475.1|  PREDICTED: probable ATP-dependent RNA helica...  98.2    3e-20   
dbj|GAM43589.1|  ATP-dependent RNA helicase                           99.0    3e-20   
ref|XP_002152684.1|  DEAD-box RNA helicase Dhh1/Vad1, putative        99.0    3e-20   
ref|XP_002808135.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...  99.0    3e-20   
ref|XP_002620701.1|  ATP-dependent RNA helicase DHH1                  99.0    3e-20   
ref|NP_001102762.1|  probable ATP-dependent RNA helicase DDX6         99.0    3e-20   
gb|EAW67413.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...  98.6    3e-20   
dbj|BAA04482.1|  RCK                                                  98.6    3e-20   
ref|XP_003418301.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_001659287.1|  AAEL008500-PA                                    98.2    3e-20   
gb|EDL25604.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, isoform...  98.6    3e-20   
ref|XP_005069498.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_005058611.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_004427303.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_004016131.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_010007187.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_008498097.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_005500759.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|NP_031867.1|  probable ATP-dependent RNA helicase DDX6            98.6    3e-20   
gb|EMP33396.1|  Putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_011195447.1|  PREDICTED: putative ATP-dependent RNA helica...  98.2    3e-20   
gb|KFP05525.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_008936029.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|NP_001137339.1|  probable ATP-dependent RNA helicase DDX6         98.6    3e-20   
gb|EMC78306.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
gb|KFQ27323.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_008576061.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|NP_001006319.2|  probable ATP-dependent RNA helicase DDX6         98.6    3e-20   
ref|XP_011197588.1|  PREDICTED: putative ATP-dependent RNA helica...  98.2    3e-20   
gb|AAA28603.1|  RNA helicase                                          98.2    3e-20   
ref|NP_723539.1|  maternal expression at 31B, isoform B               97.8    3e-20   
ref|XP_010007469.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
gb|KFV08299.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
gb|KFQ45799.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_004712835.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|NP_001268976.1|  probable ATP-dependent RNA helicase DDX6 iso...  98.6    3e-20   
ref|XP_005191779.2|  PREDICTED: putative ATP-dependent RNA helica...  98.2    3e-20   
ref|XP_010073394.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_009566929.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_006890900.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_006120991.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_005856840.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
gb|EEH07818.1|  ATP-dependent RNA helicase DHH1                       99.0    3e-20   
ref|XP_009096029.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
gb|KFO81891.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_007424313.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_005299846.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_004385709.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_003129962.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_007654732.1|  PREDICTED: probable ATP-dependent RNA helica...  98.2    3e-20   
gb|KFW07901.1|  putative ATP-dependent RNA helicase DDX6              98.6    3e-20   
ref|XP_006037671.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_005142703.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
dbj|BAC35670.1|  unnamed protein product                              98.6    3e-20   
ref|XP_849975.1|  PREDICTED: probable ATP-dependent RNA helicase ...  98.6    3e-20   
gb|ETN65039.1|  DEAD box ATP-dependent RNA helicase                   98.2    3e-20   
gb|EER42776.1|  ATP-dependent RNA helicase DHH1                       99.0    3e-20   
ref|XP_004636497.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_004667445.1|  PREDICTED: probable ATP-dependent RNA helica...  98.6    3e-20   
ref|XP_004524166.1|  PREDICTED: putative ATP-dependent RNA helica...  98.2    3e-20   



>gb|AFW63178.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=109

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  53   SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  109



>ref|NP_001132565.1| uncharacterized protein LOC100194030 [Zea mays]
 gb|ACF81456.1| unknown [Zea mays]
Length=104

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  48   SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAIYCQ  104



>gb|ADV04059.1| DEAD/DEAH box helicase 8 [Hevea brasiliensis]
Length=200

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  144  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  200



>gb|EPS59687.1| hypothetical protein M569_15121, partial [Genlisea aurea]
Length=81

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP+IDQAIYC
Sbjct  25   SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPYIDQAIYC  80



>ref|XP_010236834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Brachypodium 
distachyon]
Length=313

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  257  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  313



>ref|XP_008339750.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=266

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  210  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  266



>gb|EMT21717.1| DEAD-box ATP-dependent RNA helicase 8 [Aegilops tauschii]
Length=426

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY IEQELGTEIKPIPP IDQAIYCQ
Sbjct  370  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYSIEQELGTEIKPIPPQIDQAIYCQ  426



>ref|XP_008376043.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Malus 
domestica]
Length=216

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  160  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  216



>ref|XP_002987276.1| hypothetical protein SELMODRAFT_158648 [Selaginella moellendorffii]
 ref|XP_002989208.1| hypothetical protein SELMODRAFT_235717 [Selaginella moellendorffii]
 gb|EFJ09802.1| hypothetical protein SELMODRAFT_235717 [Selaginella moellendorffii]
 gb|EFJ11591.1| hypothetical protein SELMODRAFT_158648 [Selaginella moellendorffii]
Length=362

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYC+
Sbjct  306  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCR  362



>ref|NP_001148960.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|ACG33648.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  461  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  517



>gb|ACG29146.1| ATP-dependent RNA helicase dhh1 [Zea mays]
Length=517

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  461  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  517



>ref|XP_002320116.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
 gb|EEE98431.2| hypothetical protein POPTR_0014s07690g [Populus trichocarpa]
Length=505

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  449  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  505



>dbj|BAJ90747.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=518

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  462  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  518



>ref|XP_011023369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
 ref|XP_011023370.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Populus 
euphratica]
Length=500

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  444  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  500



>ref|XP_011035912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
 ref|XP_011035920.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Populus euphratica]
Length=503

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  447  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  503



>ref|XP_011093152.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8-like [Sesamum indicum]
Length=489

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  433  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  489



>ref|XP_004953257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Setaria 
italica]
Length=517

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  461  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  517



>dbj|BAH19526.1| AT4G00660 [Arabidopsis thaliana]
Length=374

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  318  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  374



>gb|ACL52527.1| unknown [Zea mays]
 gb|AFW72524.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=275

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  219  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAIYCQ  275



>ref|XP_011091933.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
8 [Sesamum indicum]
Length=492

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  436  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  492



>ref|XP_007051859.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
 gb|EOX96016.1| RNAhelicase-like 8 isoform 2, partial [Theobroma cacao]
Length=356

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  300  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  356



>ref|NP_001047552.1| Os02g0641800 [Oryza sativa Japonica Group]
 dbj|BAD25227.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF09466.1| Os02g0641800 [Oryza sativa Japonica Group]
 gb|EEC73681.1| hypothetical protein OsI_08237 [Oryza sativa Indica Group]
Length=483

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  427  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  483



>ref|XP_010544383.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Tarenaya 
hassleriana]
Length=512

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  456  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  512



