BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012M20

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38112.1|  hypothetical protein MIMGU_mgv1a0013162mg               213   8e-66   Erythranthe guttata [common monkey flower]
ref|XP_004158630.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-64   
gb|KGN47886.1|  hypothetical protein Csa_6G409920                       216   8e-64   Cucumis sativus [cucumbers]
gb|EPS64063.1|  serine/threonine-protein phosphatase                    210   8e-64   Genlisea aurea
gb|KJB22565.1|  hypothetical protein B456_004G054500                    214   4e-62   Gossypium raimondii
ref|XP_010070326.1|  PREDICTED: serine/threonine-protein phosphat...    219   7e-62   Eucalyptus grandis [rose gum]
ref|XP_007050742.1|  BRI1 suppressor 1 (BSU1)-like 1                    217   4e-61   
emb|CDP03570.1|  unnamed protein product                                216   5e-61   Coffea canephora [robusta coffee]
ref|XP_009593091.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-61   Nicotiana tomentosiformis
gb|KJB22563.1|  hypothetical protein B456_004G054500                    214   6e-61   Gossypium raimondii
ref|XP_009778415.1|  PREDICTED: serine/threonine-protein phosphat...    216   6e-61   Nicotiana sylvestris
ref|XP_008449460.1|  PREDICTED: serine/threonine-protein phosphat...    216   7e-61   Cucumis melo [Oriental melon]
ref|XP_008777710.1|  PREDICTED: serine/threonine-protein phosphat...    212   7e-61   
ref|XP_004140092.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    216   8e-61   
ref|XP_006366382.1|  PREDICTED: serine/threonine-protein phosphat...    204   1e-60   
ref|NP_001169882.1|  uncharacterized protein LOC100383776               201   1e-60   
ref|XP_010279479.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-60   Nelumbo nucifera [Indian lotus]
emb|CAC11128.1|  protein phosphatase                                    203   1e-60   Fagus sylvatica
ref|XP_010522673.1|  PREDICTED: serine/threonine-protein phosphat...    215   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010522672.1|  PREDICTED: serine/threonine-protein phosphat...    215   2e-60   Tarenaya hassleriana [spider flower]
gb|KJB22562.1|  hypothetical protein B456_004G054500                    215   2e-60   Gossypium raimondii
gb|KJB22561.1|  hypothetical protein B456_004G054500                    214   2e-60   Gossypium raimondii
gb|KJB22560.1|  hypothetical protein B456_004G054500                    214   2e-60   Gossypium raimondii
gb|KHG21887.1|  Serine/threonine-protein phosphatase BSL1               214   2e-60   Gossypium arboreum [tree cotton]
gb|KHG21886.1|  Serine/threonine-protein phosphatase BSL1               214   2e-60   Gossypium arboreum [tree cotton]
gb|AEK86563.1|  serine/threonine-protein phosphatase                    214   2e-60   Camellia sinensis [black tea]
ref|XP_011082512.1|  PREDICTED: serine/threonine-protein phosphat...    214   4e-60   Sesamum indicum [beniseed]
dbj|BAK04150.1|  predicted protein                                      203   5e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010684726.1|  PREDICTED: serine/threonine-protein phosphat...    210   8e-59   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011033646.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-58   Populus euphratica
ref|XP_011033645.1|  PREDICTED: serine/threonine-protein phosphat...    209   1e-58   Populus euphratica
ref|XP_010556798.1|  PREDICTED: serine/threonine-protein phosphat...    208   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_007201214.1|  hypothetical protein PRUPE_ppa001177mg             207   1e-57   Prunus persica
ref|NP_192217.2|  serine/threonine-protein phosphatase BSL1             207   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KDO87444.1|  hypothetical protein CISIN_1g002713mg                   202   1e-57   Citrus sinensis [apfelsine]
ref|XP_008234964.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    207   1e-57   Prunus mume [ume]
ref|XP_009385028.1|  PREDICTED: serine/threonine-protein phosphat...    207   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC79097.1|  putative phospho-ser/thr phosphatase                    207   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AFN44702.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    202   1e-57   Nicotiana benthamiana
ref|XP_009144526.1|  PREDICTED: serine/threonine-protein phosphat...    206   2e-57   Brassica rapa
emb|CDX97296.1|  BnaA02g20870D                                          206   2e-57   
emb|CDY62088.1|  BnaC02g46770D                                          206   2e-57   Brassica napus [oilseed rape]
emb|CDX90906.1|  BnaA03g25860D                                          206   2e-57   
ref|XP_006396534.1|  hypothetical protein EUTSA_v10028417mg             206   2e-57   Eutrema salsugineum [saltwater cress]
ref|XP_006286760.1|  hypothetical protein CARUB_v10003201mg             206   2e-57   Capsella rubella
emb|CDY17964.1|  BnaC03g30360D                                          206   2e-57   Brassica napus [oilseed rape]
ref|XP_010455968.1|  PREDICTED: serine/threonine-protein phosphat...    206   2e-57   
ref|XP_010430668.1|  PREDICTED: serine/threonine-protein phosphat...    206   2e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010422504.1|  PREDICTED: serine/threonine-protein phosphat...    206   2e-57   
ref|XP_002872798.1|  kelch repeat-containing serine/threonine pho...    206   2e-57   Arabidopsis lyrata subsp. lyrata
gb|AFN44700.1|  Ser/Thr phosphatase-containing Kelch repeat domai...    206   2e-57   Solanum tuberosum [potatoes]
ref|XP_009134374.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Brassica rapa
ref|XP_010231726.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Brachypodium distachyon [annual false brome]
ref|XP_010231727.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Brachypodium distachyon [annual false brome]
ref|XP_003568959.1|  PREDICTED: serine/threonine-protein phosphat...    206   3e-57   Brachypodium distachyon [annual false brome]
ref|XP_006654987.1|  PREDICTED: serine/threonine-protein phosphat...    204   7e-57   
gb|AAM83219.1|  AT4g03080/T4I9_4                                        204   7e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EEE62303.1|  hypothetical protein OsJ_17091                          204   8e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054625.1|  Os05g0144400                                       204   9e-57   
gb|EMS55151.1|  Serine/threonine-protein phosphatase BSL1-like pr...    203   1e-56   Triticum urartu
emb|CAC09573.1|  protein phosphatase 1 (PP1)                            189   1e-56   Fagus sylvatica
ref|XP_003591594.1|  Serine/threonine protein phosphatase               197   1e-56   
gb|KDO87443.1|  hypothetical protein CISIN_1g002713mg                   202   1e-56   Citrus sinensis [apfelsine]