>ref|XP_010540276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
 ref|XP_010540277.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Tarenaya hassleriana]
Length=497

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  441  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  497



>gb|KJB22345.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
Length=362

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  306  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  362



>ref|XP_009611007.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
tomentosiformis]
Length=504

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  448  SETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  504



>sp|Q6H7S2.2|RH8_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Oryza sativa 
Japonica Group]
 dbj|BAD25226.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAG92832.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57460.1| hypothetical protein OsJ_07688 [Oryza sativa Japonica Group]
Length=508

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP IDQAIYCQ
Sbjct  452  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDQAIYCQ  508



>ref|XP_009757253.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nicotiana 
sylvestris]
Length=504

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  448  SETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  504



>gb|KHN29373.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=368

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  306  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  362



>gb|KJB24711.1| hypothetical protein B456_004G1574001, partial [Gossypium raimondii]
Length=382

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  326  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  382



>ref|XP_010105971.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
 gb|EXC06853.1| DEAD-box ATP-dependent RNA helicase 8 [Morus notabilis]
Length=436

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  338  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  394



>emb|CDY51147.1| BnaA09g51820D [Brassica napus]
Length=496

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  440  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  496



>ref|XP_009111462.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Brassica rapa]
Length=510

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  454  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  510



>gb|EAY94957.1| hypothetical protein OsI_16765 [Oryza sativa Indica Group]
Length=484

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AIYCQ
Sbjct  428  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYCQ  484



>ref|XP_006396262.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
 gb|ESQ37715.1| hypothetical protein EUTSA_v10028588mg [Eutrema salsugineum]
Length=512

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  456  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  512



>gb|KJB09834.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
 gb|KJB09835.1| hypothetical protein B456_001G169800 [Gossypium raimondii]
Length=499

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  443  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  499



>ref|XP_009134538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Brassica 
rapa]
Length=514

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  458  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  514



>gb|KHG12667.1| DEAD-box ATP-dependent RNA helicase 8 -like protein [Gossypium 
arboreum]
Length=493

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  437  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  493



>gb|KHG21931.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=529

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+ N
Sbjct  437  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCRVN  495



>gb|KHG21932.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=493

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  437  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  493



>ref|XP_010456256.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Camelina sativa]
Length=503

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  447  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  503



>emb|CDX74342.1| BnaA03g27050D [Brassica napus]
Length=514

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  458  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  514



>ref|XP_006287568.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
 gb|EOA20466.1| hypothetical protein CARUB_v10000779mg [Capsella rubella]
Length=502

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  446  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  502



>gb|KDP28654.1| hypothetical protein JCGZ_14425 [Jatropha curcas]
Length=500

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  444  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  500



>emb|CBI40324.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  416  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  472



>gb|KJB22343.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
 gb|KJB22344.1| hypothetical protein B456_004G042200 [Gossypium raimondii]
Length=490

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  434  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  490



>ref|XP_006445089.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 ref|XP_006491063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Citrus 
sinensis]
 gb|ESR58329.1| hypothetical protein CICLE_v10019858mg [Citrus clementina]
 gb|KDO86090.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
 gb|KDO86091.1| hypothetical protein CISIN_1g011065mg [Citrus sinensis]
Length=494

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  438  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  494



>emb|CDP08841.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  432  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  488



>ref|XP_007220665.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
 ref|XP_008232788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Prunus mume]
 gb|EMJ21864.1| hypothetical protein PRUPE_ppa004633mg [Prunus persica]
Length=499

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  443  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  499



>ref|XP_007051858.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
 gb|EOX96015.1| RNAhelicase-like 8 isoform 1 [Theobroma cacao]
Length=501

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  445  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  501



>ref|XP_002511831.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF50500.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=507

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  451  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  507



>gb|KHF99913.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
 gb|KHF99914.1| DEAD-box ATP-dependent RNA helicase 8 [Gossypium arboreum]
Length=495

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  439  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  495



>ref|XP_010273108.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Nelumbo nucifera]
Length=483

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  427  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  483



>gb|KJB41288.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
 gb|KJB41291.1| hypothetical protein B456_007G097600 [Gossypium raimondii]
Length=494

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  438  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  494



>emb|CDX91901.1| BnaC03g32030D [Brassica napus]
Length=501

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  445  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  501



>ref|XP_008438061.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
 ref|XP_008438062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Cucumis melo]
Length=492

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  436  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  492



>ref|XP_009340166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Pyrus x bretschneideri]
Length=510

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  454  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  510



>ref|XP_004133869.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
 ref|XP_004155819.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cucumis 
sativus]
Length=492

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  436  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  492



>ref|XP_004306806.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Fragaria vesca 
subsp. vesca]
Length=510

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  454  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  510



>ref|XP_002875020.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51279.1| hypothetical protein ARALYDRAFT_490504 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  451  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  507



>ref|XP_010053686.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Eucalyptus 
grandis]
 gb|KCW78046.1| hypothetical protein EUGRSUZ_D02270 [Eucalyptus grandis]
Length=514

 Score =   117 bits (292),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  458  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  514



>emb|CAA09199.1| RNA helicase [Arabidopsis thaliana]
Length=505

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  449  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  505



>ref|NP_191975.2| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 ref|NP_849535.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 sp|Q8RXK6.1|RH8_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis 
thaliana]
 gb|AAL87312.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAM45033.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE81915.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
 gb|AEE81916.1| DEAD-box ATP-dependent RNA helicase 8 [Arabidopsis thaliana]
Length=505

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  449  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  505



>ref|XP_002270379.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 ref|XP_010661749.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
 emb|CAN75439.1| hypothetical protein VITISV_000835 [Vitis vinifera]
Length=491

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  435  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  491



>gb|AAC13628.1| similar to ATP-dependent RNA helicases [Arabidopsis thaliana]
 emb|CAB80875.1| putative RNA helicase [Arabidopsis thaliana]
Length=499

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYCQ
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCQ  499



>ref|XP_006587858.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=504

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  448  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  504



>ref|XP_006827696.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
 gb|ERM95112.1| hypothetical protein AMTR_s00009p00258110 [Amborella trichopoda]
Length=459

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRF+LY+IEQELGTEIKPIPP IDQAIYC+
Sbjct  403  SETYLHRVGRSGRFGHLGLAVNLITYEDRFSLYRIEQELGTEIKPIPPQIDQAIYCK  459



>ref|XP_006341720.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341721.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Solanum tuberosum]
Length=488

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC
Sbjct  432  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC  487



>ref|XP_004248580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
 ref|XP_010327321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
lycopersicum]
Length=491

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/56 (96%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC
Sbjct  435  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYC  490



>gb|KGN56528.1| Dead box ATP-dependent RNA helicase [Cucumis sativus]
Length=558

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  436  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  492



>ref|XP_002301349.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80622.1| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=499