ref|XP_008368903.1|  PREDICTED: serine/threonine-protein phosphat...    204   1e-56   
ref|XP_008368904.1|  PREDICTED: serine/threonine-protein phosphat...    203   2e-56   
gb|EMT11348.1|  Serine/threonine phosphatase BSL1-like protein          203   2e-56   
gb|KDO87442.1|  hypothetical protein CISIN_1g002713mg                   202   3e-56   Citrus sinensis [apfelsine]
ref|XP_002270638.2|  PREDICTED: serine/threonine-protein phosphat...    202   3e-56   Vitis vinifera
gb|KDP21537.1|  hypothetical protein JCGZ_22008                         202   3e-56   Jatropha curcas
ref|XP_002520710.1|  bsu-protein phosphatase, putative                  202   3e-56   Ricinus communis
ref|XP_004290707.1|  PREDICTED: serine/threonine-protein phosphat...    202   4e-56   Fragaria vesca subsp. vesca
ref|XP_011011092.1|  PREDICTED: serine/threonine-protein phosphat...    202   5e-56   Populus euphratica
gb|KDO87440.1|  hypothetical protein CISIN_1g002713mg                   202   5e-56   Citrus sinensis [apfelsine]
ref|XP_011011093.1|  PREDICTED: serine/threonine-protein phosphat...    202   6e-56   Populus euphratica
ref|XP_006444191.1|  hypothetical protein CICLE_v10018791mg             202   6e-56   Citrus clementina [clementine]
ref|XP_006444192.1|  hypothetical protein CICLE_v10018791mg             202   7e-56   Citrus clementina [clementine]
ref|XP_008386603.1|  PREDICTED: serine/threonine-protein phosphat...    202   8e-56   
ref|XP_009347104.1|  PREDICTED: serine/threonine-protein phosphat...    201   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_002301559.1|  phosphatase family protein                         201   2e-55   
ref|XP_002439264.1|  hypothetical protein SORBIDRAFT_09g003440          201   2e-55   Sorghum bicolor [broomcorn]
ref|XP_008655295.1|  PREDICTED: uncharacterized protein LOC100383...    201   3e-55   Zea mays [maize]
ref|XP_008655294.1|  PREDICTED: uncharacterized protein LOC100383...    201   3e-55   Zea mays [maize]
gb|KHN46606.1|  Serine/threonine-protein phosphatase BSL1               199   5e-55   Glycine soja [wild soybean]
ref|XP_003518942.1|  PREDICTED: serine/threonine-protein phosphat...    199   5e-55   Glycine max [soybeans]
ref|XP_007201685.1|  hypothetical protein PRUPE_ppa022807mg             198   8e-55   
ref|XP_010244625.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010244624.1|  PREDICTED: serine/threonine-protein phosphat...    199   1e-54   Nelumbo nucifera [Indian lotus]
gb|AES61845.2|  serine/threonine-protein phosphatase                    198   1e-54   Medicago truncatula
ref|XP_003591586.1|  Serine/threonine protein phosphatase               198   1e-54   
ref|XP_004496006.1|  PREDICTED: serine/threonine-protein phosphat...    198   2e-54   Cicer arietinum [garbanzo]
ref|XP_007144577.1|  hypothetical protein PHAVU_007G167400g             198   2e-54   Phaseolus vulgaris [French bean]
ref|XP_002321044.2|  phosphatase family protein                         198   2e-54   
ref|XP_006826451.1|  hypothetical protein AMTR_s00004p00179740          196   2e-54   
ref|XP_010914371.1|  PREDICTED: serine/threonine-protein phosphat...    195   2e-54   
gb|KGN66603.1|  hypothetical protein Csa_1G638500                       187   3e-54   Cucumis sativus [cucumbers]
ref|XP_010914370.1|  PREDICTED: serine/threonine-protein phosphat...    195   4e-54   
ref|XP_003536338.1|  PREDICTED: serine/threonine-protein phosphat...    196   5e-54   Glycine max [soybeans]
ref|XP_010914369.1|  PREDICTED: serine/threonine-protein phosphat...    195   6e-54   
gb|AFY26889.1|  kelch repeat-containing serine/threonine phosphoe...    196   8e-54   Morella rubra [Chinese arbutus]
ref|NP_001266004.1|  Hop-interacting protein THI129                     195   2e-53   Solanum lycopersicum
gb|ACR38393.1|  unknown                                                 182   3e-53   Zea mays [maize]
gb|KJB42021.1|  hypothetical protein B456_007G132700                    194   4e-53   Gossypium raimondii
gb|EYU41290.1|  hypothetical protein MIMGU_mgv1a0202662mg               191   4e-53   Erythranthe guttata [common monkey flower]
gb|KHG15629.1|  Serine/threonine-protein phosphatase BSL1 -like p...    193   5e-53   Gossypium arboreum [tree cotton]
ref|XP_001760494.1|  predicted protein                                  193   2e-52   
ref|XP_001769730.1|  predicted protein                                  193   2e-52   
gb|KFK30905.1|  hypothetical protein AALP_AA6G041300                    192   2e-52   Arabis alpina [alpine rockcress]
gb|EYU25965.1|  hypothetical protein MIMGU_mgv1a0006241mg               191   2e-52   Erythranthe guttata [common monkey flower]
ref|NP_001131445.1|  uncharacterized LOC100192777                       183   2e-52   
ref|NP_001167772.1|  uncharacterized protein LOC100381465               178   3e-52   
gb|KJB55562.1|  hypothetical protein B456_009G082300                    188   4e-52   Gossypium raimondii
ref|XP_010647448.1|  PREDICTED: serine/threonine-protein phosphat...    190   4e-52   Vitis vinifera
ref|XP_003538088.1|  PREDICTED: serine/threonine-protein phosphat...    192   7e-52   Glycine max [soybeans]
ref|NP_180289.3|  serine/threonine-protein phosphatase BSL3             192   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189614.1|  serine/threonine-protein phosphatase BSL3          191   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006591057.1|  PREDICTED: serine/threonine-protein phosphat...    191   8e-52   Glycine max [soybeans]
emb|CDY57791.1|  BnaCnng32470D                                          191   8e-52   Brassica napus [oilseed rape]
gb|KHN36505.1|  Serine/threonine-protein phosphatase BSL2               190   9e-52   Glycine soja [wild soybean]
gb|KEH38997.1|  serine/threonine-protein phosphatase BSL2-like pr...    190   1e-51   Medicago truncatula
ref|XP_006408677.1|  hypothetical protein EUTSA_v10001894mg             191   2e-51   Eutrema salsugineum [saltwater cress]
ref|XP_004170230.1|  PREDICTED: serine/threonine-protein phosphat...    188   2e-51   
ref|XP_003543410.1|  PREDICTED: serine/threonine-protein phosphat...    190   2e-51   Glycine max [soybeans]
ref|XP_007150014.1|  hypothetical protein PHAVU_005G118700g             190   2e-51   Phaseolus vulgaris [French bean]
ref|XP_003596905.1|  Serine/threonine protein phosphatase               190   2e-51   Medicago truncatula
ref|XP_004291538.1|  PREDICTED: serine/threonine-protein phosphat...    190   2e-51   Fragaria vesca subsp. vesca
ref|XP_003540821.1|  PREDICTED: serine/threonine-protein phosphat...    190   2e-51   Glycine max [soybeans]
ref|XP_010045170.1|  PREDICTED: serine/threonine-protein phosphat...    190   2e-51   Eucalyptus grandis [rose gum]
ref|XP_011090288.1|  PREDICTED: serine/threonine-protein phosphat...    190   2e-51   Sesamum indicum [beniseed]
ref|XP_007208428.1|  hypothetical protein PRUPE_ppa000783mg             190   3e-51   Prunus persica
ref|XP_002264614.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Vitis vinifera
ref|XP_011090289.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Sesamum indicum [beniseed]
ref|XP_009336399.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_004487445.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Cicer arietinum [garbanzo]
ref|XP_008230036.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Prunus mume [ume]
ref|XP_008385576.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   
dbj|BAK06303.1|  predicted protein                                      183   3e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008230041.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Prunus mume [ume]
ref|XP_004506226.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Cicer arietinum [garbanzo]
gb|KJB55561.1|  hypothetical protein B456_009G082300                    188   3e-51   Gossypium raimondii
ref|XP_002879075.1|  kelch repeat-containing serine/threonine pho...    190   3e-51   
ref|XP_009368358.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_010513312.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009373887.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Pyrus x bretschneideri [bai li]
ref|XP_008361620.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   
ref|XP_009412503.1|  PREDICTED: serine/threonine-protein phosphat...    190   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP42962.1|  hypothetical protein JCGZ_23904                         190   3e-51   Jatropha curcas
ref|XP_004164757.1|  PREDICTED: serine/threonine-protein phosphat...    189   3e-51   
ref|XP_006295510.1|  hypothetical protein CARUB_v10024614mg             189   3e-51   
ref|XP_007015660.1|  BRI1 suppressor 1 (BSU1)-like 3 isoform 4          188   4e-51   
ref|XP_009418973.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398341.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398342.1|  PREDICTED: serine/threonine-protein phosphat...    189   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009775149.1|  PREDICTED: serine/threonine-protein phosphat...    179   4e-51   Nicotiana sylvestris
ref|XP_008450272.1|  PREDICTED: serine/threonine-protein phosphat...    189   5e-51   
ref|XP_010685448.1|  PREDICTED: serine/threonine-protein phosphat...    189   5e-51   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI24435.3|  unnamed protein product                                189   5e-51   Vitis vinifera
ref|XP_010904839.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    188   5e-51   Elaeis guineensis
ref|XP_010544322.1|  PREDICTED: serine/threonine-protein phosphat...    189   6e-51   Tarenaya hassleriana [spider flower]
ref|XP_004139147.1|  PREDICTED: serine/threonine-protein phosphat...    189   6e-51   
ref|XP_009140775.1|  PREDICTED: serine/threonine-protein phosphat...    189   6e-51   Brassica rapa
gb|KHN03759.1|  Serine/threonine-protein phosphatase BSL1               187   6e-51   Glycine soja [wild soybean]
emb|CDY57485.1|  BnaAnng14650D                                          189   6e-51   Brassica napus [oilseed rape]
ref|XP_010557449.1|  PREDICTED: serine/threonine-protein phosphat...    189   7e-51   Tarenaya hassleriana [spider flower]
gb|KHG22818.1|  Serine/threonine-protein phosphatase BSL3 -like p...    189   8e-51   Gossypium arboreum [tree cotton]
ref|XP_010544321.1|  PREDICTED: serine/threonine-protein phosphat...    189   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_011044597.1|  PREDICTED: serine/threonine-protein phosphat...    189   8e-51   Populus euphratica
ref|XP_007015657.1|  BRI1 suppressor 1 (BSU1)-like 2 isoform 1          189   9e-51   
ref|XP_008449600.1|  PREDICTED: serine/threonine-protein phosphat...    189   9e-51   Cucumis melo [Oriental melon]
ref|XP_006369377.1|  hypothetical protein POPTR_0001s22320g             189   9e-51   
ref|XP_011008648.1|  PREDICTED: serine/threonine-protein phosphat...    189   9e-51   Populus euphratica
ref|XP_011008746.1|  PREDICTED: serine/threonine-protein phosphat...    188   1e-50   Populus euphratica
ref|XP_004140171.1|  PREDICTED: serine/threonine-protein phosphat...    188   1e-50   Cucumis sativus [cucumbers]
ref|XP_007132502.1|  hypothetical protein PHAVU_011G099600g             188   1e-50   Phaseolus vulgaris [French bean]
gb|EYU36016.1|  hypothetical protein MIMGU_mgv1a000720mg                188   1e-50   Erythranthe guttata [common monkey flower]
gb|KHG29076.1|  Serine/threonine-protein phosphatase BSL3 -like p...    188   1e-50   Gossypium arboreum [tree cotton]
gb|KJB35468.1|  hypothetical protein B456_006G116600                    186   1e-50   Gossypium raimondii
gb|KJB55556.1|  hypothetical protein B456_009G082300                    188   1e-50   Gossypium raimondii
ref|XP_004960470.1|  PREDICTED: serine/threonine-protein phosphat...    187   1e-50   Setaria italica
ref|XP_011088983.1|  PREDICTED: serine/threonine-protein phosphat...    187   2e-50   Sesamum indicum [beniseed]
ref|XP_009606099.1|  PREDICTED: serine/threonine-protein phosphat...    185   2e-50   Nicotiana tomentosiformis
gb|KHN17986.1|  Serine/threonine-protein phosphatase BSL2               187   2e-50   Glycine soja [wild soybean]
ref|XP_010263036.1|  PREDICTED: serine/threonine-protein phosphat...    187   2e-50   Nelumbo nucifera [Indian lotus]
dbj|BAF02235.1|  putative protein serine/threonine phosphatase alpha    186   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787777.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-50   Phoenix dactylifera
ref|XP_009606096.1|  PREDICTED: serine/threonine-protein phosphat...    185   3e-50   
ref|XP_009388972.1|  PREDICTED: serine/threonine-protein phosphat...    187   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO46579.1|  hypothetical protein CISIN_1g001895mg                   185   3e-50   Citrus sinensis [apfelsine]
ref|XP_008787776.1|  PREDICTED: serine/threonine-protein phosphat...    186   3e-50   
ref|XP_003539489.1|  PREDICTED: serine/threonine-protein phosphat...    187   3e-50   Glycine max [soybeans]
ref|XP_001765008.1|  predicted protein                                  187   3e-50   
ref|NP_001275238.1|  serine/threonine-protein phosphatase BSL3-like     187   4e-50   Solanum tuberosum [potatoes]
gb|KJB35474.1|  hypothetical protein B456_006G116600                    187   4e-50   Gossypium raimondii
ref|XP_003605992.1|  Serine/threonine protein phosphatase               186   4e-50   
ref|XP_010473113.1|  PREDICTED: serine/threonine-protein phosphat...    187   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010247574.1|  PREDICTED: serine/threonine-protein phosphat...    187   4e-50   Nelumbo nucifera [Indian lotus]
ref|XP_006367582.1|  PREDICTED: serine/threonine-protein phosphat...    185   4e-50   Solanum tuberosum [potatoes]