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQ IYCQ
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQTIYCQ  499



>ref|NP_001053408.1| Os04g0533000 [Oryza sativa Japonica Group]
 sp|Q7XMK8.1|RH6_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Oryza sativa 
Japonica Group]
 emb|CAE04571.1| OSJNBb0039L24.10 [Oryza sativa Japonica Group]
 dbj|BAF15322.1| Os04g0533000 [Oryza sativa Japonica Group]
 gb|EAZ31443.1| hypothetical protein OsJ_15580 [Oryza sativa Japonica Group]
 dbj|BAG92597.1| unnamed protein product [Oryza sativa Japonica Group]
Length=498

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AIYCQ
Sbjct  442  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYCQ  498



>ref|XP_007139882.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
 gb|ESW11876.1| hypothetical protein PHAVU_008G066400g [Phaseolus vulgaris]
Length=512

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  456  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  512



>ref|XP_006652567.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
6-like [Oryza brachyantha]
Length=507

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AIYCQ
Sbjct  451  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYCQ  507



>ref|XP_004976343.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Setaria 
italica]
Length=501

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+AIYCQ
Sbjct  445  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRAIYCQ  501



>gb|EMS61023.1| DEAD-box ATP-dependent RNA helicase 8 [Triticum urartu]
Length=356

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYCQ
Sbjct  300  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTIYCQ  356



>ref|XP_008681228.1| PREDICTED: uncharacterized protein LOC100194030 isoform X2 [Zea 
mays]
 gb|ACL54546.1| unknown [Zea mays]
Length=525

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  469  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAIYCQ  525



>ref|XP_006587857.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=539

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 56/57 (98%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQAIYC+
Sbjct  483  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAIYCR  539



>ref|XP_008681227.1| PREDICTED: uncharacterized protein LOC100194030 isoform X1 [Zea 
mays]
Length=536

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/57 (95%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  480  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKSIPPQIDQAIYCQ  536



>emb|CBI34696.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPPHIDQAIYC+
Sbjct  382  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPHIDQAIYCR  438



>emb|CDY07205.1| BnaCnng02200D [Brassica napus]
Length=491

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQ IYCQ
Sbjct  435  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQTIYCQ  491



>ref|XP_004240107.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=487

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQA+YC
Sbjct  431  SETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAVYC  486



>ref|XP_007135053.1| hypothetical protein PHAVU_010G0977000g [Phaseolus vulgaris]
 gb|ESW07047.1| hypothetical protein PHAVU_010G0977000g [Phaseolus vulgaris]
Length=362

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  306  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  362



>ref|XP_006345594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=478

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPPHIDQA+YC
Sbjct  422  SETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPHIDQAVYC  477



>ref|XP_001765911.1| predicted protein [Physcomitrella patens]
 gb|EDQ69232.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYC+
Sbjct  350  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRGIYCR  406



>ref|XP_009794053.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Nicotiana sylvestris]
Length=493

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  437  SETYLHRVGRSGRFGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPQIDQAIYCQ  493



>ref|XP_007135054.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
 gb|ESW07048.1| hypothetical protein PHAVU_010G0977000g, partial [Phaseolus vulgaris]
Length=402

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  346  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  402



>ref|XP_004510805.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=530

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPPHIDQA YC+
Sbjct  474  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPHIDQAFYCR  530



>gb|EYU32082.1| hypothetical protein MIMGU_mgv1a005052mg [Erythranthe guttata]
Length=499

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCQ  499



>ref|XP_001766771.1| predicted protein [Physcomitrella patens]
 gb|EDQ68402.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYC+
Sbjct  350  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRGIYCR  406



>ref|XP_010513761.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Camelina 
sativa]
Length=152

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  96   SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  152



>ref|XP_010255444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
 ref|XP_010255445.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Nelumbo 
nucifera]
Length=481

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  425  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  481



>ref|XP_002271357.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Vitis vinifera]
Length=480

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPPHIDQAIYC+
Sbjct  424  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPHIDQAIYCR  480



>dbj|BAJ94923.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYCQ
Sbjct  439  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTIYCQ  495



>ref|XP_010676491.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676492.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=523

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLYKIEQELGTEIK IPPHIDQ IYC+
Sbjct  467  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYKIEQELGTEIKQIPPHIDQGIYCR  523



>gb|KHN27312.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=406

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  350  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  406



>gb|EYU35077.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
 gb|EYU35078.1| hypothetical protein MIMGU_mgv1a005045mg [Erythranthe guttata]
Length=499

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP+IDQAIYC
Sbjct  443  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPNIDQAIYC  498



>ref|XP_003580213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brachypodium 
distachyon]
Length=495

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYCQ
Sbjct  439  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTIYCQ  495



>ref|XP_009384494.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=488

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  432  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  488



>gb|EMT23815.1| DEAD-box ATP-dependent RNA helicase 6 [Aegilops tauschii]
Length=522

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIPP ID+ IYCQ
Sbjct  466  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPPQIDRTIYCQ  522



>ref|XP_003623900.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80118.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=514

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  458  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAIYCR  514



>gb|ABG66172.1| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
Length=362

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  306  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  362



>ref|XP_010940461.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Elaeis guineensis]
Length=490

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  434  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  490



>ref|XP_004492712.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Cicer 
arietinum]
Length=499

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  443  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAIYCR  499



>ref|XP_010671975.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671984.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Beta vulgaris 
subsp. vulgaris]
Length=519

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/56 (95%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIK IPPHIDQA YC
Sbjct  463  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKQIPPHIDQAYYC  518



>gb|KHN04661.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  428  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  484



>gb|KHN04659.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=484

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  428  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  484



>gb|AES80120.2| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=523

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNL+TYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  467  SETYLHRVGRSGRFGHLGLAVNLVTYEDRFNLYRIEQELGTEIKQIPPFIDQAIYCR  523



>ref|XP_003528863.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Glycine 
max]
Length=500

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  444  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  500



>emb|CDY54061.1| BnaA02g36470D [Brassica napus]
Length=326

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDR NLY+IEQELGTEIK I PHIDQAIYCQ
Sbjct  270  AETYLHRVGRSGRFGHLGLAVNLITYEDRLNLYRIEQELGTEIKQIQPHIDQAIYCQ  326



>ref|XP_003623903.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES80121.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=516

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+YC+
Sbjct  460  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPFIDQAVYCR  516



>ref|XP_003623902.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=586

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNL+TYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  530  SETYLHRVGRSGRFGHLGLAVNLVTYEDRFNLYRIEQELGTEIKQIPPFIDQAIYCR  586



>ref|XP_003521117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=499

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  499



>ref|XP_006662493.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Oryza 
brachyantha]
Length=510

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIKPIP  ID A+YCQ
Sbjct  454  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKPIPSQIDLAVYCQ  510



>ref|XP_006339542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Solanum 
tuberosum]
Length=497

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAV+LIT+EDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  441  SETYLHRVGRSGRFGHLGLAVSLITFEDRFNLYRIEQELGTEIKQIPPQIDQAIYCQ  497



>gb|KHN27313.1| DEAD-box ATP-dependent RNA helicase 8 [Glycine soja]
Length=499

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  499



>ref|XP_006848084.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
 gb|ERN09665.1| hypothetical protein AMTR_s00029p00205680 [Amborella trichopoda]
Length=468

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ IYC+
Sbjct  412  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTIYCR  468



>ref|XP_003528862.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Glycine max]
Length=503

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  447  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  503



>ref|XP_006576347.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=502

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  446  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  502



>ref|XP_006576348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X3 [Glycine max]
Length=499

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  443  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  499



>ref|XP_009389244.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  430  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  486



>ref|XP_004229903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8 [Solanum lycopersicum]
Length=498

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAV+LIT+EDRFNLY+IEQELGTEIK IPP IDQAIYCQ
Sbjct  442  SETYLHRVGRSGRFGHLGLAVSLITFEDRFNLYRIEQELGTEIKQIPPQIDQAIYCQ  498



>emb|CDP09769.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  448  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPLIDQAIYCR  504



>gb|ABR16163.1| unknown [Picea sitchensis]
Length=477

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEI+ IPP IDQ +YC+
Sbjct  421  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIQQIPPQIDQTVYCR  477



>sp|Q109G2.2|RH12_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Oryza sativa 
Japonica Group]
 gb|AAG13612.1|AC078840_3 putative RNA helicase [Oryza sativa Japonica Group]
 gb|ABB47852.2| ATP-dependent RNA helicase ste13, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAG93281.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51233.1| hypothetical protein OsJ_32082 [Oryza sativa Japonica Group]
Length=521

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  465  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  521



>gb|EEC67267.1| hypothetical protein OsI_34232 [Oryza sativa Indica Group]
Length=524

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  468  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  524



>ref|XP_006583310.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X2 [Glycine max]
Length=545

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  489  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  545



>ref|NP_001065000.2| Os10g0503700 [Oryza sativa Japonica Group]
 dbj|BAF26914.2| Os10g0503700 [Oryza sativa Japonica Group]
Length=521

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  465  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  521



>ref|XP_009408278.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ IYC+
Sbjct  436  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTIYCR  492



>ref|XP_005831668.1| hypothetical protein GUITHDRAFT_71963 [Guillardia theta CCMP2712]
 gb|EKX44688.1| hypothetical protein GUITHDRAFT_71963 [Guillardia theta CCMP2712]
Length=407

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLA+NLITY+DRFNLYK+EQELGTEIKPIPP ID+ +YC
Sbjct  351  SETYLHRVGRSGRFGHLGLAINLITYDDRFNLYKVEQELGTEIKPIPPAIDKGLYC  406



>emb|CAA09198.1| RNA helicase [Arabidopsis thaliana]
Length=145

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  89   SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  145



>ref|XP_008794179.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794180.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=482

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+YC+
Sbjct  426  AETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAVYCR  482



>emb|CDY45702.1| BnaCnng13670D [Brassica napus]
Length=206

 Score =   108 bits (269),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRF HLGLA+NL+TYEDRF +Y+ EQELGTEIKPIP HIDQAIYCQ
Sbjct  150  SESYLHRVGRSGRFRHLGLALNLVTYEDRFKMYQTEQELGTEIKPIPSHIDQAIYCQ  206



>ref|XP_010908424.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like isoform 
X1 [Elaeis guineensis]
Length=482

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQA+YC+
Sbjct  426  AETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQAVYCR  482



>ref|XP_004982679.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
12-like [Setaria italica]
Length=505

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  449  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  505



>ref|XP_010905111.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Elaeis 
guineensis]
Length=492

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLIT+EDRFNLY+IEQELGTEIK IPP IDQAIYC+
Sbjct  436  SETYLHRVGRSGRYGHLGLAVNLITFEDRFNLYRIEQELGTEIKQIPPQIDQAIYCR  492



>ref|XP_002464412.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
 gb|EER91410.1| hypothetical protein SORBIDRAFT_01g017760 [Sorghum bicolor]
Length=507

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  451  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  507



>ref|NP_001150170.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 ref|XP_008677767.1| PREDICTED: ATP-dependent RNA helicase dhh1 isoform X1 [Zea mays]
 gb|ACG38116.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 tpg|DAA49386.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=503

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  447  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  503



>ref|XP_002464413.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
 gb|EER91411.1| hypothetical protein SORBIDRAFT_01g017770 [Sorghum bicolor]
Length=507

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID A+YCQ
Sbjct  451  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLAVYCQ  507



>gb|KDD74992.1| DEAD/DEAH box helicase [Helicosporidium sp. ATCC 50920]
Length=370

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 55/56 (98%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITY+DRFNLY+IEQELGTEIKPIPP I++++YC
Sbjct  314  SETYLHRVGRSGRFGHLGLAVNLITYDDRFNLYRIEQELGTEIKPIPPVIEKSLYC  369



>ref|NP_001140760.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
 gb|ACF84564.1| unknown [Zea mays]
 gb|ACG33781.1| ATP-dependent RNA helicase dhh1 [Zea mays]
 gb|AFW68449.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=499

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP ID +IYCQ
Sbjct  443  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKTIPPQIDLSIYCQ  499



>ref|XP_005849570.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
 gb|EFN57468.1| hypothetical protein CHLNCDRAFT_56077 [Chlorella variabilis]
Length=390

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLG+A+NLITYEDRFNLYKIEQELGTEIKPIPP I++ +YC
Sbjct  334  SETYLHRVGRSGRFGHLGIAINLITYEDRFNLYKIEQELGTEIKPIPPVIEKGLYC  389



>ref|XP_008794547.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
 ref|XP_008794548.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 8-like [Phoenix 
dactylifera]
Length=484

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGR+GHLGLAVNLITYEDRFNLY+IEQELGTEIK IPP IDQ IYC+
Sbjct  428  SETYLHRVGRSGRYGHLGLAVNLITYEDRFNLYRIEQELGTEIKQIPPQIDQTIYCR  484



>ref|XP_005646927.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22383.1| cytoplasmic DExD/H-box RNA helicase [Coccomyxa subellipsoidea 
C-169]
Length=415

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNL++IEQELGTEIKPIPP I++ +YC
Sbjct  359  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLFRIEQELGTEIKPIPPVIEKTLYC  414



>ref|XP_002769152.1| ATP-dependent RNA helicase, putative [Perkinsus marinus ATCC 
50983]
 gb|EER01870.1| ATP-dependent RNA helicase, putative [Perkinsus marinus ATCC 
50983]
Length=230