ref|XP_004241349.1|  PREDICTED: serine/threonine-protein phosphat...    186   4e-50   Solanum lycopersicum
gb|KJB35470.1|  hypothetical protein B456_006G116600                    186   5e-50   Gossypium raimondii
ref|XP_010907354.1|  PREDICTED: serine/threonine-protein phosphat...    186   6e-50   Elaeis guineensis
ref|XP_009770255.1|  PREDICTED: serine/threonine-protein phosphat...    186   6e-50   Nicotiana sylvestris
ref|XP_009770253.1|  PREDICTED: serine/threonine-protein phosphat...    186   6e-50   Nicotiana sylvestris
ref|XP_010941606.1|  PREDICTED: serine/threonine-protein phosphat...    186   6e-50   
ref|XP_010907353.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Elaeis guineensis
ref|XP_008811285.1|  PREDICTED: serine/threonine-protein phosphat...    186   7e-50   Phoenix dactylifera
gb|AES88189.2|  serine/threonine-protein phosphatase BSL2-like pr...    186   7e-50   Medicago truncatula
ref|XP_009795596.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    186   7e-50   Nicotiana sylvestris
ref|XP_008811284.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   Phoenix dactylifera
ref|XP_008811286.1|  PREDICTED: serine/threonine-protein phosphat...    186   8e-50   Phoenix dactylifera
ref|XP_006424083.1|  hypothetical protein CICLE_v10027742mg             186   8e-50   Citrus clementina [clementine]
ref|XP_006424082.1|  hypothetical protein CICLE_v10027742mg             186   8e-50   
ref|XP_010488844.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010458078.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   
ref|XP_006592359.1|  PREDICTED: serine/threonine-protein phosphat...    186   9e-50   
ref|XP_010475640.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002513730.1|  bsu-protein phosphatase, putative                  184   1e-49   
ref|XP_006303893.1|  hypothetical protein CARUB_v10008182mg             186   1e-49   Capsella rubella
ref|NP_001266022.1|  Hop-interacting protein THI140                     185   1e-49   Solanum lycopersicum
ref|NP_172318.1|  serine/threonine-protein phosphatase BSL2             186   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010322449.1|  PREDICTED: serine/threonine-protein phosphat...    186   1e-49   Solanum lycopersicum
dbj|BAH19666.1|  AT1G08420                                              186   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001184935.1|  serine/threonine-protein phosphatase BSL2          186   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011090290.1|  PREDICTED: serine/threonine-protein phosphat...    185   1e-49   Sesamum indicum [beniseed]
gb|AFW68155.1|  putative kelch repeat-containing protein containi...    179   1e-49   
ref|XP_002889692.1|  kelch repeat-containing protein                    185   1e-49   Arabidopsis lyrata subsp. lyrata
gb|EEE65895.1|  hypothetical protein OsJ_21718                          185   1e-49   Oryza sativa Japonica Group [Japonica rice]
emb|CDP15567.1|  unnamed protein product                                185   1e-49   Coffea canephora [robusta coffee]
ref|NP_001067290.1|  Os12g0617900                                       185   2e-49   
ref|XP_004963199.1|  PREDICTED: serine/threonine-protein phosphat...    184   2e-49   Setaria italica
gb|EMS59471.1|  Serine/threonine-protein phosphatase BSL2-like pr...    183   2e-49   Triticum urartu
ref|XP_008674098.1|  PREDICTED: serine/threonine-protein phosphat...    184   3e-49   Zea mays [maize]
ref|XP_002976889.1|  hypothetical protein SELMODRAFT_175932             184   3e-49   
ref|XP_009587053.1|  PREDICTED: serine/threonine-protein phosphat...    184   3e-49   
ref|XP_002980607.1|  hypothetical protein SELMODRAFT_268371             184   3e-49   
ref|XP_001781021.1|  predicted protein                                  184   3e-49   
gb|KJB21740.1|  hypothetical protein B456_004G011600                    184   3e-49   Gossypium raimondii
ref|XP_009587040.1|  PREDICTED: serine/threonine-protein phosphat...    184   3e-49   Nicotiana tomentosiformis
ref|XP_002443577.1|  hypothetical protein SORBIDRAFT_08g021850          184   3e-49   Sorghum bicolor [broomcorn]
ref|XP_002313501.2|  kelch repeat-containing family protein             184   3e-49   
gb|EEE59591.1|  hypothetical protein OsJ_11899                          184   4e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006651637.1|  PREDICTED: serine/threonine-protein phosphat...    184   4e-49   Oryza brachyantha
ref|XP_006361106.1|  PREDICTED: serine/threonine-protein phosphat...    184   4e-49   Solanum tuberosum [potatoes]
gb|EPS70499.1|  hypothetical protein M569_04238                         184   5e-49   Genlisea aurea
ref|XP_008681503.1|  PREDICTED: uncharacterized protein LOC100192...    184   5e-49   Zea mays [maize]
gb|ABF97885.1|  kelch repeat-containing serine/threonine phosphoe...    184   5e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664752.1|  PREDICTED: serine/threonine-protein phosphat...    183   5e-49   
gb|EEC75832.1|  hypothetical protein OsI_12812                          184   5e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008681453.1|  PREDICTED: uncharacterized protein LOC100192...    184   5e-49   
ref|XP_011088984.1|  PREDICTED: serine/threonine-protein phosphat...    183   6e-49   Sesamum indicum [beniseed]
ref|XP_009606098.1|  PREDICTED: serine/threonine-protein phosphat...    181   6e-49   
gb|AAD26883.1|  putative phosphoprotein phosphatase                     180   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006592783.1|  PREDICTED: serine/threonine-protein phosphat...    182   1e-48   
ref|XP_006417691.1|  hypothetical protein EUTSA_v10006669mg             182   2e-48   Eutrema salsugineum [saltwater cress]
ref|XP_009587046.1|  PREDICTED: serine/threonine-protein phosphat...    182   2e-48   Nicotiana tomentosiformis
ref|XP_009770254.1|  PREDICTED: serine/threonine-protein phosphat...    181   3e-48   Nicotiana sylvestris
ref|XP_009587594.1|  PREDICTED: serine/threonine-protein phosphat...    181   3e-48   Nicotiana tomentosiformis
ref|XP_008643918.1|  PREDICTED: uncharacterized protein LOC100381...    179   4e-48   
ref|XP_003561867.1|  PREDICTED: serine/threonine-protein phosphat...    181   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_010232097.1|  PREDICTED: serine/threonine-protein phosphat...    181   5e-48   Brachypodium distachyon [annual false brome]
ref|XP_008795124.1|  PREDICTED: serine/threonine-protein phosphat...    179   8e-48   Phoenix dactylifera
ref|XP_004982315.1|  PREDICTED: serine/threonine-protein phosphat...    179   8e-48   
ref|XP_006340327.1|  PREDICTED: serine/threonine-protein phosphat...    180   9e-48   Solanum tuberosum [potatoes]
ref|XP_006592360.1|  PREDICTED: serine/threonine-protein phosphat...    180   9e-48   
ref|XP_010419412.1|  PREDICTED: serine/threonine-protein phosphat...    180   9e-48   Camelina sativa [gold-of-pleasure]
ref|XP_004251224.1|  PREDICTED: serine/threonine-protein phosphat...    180   1e-47   Solanum lycopersicum
gb|ABV91338.1|  kelch repeat-containing protein /serine/threonine...    180   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101992.1|  Serine/threonine-protein phosphatase BSL2          180   1e-47   
ref|XP_006340328.1|  PREDICTED: serine/threonine-protein phosphat...    179   1e-47   Solanum tuberosum [potatoes]
gb|AAF22889.1|AC006932_6  T27G7.10                                      179   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464169.1|  hypothetical protein SORBIDRAFT_01g013460          179   2e-47   Sorghum bicolor [broomcorn]
ref|XP_010313488.1|  PREDICTED: serine/threonine-protein phosphat...    179   2e-47   Solanum lycopersicum
ref|XP_004496005.1|  PREDICTED: serine/threonine-protein phosphat...    178   3e-47   
ref|XP_004982314.1|  PREDICTED: serine/threonine-protein phosphat...    179   3e-47   Setaria italica
ref|XP_003577251.1|  PREDICTED: serine/threonine-protein phosphat...    179   3e-47   Brachypodium distachyon [annual false brome]
gb|EMT08803.1|  Serine/threonine-phosphatase BSL2-like protein          178   3e-47   
ref|XP_010112705.1|  Serine/threonine-protein phosphatase BSL1          177   4e-47   
gb|KDO46578.1|  hypothetical protein CISIN_1g001895mg                   178   5e-47   Citrus sinensis [apfelsine]
ref|XP_006826448.1|  hypothetical protein AMTR_s00004p00175690          178   1e-46   
gb|EMT33719.1|  Serine/threonine-phosphatase BSL2-like protein          175   8e-46   
emb|CDY22684.1|  BnaC08g43180D                                          174   1e-45   Brassica napus [oilseed rape]
emb|CDY06313.1|  BnaA09g48900D                                          174   1e-45   
ref|XP_009118376.1|  PREDICTED: serine/threonine-protein phosphat...    174   1e-45   
gb|KFK43163.1|  hypothetical protein AALP_AA1G088000                    172   5e-45   
emb|CBI24997.3|  unnamed protein product                                172   7e-45   
ref|XP_010031570.1|  PREDICTED: serine/threonine-protein phosphat...    171   7e-45   
ref|XP_002262846.2|  PREDICTED: serine/threonine-protein phosphat...    171   8e-45   
gb|AFW68156.1|  putative kelch repeat-containing protein containi...    165   3e-44   
ref|XP_009110896.1|  PREDICTED: serine/threonine-protein phosphat...    168   2e-43   
emb|CDX97481.1|  BnaC08g13460D                                          167   3e-43   
ref|XP_007508044.1|  predicted protein                                  162   5e-43   
emb|CDY31148.1|  BnaA08g26980D                                          166   6e-43   
ref|XP_002963377.1|  hypothetical protein SELMODRAFT_438528             162   7e-42   
ref|XP_002974662.1|  hypothetical protein SELMODRAFT_442608             162   8e-42   
ref|XP_007510268.1|  predicted protein                                  163   1e-41   
ref|XP_001420111.1|  predicted protein                                  160   9e-41   
emb|CEF99328.1|  Serine/threonine-specific protein phosphatase/bi...    158   5e-40   
emb|CAN67845.1|  hypothetical protein VITISV_016668                     155   6e-40   
ref|XP_003081555.1|  Serine/threonine specific protein phosphatas...    158   7e-40   
gb|KDD72092.1|  calcineurin-like phosphoesterase                        151   1e-39   
emb|CDY17966.1|  BnaC03g30380D                                          147   2e-39   
gb|KJB35473.1|  hypothetical protein B456_006G116600                    156   2e-39   
ref|XP_003058098.1|  predicted protein                                  152   6e-38   
ref|XP_001689767.1|  protein phosphatase 1 beta                         150   1e-37   
ref|XP_002499734.1|  predicted protein                                  150   3e-37   
ref|XP_005846245.1|  hypothetical protein CHLNCDRAFT_135536             149   4e-37   
ref|XP_005645525.1|  protein phosphatase 1 beta                         149   5e-37   
ref|XP_011402161.1|  Serine/threonine-protein phosphatase BSL3          147   9e-37   
ref|XP_002958148.1|  hypothetical protein VOLCADRAFT_84366              148   1e-36   
ref|XP_010474966.1|  PREDICTED: serine/threonine-protein phosphat...    143   4e-35   
gb|EPS58158.1|  serine/threonine-protein phosphatase                    135   3e-34   
ref|XP_010457353.1|  PREDICTED: serine/threonine-protein phosphat...    140   5e-34   
ref|XP_007508023.1|  predicted protein                                  135   3e-33   
pir||T00913  probable phosphoprotein phosphatase (EC 3.1.3.16) F2...    133   1e-31
ref|NP_171844.6|  serine/threonine-protein phosphatase BSU1             133   2e-31   
gb|AAF86539.1|AC002560_32  F21B7.7                                      133   2e-31   
emb|CDY07313.1|  BnaC05g26750D                                          125   9e-31   
ref|XP_006304779.1|  hypothetical protein CARUB_v10012319mg             130   1e-30   
emb|CAN62681.1|  hypothetical protein VITISV_026755                     122   6e-30   
ref|XP_006418234.1|  hypothetical protein EUTSA_v10009980mg             127   1e-29   
ref|XP_002892160.1|  Serine/threonine-protein phosphatase BSU1          125   7e-29   
ref|XP_009144944.1|  PREDICTED: serine/threonine-protein phosphat...    123   4e-28   
emb|CDY29598.1|  BnaA05g15720D                                          122   5e-28   
gb|KFK42699.1|  hypothetical protein AALP_AA1G028300                    118   5e-26   
gb|KFK42698.1|  hypothetical protein AALP_AA1G028300                    118   5e-26   
tpg|DAA50299.1|  TPA: putative kelch repeat-containing protein co...    117   5e-26   
gb|AFK45415.1|  unknown                                                 107   7e-25   
gb|AAC69437.1|  protein serine/threonine phosphatase alpha              111   5e-24   
gb|ETW46597.1|  hypothetical protein PFMALIP_05500                      111   8e-24   
gb|ETB63046.1|  hypothetical protein YYC_00643                          110   1e-23   
ref|XP_001348804.1|  protein serine/threonine phosphatase               110   1e-23   
gb|EUD70469.1|  protein phosphatase                                     110   1e-23   
ref|XP_727284.1|  protein serine/threonine phosphatase alpha            110   1e-23   
ref|XP_678280.1|  protein serine/threonine phosphatase                  110   1e-23   
emb|CDS50472.1|  protein phosphatase containing kelch-like domains      110   1e-23   
emb|CDO67125.1|  protein phosphatase containing kelch-like domain...    110   1e-23   
gb|EWC73527.1|  hypothetical protein C923_05783                         110   1e-23   
ref|XP_008622216.1|  protein phosphatase                                110   1e-23   
emb|CDR15635.1|  protein phosphatase containing kelch-like domain...    110   1e-23   
ref|XP_002260205.1|  protein serine/threonine phosphatase               110   2e-23   