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  175  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  230



>emb|CDY48935.1| BnaA09g39020D [Brassica napus]
Length=475

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  419  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  475



>ref|XP_008873462.1| DEAD-box ATP-dependent RNA helicase 6 [Aphanomyces invadans]
 gb|ETV97901.1| DEAD-box ATP-dependent RNA helicase 6 [Aphanomyces invadans]
Length=423

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  367  SETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  423



>gb|KDO28289.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia parasitica 
CBS 223.65]
Length=421

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  365  SETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  421



>gb|EYU29737.1| hypothetical protein MIMGU_mgv1a005117mg [Erythranthe guttata]
Length=496

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFNLY+IEQELG EIK IPP IDQAIYC
Sbjct  440  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQELGAEIKQIPPLIDQAIYC  495



>ref|XP_008605548.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia diclina VS20]
 gb|EQC40704.1| DEAD-box ATP-dependent RNA helicase 8 [Saprolegnia diclina VS20]
Length=421

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  365  SETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  421



>gb|EMT21677.1| DEAD-box ATP-dependent RNA helicase 12 [Aegilops tauschii]
Length=515

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A YCQ
Sbjct  459  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAEYCQ  515



>ref|XP_009829781.1| DEAD-box ATP-dependent RNA helicase 8 [Aphanomyces astaci]
 gb|ETV80834.1| DEAD-box ATP-dependent RNA helicase 8 [Aphanomyces astaci]
Length=421

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  365  SETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  421



>ref|XP_009116788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
 ref|XP_009116789.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brassica rapa]
Length=473

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  417  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  473



>ref|XP_002876600.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52859.1| hypothetical protein ARALYDRAFT_486601 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  438  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  494



>emb|CDX71756.1| BnaC08g31180D [Brassica napus]
Length=479

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  423  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  479



>emb|CAA09203.1| RNA helicase [Arabidopsis thaliana]
Length=498

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  442  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  498



>ref|XP_005855068.1| hypothetical protein NGA_0350100, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU21291.1| hypothetical protein NGA_0350100, partial [Nannochloropsis gaditana 
CCMP526]
Length=140

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL++IEQELGTEIKPIP  ID+++YC
Sbjct  84   AETYLHRIGRSGRFGHLGLAINLITYDDRFNLFRIEQELGTEIKPIPRDIDRSLYC  139



>ref|NP_191683.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 ref|NP_974472.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 sp|Q9M2E0.1|RH12_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis 
thaliana]
 emb|CAB71054.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAM53270.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AAN15357.1| DEAD box RNA helicase RH12 [Arabidopsis thaliana]
 gb|AEE80177.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
 gb|AEE80178.1| DEAD-box ATP-dependent RNA helicase 12 [Arabidopsis thaliana]
Length=498

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  442  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  498



>ref|XP_008778709.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
 ref|XP_008778717.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Phoenix dactylifera]
Length=488

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLGLAVNLITYEDRFNL +IEQELGTEIK IPP IDQ IYC+
Sbjct  432  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLNRIEQELGTEIKQIPPQIDQTIYCR  488



>ref|XP_006290970.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
 gb|EOA23868.1| hypothetical protein CARUB_v10017085mg [Capsella rubella]
Length=494

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  438  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  494



>ref|XP_009104295.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Brassica 
rapa]
Length=477

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  IDQAIYCQ
Sbjct  421  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSQIDQAIYCQ  477



>ref|XP_010413440.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like isoform 
X2 [Camelina sativa]
Length=496

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  440  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  496



>ref|XP_010469048.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12-like [Camelina 
sativa]
Length=500

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  444  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  500



>ref|XP_010512458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Camelina sativa]
Length=502

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP +IDQAIYCQ
Sbjct  446  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSNIDQAIYCQ  502



>ref|XP_002769153.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER01871.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=449

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  394  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  449



>ref|XP_002771414.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03230.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=453

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  398  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  453



>ref|XP_002771413.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03229.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=431

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  376  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  431



>ref|XP_002909411.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY58225.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=411

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGR+GHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  355  SETYLHRIGRSGRYGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  411



>ref|XP_002767329.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER00047.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=447

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  392  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  447



>ref|XP_003294872.1| hypothetical protein DICPUDRAFT_93301 [Dictyostelium purpureum]
 gb|EGC28605.1| hypothetical protein DICPUDRAFT_93301 [Dictyostelium purpureum]
Length=413

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRF+LYKIEQELGTEIKPIPP ID+++Y
Sbjct  357  SETYLHRIGRSGRFGHLGLAINLITYEDRFSLYKIEQELGTEIKPIPPVIDKSLY  411



>ref|XP_002767330.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER00048.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=364

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLG+A+N++TY+DRFNLY+IE ELGTEIKPIP HID+A+YC
Sbjct  309  SETYLHRIGRSGRFGHLGIAINMLTYDDRFNLYRIEHELGTEIKPIPSHIDEALYC  364



>ref|XP_009514016.1| hypothetical protein PHYSODRAFT_283996 [Phytophthora sojae]
 gb|EGZ26741.1| hypothetical protein PHYSODRAFT_283996 [Phytophthora sojae]
Length=413

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGR+GHLGLA+N+ITYEDRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  357  SETYLHRIGRSGRYGHLGLAINMITYEDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  413



>ref|XP_629938.1| hypothetical protein DDB_G0291804 [Dictyostelium discoideum AX4]
 sp|Q54E49.1|DDX6_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx6; AltName: 
Full=DEAD box protein 6 [Dictyostelium discoideum]
 gb|EAL61523.1| hypothetical protein DDB_G0291804 [Dictyostelium discoideum AX4]
Length=423

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRF+LYKIEQELGTEIKPIPP ID+++Y
Sbjct  367  SETYLHRIGRSGRFGHLGLAINLITYEDRFSLYKIEQELGTEIKPIPPVIDKSLY  421



>ref|XP_009400273.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400274.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHRVGRSGRFGHLGLA+NLITYEDRFNLY+IEQELG EIK IPP ID+ IYC
Sbjct  436  SETYLHRVGRSGRFGHLGLAINLITYEDRFNLYRIEQELGAEIKQIPPQIDRTIYC  491



>dbj|BAJ95381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88430.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A YCQ
Sbjct  468  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAEYCQ  524



>ref|XP_006402503.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
 gb|ESQ43956.1| hypothetical protein EUTSA_v10005922mg [Eutrema salsugineum]
Length=485

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  IDQAIYCQ
Sbjct  429  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDQAIYCQ  485



>ref|XP_010234885.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 12 [Brachypodium 
distachyon]
Length=523

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHRVGRSGRFGHLGLAVNLITYEDRFN+Y+IEQELGTEIK IPP ID A YCQ
Sbjct  467  AETYLHRVGRSGRFGHLGLAVNLITYEDRFNMYRIEQELGTEIKTIPPQIDLAEYCQ  523