ref|XP_008813960.1|  protein phosphatase                                109   2e-23   
ref|XP_004223870.1|  protein serine/threonine phosphatase               109   3e-23   
gb|ABR25780.1|  serine/threonine-protein phosphatase bsl2               105   3e-23   
ref|XP_001615727.1|  protein serine/threonine phosphatase               109   3e-23   
ref|XP_666328.1|  protein serine/threonine phosphatase alpha            108   3e-23   
ref|XP_001388090.1|  protein serine/threonine phosphatase alpha         108   4e-23   
ref|XP_001609688.1|  kelch repeat domain containing/Serine/threon...    108   4e-23   
gb|KFG42467.1|  kelch repeat domain containing/Serine/threonine p...    104   5e-23   
ref|XP_953085.1|  serine/threonine phosphatase                          108   6e-23   
ref|XP_764058.1|  serine/threonine protein phosphatase                  108   7e-23   
ref|XP_001458952.1|  hypothetical protein                               107   9e-23   
emb|CDX71467.1|  BnaC04g17020D                                          104   9e-23   
ref|XP_011129274.1|  serine/threonine-protein phosphatase               105   1e-22   
emb|CDR94993.1|  kelch repeat domain containing/Serine/threonine ...    107   1e-22   
ref|XP_001438977.1|  hypothetical protein                               107   2e-22   
ref|XP_001443631.1|  hypothetical protein                               106   2e-22   
emb|CDJ38799.1|  Serine/threonine-protein phosphatase , related         102   2e-22   
emb|CDI76910.1|  Serine/threonine-protein phosphatase , related         105   4e-22   
ref|XP_004831147.1|  Ser/Thr protein phosphatase family member pr...    106   5e-22   
ref|XP_001022531.2|  Ser/Thr protein phosphatase family protein         105   5e-22   
emb|CCF73649.1|  unnamed protein product                                105   6e-22   
ref|XP_008889177.1|  kelch repeat domain containing/Serine/threon...    105   7e-22   
ref|XP_002368432.1|  protein serine/threonine phosphatase, putati...    104   2e-21   
gb|ESS33859.1|  kelch repeat domain containing/Serine/threonine p...    104   2e-21   
gb|EPR59771.1|  kelch repeat domain containing/Serine/threonine p...    104   2e-21   
emb|CDW91130.1|  ser thr protein phosphatase family protein             103   3e-21   
emb|CDJ50529.1|  protein serine/threonine phosphatase, putative /...    102   4e-21   
ref|XP_002785335.1|  bsu-protein phosphatase, putative                  101   5e-21   
emb|CDJ58913.1|  Serine/threonine-protein phosphatase , related         102   5e-21   
ref|XP_002139134.1|  serine/threonine protein phosphatase               102   6e-21   
gb|EJY66618.1|  Serine/threonine-protein phosphatase                    102   9e-21   
ref|XP_004036424.1|  protein serine threonine phosphatase alpha, ...    100   4e-20   
gb|KIY95206.1|  hypothetical protein MNEG_12757                       93.2    4e-20   
ref|XP_004030178.1|  ser thr protein phosphatase family protein, ...  99.4    6e-20   
ref|XP_002788680.1|  protein serine/threonine phosphatase, putative   97.8    3e-19   
ref|XP_004995703.1|  hypothetical protein PTSG_03117                  96.3    1e-18   
gb|ETO30408.1|  hypothetical protein RFI_06712                        92.4    2e-18   
ref|XP_001429774.1|  hypothetical protein                             95.1    2e-18   
ref|XP_001746829.1|  hypothetical protein                             94.4    3e-18   
ref|XP_004987444.1|  hypothetical protein PTSG_11520                  90.9    4e-18   
gb|ETO22086.1|  protein serine/threonine phosphatase                  94.4    5e-18   
ref|XP_010023961.1|  PREDICTED: serine/threonine-protein phosphat...  89.4    1e-17   
ref|XP_010023960.1|  PREDICTED: serine/threonine-protein phosphat...  89.7    1e-17   
ref|XP_005793306.1|  hypothetical protein EMIHUDRAFT_417293           91.7    2e-17   
gb|EWM21847.1|  serine threonine-protein phosphatase bsl2             92.0    3e-17   
dbj|BAF48782.1|  hypothetical protein                                 85.9    5e-16   
ref|XP_002902202.1|  calcineurin-like phosphoesterase, putative       86.7    6e-16   
gb|ETO81245.1|  hypothetical protein F444_04413                       86.3    1e-15   
gb|ETK92354.1|  hypothetical protein L915_04269                       86.3    1e-15   
gb|ETM52081.1|  hypothetical protein L914_04213                       86.3    2e-15   
gb|ETI52475.1|  hypothetical protein F443_04391                       86.3    2e-15   
gb|ETL98921.1|  hypothetical protein L917_04107                       86.3    2e-15   
gb|ADE76458.1|  unknown                                               83.6    2e-15   
ref|XP_009692418.1|  serine/threonine protein phosphatase             85.9    2e-15   
ref|XP_009397621.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
gb|ETP50198.1|  hypothetical protein F442_04419                       85.9    2e-15   
ref|XP_010924761.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    2e-15   
ref|XP_008901676.1|  hypothetical protein PPTG_08717                  85.9    2e-15   
ref|XP_004510082.1|  PREDICTED: serine/threonine-protein phosphat...  82.8    3e-15   
ref|XP_007222643.1|  hypothetical protein PRUPE_ppa008543mg           83.2    3e-15   
dbj|BAJ99103.1|  predicted protein                                    82.4    3e-15   
ref|XP_008224363.1|  PREDICTED: serine/threonine-protein phosphat...  83.2    3e-15   
sp|P48480.1|PP11_ACEPE  RecName: Full=Serine/threonine-protein ph...  82.8    4e-15   
gb|KHN22207.1|  Serine/threonine-protein phosphatase PP1              82.0    5e-15   
ref|XP_009382144.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    5e-15   
gb|EJU02609.1|  catalytic subunit of type 1 serine/threonine prot...  82.4    5e-15   
ref|XP_006581185.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    5e-15   
ref|XP_010935746.1|  PREDICTED: serine/threonine-protein phosphat...  81.6    6e-15   
ref|XP_002277816.1|  PREDICTED: serine/threonine-protein phosphat...  82.0    7e-15   
dbj|BAM19951.1|  flapwing                                             78.2    7e-15   
ref|XP_002908542.1|  serine/threonine-protein phosphatase, putative   84.0    8e-15   
ref|XP_007016295.1|  Type one serine/threonine protein phosphatase 2  81.3    9e-15   
gb|ABE93049.1|  Serine/threonine-specific protein phosphatase and...  81.3    9e-15   
gb|KDO69205.1|  hypothetical protein CISIN_1g020919mg                 80.9    9e-15   
ref|XP_003626624.1|  Serine/threonine protein phosphatase PP1         81.3    9e-15   
ref|XP_007153420.1|  hypothetical protein PHAVU_003G033800g           81.3    1e-14   
gb|KHG03131.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  80.9    1e-14   
ref|XP_006486426.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    1e-14   
ref|XP_006435598.1|  hypothetical protein CICLE_v10032138mg           81.3    1e-14   
ref|XP_003881208.1|  serine/threonine protein phosphatase, related    83.6    1e-14   
gb|KIR26850.1|  serine/threonine-protein phosphatase PP1              78.6    1e-14   
ref|XP_008795019.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    1e-14   
ref|XP_001395377.2|  serine/threonine-protein phosphatase PP2A ca...  81.3    1e-14   
gb|ERG80424.1|  serine threonine-protein phosphatase pp1 isozyme 7    78.6    1e-14   
gb|KJB19980.1|  hypothetical protein B456_003G128300                  80.9    1e-14   
ref|XP_008796501.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    1e-14   
gb|KDO32597.1|  hypothetical protein SPRG_03070                       83.2    1e-14   
ref|XP_004305060.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    1e-14   
ref|XP_008604603.1|  hypothetical protein SDRG_00878                  83.2    1e-14   
gb|KDO57610.1|  hypothetical protein CISIN_1g017614mg                 80.1    1e-14   
ref|XP_011085000.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    1e-14   
gb|EHA25766.1|  hypothetical protein ASPNIDRAFT_50362                 80.9    1e-14   
emb|CAK41137.1|  unnamed protein product                              80.9    1e-14   
ref|XP_006827474.1|  hypothetical protein AMTR_s00009p00134520        80.5    1e-14   
ref|XP_010935745.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    1e-14   
ref|XP_002319103.2|  hypothetical protein POPTR_0013s04310g           80.5    1e-14   
ref|XP_011073522.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
ref|XP_009398739.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
ref|XP_009339616.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
ref|XP_008784741.1|  PREDICTED: serine/threonine-protein phosphat...  80.9    2e-14   
emb|CCA19201.1|  serine/threonineprotein phosphatase PP1gamma cat...  80.9    2e-14   
emb|CDS11155.1|  Putative Serine/threonine-protein phosphatase        80.9    2e-14   
ref|XP_009342488.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
emb|CCI39850.1|  unnamed protein product                              80.9    2e-14   
gb|KHG02218.1|  Serine/threonine-protein phosphatase PP1 isozyme ...  80.5    2e-14   
ref|XP_001985583.1|  GH17149                                          80.5    2e-14   
ref|XP_010935744.1|  PREDICTED: serine/threonine-protein phosphat...  81.3    2e-14   
ref|XP_010261395.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
emb|CDH50078.1|  serine threonine-protein phosphatase pp1             80.9    2e-14   
gb|KJB08919.1|  hypothetical protein B456_001G112800                  80.1    2e-14   
gb|KDP23705.1|  hypothetical protein JCGZ_23538                       80.9    2e-14   
emb|CDS04786.1|  Putative Serine/threonine-protein phosphatase        80.9    2e-14   
ref|XP_002905419.1|  serine/threonine-protein phosphatase PP1-gam...  80.5    2e-14   
emb|CBI31141.3|  unnamed protein product                              80.1    2e-14   
gb|EYU35261.1|  hypothetical protein MIMGU_mgv1a0105852mg             79.7    2e-14   
emb|CDY22350.1|  BnaA06g36720D                                        80.5    2e-14   
ref|XP_009398030.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
ref|XP_009101787.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
gb|KJB08918.1|  hypothetical protein B456_001G112800                  80.1    2e-14   
ref|XP_002521968.1|  serine/threonine protein phosphatase, putative   80.9    2e-14   
emb|CDY60901.1|  BnaCnng37040D                                        80.5    2e-14   
gb|KHG29440.1|  hypothetical protein F383_12544                       80.5    2e-14   
ref|XP_009101788.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    2e-14   
emb|CAK36941.1|  unnamed protein product                              77.4    2e-14   
emb|CAQ58626.1|  Serine-threonine phosphatase type 1                  80.1    2e-14   
gb|ETP53871.1|  hypothetical protein F442_01262                       82.4    2e-14   
ref|XP_004296363.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    2e-14   
ref|XP_002264806.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    2e-14   
emb|CCF44786.1|  serine/threonine-protein phosphatase PP1             77.4    2e-14   
ref|XP_002298335.1|  Serine/threonine protein phosphatase PP1 iso...  80.1    2e-14   
ref|XP_010940610.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    3e-14   
ref|XP_002323107.1|  hypothetical protein POPTR_0016s14930g           80.1    3e-14   
gb|ETL49264.1|  hypothetical protein L916_01227                       82.8    3e-14   
ref|XP_009381054.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
emb|CBI31608.3|  unnamed protein product                              80.1    3e-14   
ref|XP_002863660.1|  hypothetical protein ARALYDRAFT_494661           80.5    3e-14   
ref|XP_009373991.1|  PREDICTED: serine/threonine-protein phosphat...  80.5    3e-14   
ref|XP_008890978.1|  hypothetical protein PPTG_01130                  82.4    3e-14   
ref|XP_011462265.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
gb|KDO24417.1|  serine/threonine-protein phosphatase PP1              80.1    3e-14   
gb|ETO84799.1|  hypothetical protein F444_01323                       82.4    3e-14   
ref|XP_010272441.1|  PREDICTED: serine/threonine-protein phosphat...  79.7    3e-14   
ref|XP_002282188.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_001388833.2|  serine/threonine-protein phosphatase PP1         77.4    3e-14   
ref|XP_009845345.1|  serine/threonine-protein phosphatase             80.1    3e-14   
ref|XP_011006236.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_005644561.1|  protein phosphatase 1                            79.7    3e-14   
gb|AFW99159.1|  serine/threonine-protein phosphatase PP1 isozyme ...  79.0    3e-14   
ref|XP_006648131.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
gb|ACN69491.1|  serine/threonine-protein phosphatase                  77.4    3e-14   
ref|XP_009522482.1|  hypothetical protein PHYSODRAFT_312787           81.6    3e-14   
ref|XP_008792366.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
emb|CAN71489.1|  hypothetical protein VITISV_005340                   79.7    3e-14   
gb|ETW45826.1|  serine/threonine-protein phosphatase PP1-gamma ca...  76.6    3e-14   
gb|KJB82281.1|  hypothetical protein B456_013G187100                  80.1    3e-14   
gb|AAK68780.1|  protein phosphatase                                   79.0    3e-14   
gb|ABW74579.1|  putative serine/threonine phosphatase                 79.7    3e-14   
gb|EUR64176.1|  serine/threonine-protein phosphatase PP1-gamma ca...  76.6    3e-14   
ref|XP_008341122.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_010759698.1|  serine/threonine-protein phosphatase PP1         77.4    3e-14   
ref|XP_009382143.1|  PREDICTED: serine/threonine-protein phosphat...  80.1    3e-14   
ref|XP_004356641.1|  protein phosphatase 1, catalytic subunit, al...  80.5    4e-14   