>ref|XP_004336605.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14592.1| atpdependent rna helicase ddx6, putative [Acanthamoeba castellanii 
str. Neff]
Length=407

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNL+KIEQELGTEIKPIPP ID+ +Y
Sbjct  350  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLFKIEQELGTEIKPIPPVIDKRLY  404



>ref|XP_008913632.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
INRA-310]
 gb|ETI33717.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P1569]
 gb|ETK74059.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETL27485.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETL80734.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETM33927.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica]
 gb|ETN01077.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
INRA-310]
 gb|ETO62499.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P1976]
 gb|ETP03583.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
CJ01A1]
 gb|ETP31731.1| DEAD-box ATP-dependent RNA helicase 8 [Phytophthora parasitica 
P10297]
Length=411

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGR+GHLGLA+N+ITY+DRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  355  SETYLHRIGRSGRYGHLGLAINMITYDDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  411



>ref|XP_011129036.1| putative DEAD box ATP-dependent RNA helicase [Gregarina niphandrodes]
 gb|EZG82130.1| putative DEAD box ATP-dependent RNA helicase [Gregarina niphandrodes]
Length=434

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+N+ITYEDRFNLY++EQELGTEI+PIP H+D A+Y
Sbjct  379  SETYLHRIGRSGRFGHLGLAINMITYEDRFNLYRVEQELGTEIQPIPSHVDTALY  433



>emb|CCI48817.1| unnamed protein product [Albugo candida]
Length=417

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+++ITY+DRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  361  SETYLHRIGRSGRFGHLGLAISMITYDDRFNLYRIEQELGTEIRPIPPVIDRNLYCK  417



>gb|EJU02445.1| DEAD-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=547

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIPP ID+++Y
Sbjct  360  SETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPPDIDKSLY  414



>emb|CCA22119.1| predicted protein putative [Albugo laibachii Nc14]
 emb|CCA23389.1| unknown putative [Albugo laibachii Nc14]
Length=417

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHR+GRSGRFGHLGLA+++ITY+DRFNLY+IEQELGTEI+PIPP ID+ +YC+
Sbjct  361  SETYLHRIGRSGRFGHLGLAISMITYDDRFNLYRIEQELGTEIRPIPPIIDRNLYCK  417



>dbj|GAM18218.1| hypothetical protein SAMD00019534_013930 [Acytostelium subglobosum 
LB1]
Length=414

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRF+L+KIEQELGTEIKPIPP ID+++Y
Sbjct  358  SETYLHRIGRSGRFGHLGLAINLITYEDRFSLHKIEQELGTEIKPIPPVIDKSLY  412



>ref|XP_006397768.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39221.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=406

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  350  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  406



>ref|XP_004350316.1| putative RNA helicase [Dictyostelium fasciculatum]
 gb|EGG13612.1| putative RNA helicase [Dictyostelium fasciculatum]
Length=414

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLGLA+NLITYEDRF+L+KIEQELGTEIKPIPP ID+++Y 
Sbjct  358  SETYLHRIGRSGRFGHLGLAINLITYEDRFSLHKIEQELGTEIKPIPPVIDKSLYA  413



>ref|NP_182105.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
 sp|Q94BV4.2|RH6_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis 
thaliana]
 gb|AAC28543.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AEC10604.1| DEAD-box ATP-dependent RNA helicase 6 [Arabidopsis thaliana]
Length=528

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  472  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  528



>emb|CDY58787.1| BnaA07g38020D [Brassica napus]
Length=482

 Score =   106 bits (264),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF + + EQELGTEIKPIP  IDQAIYCQ
Sbjct  426  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMCQTEQELGTEIKPIPSQIDQAIYCQ  482



>gb|AAK63966.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
 gb|AAO11625.1| At2g45810/F4I18.21 [Arabidopsis thaliana]
Length=528

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  472  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  528



>ref|XP_002880201.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56460.1| hypothetical protein ARALYDRAFT_483719 [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGRFGHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  465  SESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  521



>dbj|GAM20363.1| hypothetical protein SAMD00019534_035380 [Acytostelium subglobosum 
LB1]
Length=427

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRF+L+KIEQELGTEIKPIPP ID+++Y
Sbjct  371  SETYLHRIGRSGRFGHLGLAINLITYEDRFSLHKIEQELGTEIKPIPPVIDKSLY  425



>gb|EWM20640.1| RNA helicase,ATP-dependent, DEAD-box type [Nannochloropsis gaditana]
Length=412

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 54/56 (96%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNL++IEQELGTEIKPIP  ID+++YC
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYDDRFNLFRIEQELGTEIKPIPRDIDRSLYC  411



>emb|CCO29368.1| ATP-dependent RNA helicase DDX6/DHH1 [Rhizoctonia solani AG-1 
IB]
Length=159

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP  I++++Y 
Sbjct  34   SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPTEINKSLYV  89



>ref|XP_001881258.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR08188.1| predicted protein [Laccaria bicolor S238N-H82]
Length=442

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +Y
Sbjct  346  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQNIDRGLY  400



>gb|KFG56064.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX6, partial [Toxoplasma 
gondii FOU]
Length=381

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITY+DRFNLY+IE ELGTEI+PIP  ID+AIY
Sbjct  326  SETYLHRIGRSGRFGHLGLAINLITYDDRFNLYRIESELGTEIQPIPSQIDEAIY  380



>gb|EFZ13584.1| hypothetical protein SINV_12815 [Solenopsis invicta]
Length=98

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHR+GRSGRFGHLG+A+NLITYEDRFNL++IEQELGTEIKPIP  ID ++Y 
Sbjct  27   AETYLHRIGRSGRFGHLGIAINLITYEDRFNLHRIEQELGTEIKPIPKVIDPSLYV  82



>emb|CCL98213.1| predicted protein [Fibroporia radiculosa]
Length=488

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +Y
Sbjct  357  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQQIDKGLY  411



>gb|EUC65189.1| ATP-dependent RNA helicase dhh1 [Rhizoctonia solani AG-3 Rhs1AP]
Length=262

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP  I++++Y
Sbjct  134  SETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPAEINKSLY  188



>gb|EIE82813.1| ATP-dependent RNA helicase dhh1 [Rhizopus delemar RA 99-880]
Length=453

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  340  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKQLYVAPN  398



>ref|XP_010518223.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010518224.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=519

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  463  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  519



>gb|KIO14251.1| hypothetical protein M404DRAFT_12103 [Pisolithus tinctorius Marx 
270]
Length=490

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGH GLA+NL+TYEDRFNLY+IEQELGTEI+PIP HID+++Y
Sbjct  365  SETYLHRIGRSGRFGHFGLAINLVTYEDRFNLYRIEQELGTEIQPIPQHIDKSLY  419



>emb|CDY27357.1| BnaC04g50480D [Brassica napus]
Length=509

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  453  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  509



>emb|CEP17217.1| hypothetical protein [Parasitella parasitica]
Length=492

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLY  410



>ref|XP_002473400.1| eukaryotic translation initiation factor 4A-like protein [Postia 
placenta Mad-698-R]
 gb|EED81414.1| eukaryotic translation initiation factor 4A-like protein [Postia 
placenta Mad-698-R]
Length=501

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +Y
Sbjct  361  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQYIDKGLY  415



>emb|CEG81286.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=501

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y
Sbjct  355  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLY  409



>emb|CDY37067.1| BnaA04g26450D [Brassica napus]
Length=510

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  454  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  510



>ref|XP_010506559.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
 ref|XP_010506560.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Camelina sativa]
Length=520

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  464  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  520



>gb|EFN88325.1| Putative ATP-dependent RNA helicase me31b [Harpegnathos saltator]
Length=91

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLG+A+NLITYEDRFNL++IEQELGTEIKPIP  ID ++Y
Sbjct  29   AETYLHRIGRSGRFGHLGIAINLITYEDRFNLHRIEQELGTEIKPIPKVIDPSLY  83



>emb|CEI85652.1| Putative DEAD/DEAH box helicase [Rhizopus microsporus]
Length=498

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y   N
Sbjct  345  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLYVAPN  403



>ref|XP_007719915.1| ATP-dependent RNA helicase DHH1 [Capronia coronata CBS 617.96]
 gb|EXJ95686.1| ATP-dependent RNA helicase DHH1 [Capronia coronata CBS 617.96]
Length=506

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLYKIEQELGTEI+PIPP ID+++Y
Sbjct  365  AETYLHRIGRSGRFGHLGLAINLINWEDRFNLYKIEQELGTEIQPIPPSIDKSLY  419



>ref|XP_002164714.2| PREDICTED: probable ATP-dependent RNA helicase DDX6-like [Hydra 
vulgaris]
Length=436

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLG+A+NLITY+DRF LY++EQELGTEIKPIPP ID+++Y
Sbjct  365  SETYLHRIGRSGRFGHLGIALNLITYDDRFTLYQVEQELGTEIKPIPPSIDKSLY  419



>ref|XP_009142369.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6 [Brassica rapa]
Length=517

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  461  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  517



>ref|XP_002951166.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
 gb|EFJ47695.1| DEAD-box RNA helicase, ATP-dependent, cytoplasmic [Volvox carteri 
f. nagariensis]
Length=406

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHRVGRSGRFGHLGLAVNLITY+DR NL+KIEQELGTEIKPIP  I++ +YC
Sbjct  350  AETYLHRVGRSGRFGHLGLAVNLITYDDRINLFKIEQELGTEIKPIPAQIEEKLYC  405



>ref|XP_006294022.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
 gb|EOA26920.1| hypothetical protein CARUB_v10023015mg [Capsella rubella]
Length=518

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  462  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  518



>ref|XP_001692202.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP04152.1| cytoplasmic DExD/H-box RNA helicase [Chlamydomonas reinhardtii]
Length=405

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYC  536
            +ETYLHRVGRSGRFGHLGLAVNLITY+DR NL+KIEQELGTEIKPIP  I++ +YC
Sbjct  349  AETYLHRVGRSGRFGHLGLAVNLITYDDRINLFKIEQELGTEIKPIPAQIEEKLYC  404



>ref|XP_003062040.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53752.1| predicted protein [Micromonas pusilla CCMP1545]
Length=362

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SETYLHRVGRSGRFGHLG++VNLITY+DRFNL++IEQELGTEI+ IPP ID ++YC+
Sbjct  306  SETYLHRVGRSGRFGHLGISVNLITYDDRFNLFRIEQELGTEIQQIPPVIDPSVYCR  362



>ref|XP_010508105.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
 ref|XP_010508106.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 6-like [Camelina 
sativa]
Length=520

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  464  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  520



>ref|XP_007731184.1| ATP-dependent RNA helicase DHH1 [Capronia epimyces CBS 606.96]
 gb|EXJ89787.1| ATP-dependent RNA helicase DHH1 [Capronia epimyces CBS 606.96]
Length=510

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLI +EDRFNLYKIEQELGTEI+PIPP ID+++Y
Sbjct  365  AETYLHRIGRSGRFGHLGLAINLINWEDRFNLYKIEQELGTEIQPIPPSIDKSLY  419



>ref|XP_006397771.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
 gb|ESQ39224.1| hypothetical protein EUTSA_v10001405mg [Eutrema salsugineum]
Length=518

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            SE+YLHRVGRSGR+GHLGLAVNL+TYEDRF +Y+ EQELGTEIKPIP  ID+AIYCQ
Sbjct  462  SESYLHRVGRSGRYGHLGLAVNLVTYEDRFKMYQTEQELGTEIKPIPSLIDKAIYCQ  518



>gb|EPB90373.1| ATP-dependent RNA helicase dhh1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=499

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y   N
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLYVAPN  414



>emb|CEG63343.1| Putative Atp-dependent rna helicase dhh1 [Rhizopus microsporus]
Length=508

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y   N
Sbjct  355  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLYVAPN  413



>ref|XP_008042303.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW55033.1| DEAD-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=503

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +Y
Sbjct  359  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQQIDKGLY  413



>dbj|GAN00930.1| conserved hypothetical protein [Mucor ambiguus]
Length=491

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+++Y   N
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKSLYVAPN  414



>gb|KIJ36696.1| hypothetical protein M422DRAFT_232268 [Sphaerobolus stellatus 
SS14]
Length=543

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP  ID+++Y
Sbjct  357  SETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPTQIDKSLY  411



>ref|XP_007384334.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN08382.1| DEAD-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=505

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+++Y
Sbjct  357  AETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPAQIDRSLY  411



>ref|XP_007393350.1| hypothetical protein PHACADRAFT_182411 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM58019.1| hypothetical protein PHACADRAFT_182411 [Phanerochaete carnosa 
HHB-10118-sp]
Length=338

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP  ID+ +Y
Sbjct  183  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPQQIDKGLY  237



>gb|KIJ98785.1| hypothetical protein K443DRAFT_194552 [Laccaria amethystina LaAM-08-1]
Length=480

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP +ID+ +Y
Sbjct  360  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQNIDRGLY  414



>gb|KJA23157.1| hypothetical protein HYPSUDRAFT_138278 [Hypholoma sublateritium 
FD-334 SS-4]
Length=491

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +Y
Sbjct  360  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQSIDRGLY  414



>ref|XP_001832628.1| ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130]
 gb|EAU89171.1| ATP-dependent RNA helicase dhh1 [Coprinopsis cinerea okayama7#130]
Length=509

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+++Y   N
Sbjct  360  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQSIDRSLYVAPN  418



>ref|XP_009268120.1| ATP-dependent RNA helicase dhh1 [Wallemia ichthyophaga EXF-994]
 gb|EOR00843.1| ATP-dependent RNA helicase dhh1 [Wallemia ichthyophaga EXF-994]
Length=495

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGR+GHLGLA+NLITYEDRFNLYKIEQELGTEI+PIP  ID+++Y
Sbjct  354  SETYLHRIGRSGRYGHLGLAINLITYEDRFNLYKIEQELGTEIQPIPSQIDRSLY  408



>gb|KIM70603.1| hypothetical protein SCLCIDRAFT_156787 [Scleroderma citrinum 
Foug A]
Length=490

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 54/55 (98%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLY+IEQELGTEI+PIP +ID+++Y
Sbjct  365  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYRIEQELGTEIQPIPQYIDKSLY  419



>emb|CDJ38983.1| ATP-dependent RNA helicase, putative [Eimeria tenella]
Length=431

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLAVNL+TYEDRFNLY+IE ELGTEIKPIP HID   Y
Sbjct  376  SETYLHRIGRSGRFGHLGLAVNLVTYEDRFNLYRIEHELGTEIKPIPSHIDPETY  430



>gb|EMD35619.1| hypothetical protein CERSUDRAFT_96734 [Ceriporiopsis subvermispora 
B]
Length=502

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +Y
Sbjct  363  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPQTIDKGLY  417



>emb|CBJ26145.1| DEAD box helicase [Ectocarpus siliculosus]
Length=275

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ  533
            +ETYLHR+GRSGRFGHLGLA+NLITYEDR NL++IEQELGTEIKPIP  ID+ +YC+
Sbjct  219  AETYLHRIGRSGRFGHLGLAINLITYEDRHNLFRIEQELGTEIKPIPAVIDRDLYCR  275



>emb|CDJ63514.1| ATP-dependent RNA helicase, putative [Eimeria necatrix]
Length=431

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLAVNL+TYEDRFNLY+IE ELGTEIKPIP HID   Y
Sbjct  376  SETYLHRIGRSGRFGHLGLAVNLVTYEDRFNLYRIEHELGTEIKPIPSHIDPETY  430



>gb|EPB84122.1| ATP-dependent RNA helicase DHH1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=513

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKNLYVAPN  414



>emb|CEG82997.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=523

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  362  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKTLYVAPN  420



>dbj|GAN04011.1| eukaryotic translation initiation factor 4A-like protein [Mucor 
ambiguus]
Length=520

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  356  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKNLYVAPN  414



>dbj|GAC99235.1| hypothetical protein PHSY_006835 [Pseudozyma hubeiensis SY62]
Length=1755

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/55 (82%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLY+IEQELGTEI+PIP +ID+ +Y
Sbjct  358  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYRIEQELGTEIQPIPSNIDKRLY  412



>ref|XP_002677495.1| dead box ATP-dependent RNA helicase [Naegleria gruberi]
 gb|EFC44751.1| dead box ATP-dependent RNA helicase [Naegleria gruberi]
Length=618

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGR+GHLGLA+N +TYEDRFNLYKIEQELGTEIKPIPP ID+ +Y
Sbjct  562  SETYLHRIGRSGRYGHLGLAINFVTYEDRFNLYKIEQELGTEIKPIPPTIDKNLY  616



>emb|CEJ02025.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=521

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  362  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKTLYVAPN  420



>emb|CEG71520.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=527

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  362  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKTLYVAPN  420



>gb|ESA01456.1| hypothetical protein GLOINDRAFT_333744 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX61432.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61433.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX61434.1| Dhh1p [Rhizophagus irregularis DAOM 197198w]
Length=490

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLITY+DRFNLYKIEQELGTEI+PIPP ID+ +Y
Sbjct  363  AETYLHRIGRSGRFGHLGLAINLITYDDRFNLYKIEQELGTEIQPIPPVIDKRLY  417



>gb|KIW14976.1| ATP-dependent RNA helicase DHH1 [Exophiala spinifera]
Length=512

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++Y
Sbjct  365  AETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSLY  419



>emb|CEI93304.1| Putative ATP-dependent RNA helicase DHH1 [Rhizopus microsporus]
Length=528

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  362  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKTLYVAPN  420



>emb|CDJ30776.1| ATP-dependent RNA helicase, putative [Eimeria mitis]
Length=443

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLAVNL+TY+DRFNLY+IEQELGTEI+PIP HID   Y
Sbjct  388  SETYLHRIGRSGRFGHLGLAVNLVTYDDRFNLYRIEQELGTEIQPIPSHIDPETY  442



>ref|XP_007272025.1| DEAD-domain-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJC97706.1| DEAD-domain-containing protein [Fomitiporia mediterranea MF3/22]
Length=533

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGR+GHLGLA+NLITYEDRFNLYKIEQELGTEI+PIP  ID+++Y
Sbjct  363  SETYLHRIGRSGRYGHLGLAINLITYEDRFNLYKIEQELGTEIQPIPAQIDRSLY  417



>ref|XP_009549682.1| hypothetical protein HETIRDRAFT_67389 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW78030.1| hypothetical protein HETIRDRAFT_67389 [Heterobasidion irregulare 
TC 32-1]
Length=487

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            SETYLHR+GRSGRFGHLGLA+NL+TYEDRFNLYKIEQELGTEI+PIP  ID+ +Y
Sbjct  359  SETYLHRIGRSGRFGHLGLAINLVTYEDRFNLYKIEQELGTEIQPIPHQIDKGLY  413



>ref|XP_009158872.1| ATP-dependent RNA helicase dhh1 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY58411.1| ATP-dependent RNA helicase dhh1 [Exophiala dermatitidis NIH/UT8656]
Length=506

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 53/55 (96%), Gaps = 0/55 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIY  539
            +ETYLHR+GRSGRFGHLGLA+NLI ++DRFNLYKIEQELGTEI+PIPP ID+++Y
Sbjct  365  AETYLHRIGRSGRFGHLGLAINLINWDDRFNLYKIEQELGTEIQPIPPSIDKSLY  419



>gb|EIE81845.1| ATP-dependent RNA helicase DHH1 [Rhizopus delemar RA 99-880]
Length=494

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  703  SETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYKIEQELGTEIKPIPPHIDQAIYCQ*N  527
            +ETYLHR+GRSGRFGHLGLA+NLITYEDRFNLYKIE+ELGTEI+PIPP ID+ +Y   N
Sbjct  361  AETYLHRIGRSGRFGHLGLAINLITYEDRFNLYKIERELGTEIQPIPPVIDKQLYVAPN  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335