>gb|EYU38112.1| hypothetical protein MIMGU_mgv1a0013162mg, partial [Erythranthe 
guttata]
Length=144

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  3    PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  62

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP  SP+TSPERV ++TWMQELNIQ
Sbjct  63   LFSATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPFQSPETSPERVTDETWMQELNIQ  122

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP+LDR+SLAYI
Sbjct  123  RPPTPTRGRPQPELDRSSLAYI  144



>ref|XP_004158630.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Cucumis 
sativus]
Length=321

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  180  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  239

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQ
Sbjct  240  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQ  299

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            R PTPTRGRPQPDLDR+SLAYI
Sbjct  300  RRPTPTRGRPQPDLDRSSLAYI  321



>gb|KGN47886.1| hypothetical protein Csa_6G409920 [Cucumis sativus]
Length=394

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  253  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  312

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQ
Sbjct  313  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQ  372

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  373  RPPTPTRGRPQPDLDRSSLAYI  394



>gb|EPS64063.1| serine/threonine-protein phosphatase, partial [Genlisea aurea]
Length=212

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTEND V+GLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  71   PTENDGVQGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  130

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPE   ++TWMQELNIQ
Sbjct  131  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPEHAADETWMQELNIQ  190

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  191  RPPTPTRGRPQPDLDRNSLAYI  212



>gb|KJB22565.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=538

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  397  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  456

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  457  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  516

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  517  RPPTPTRGRPQPDHDRSSLAYI  538



>ref|XP_010070326.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Eucalyptus 
grandis]
 gb|KCW58989.1| hypothetical protein EUGRSUZ_H01613 [Eucalyptus grandis]
Length=887

 Score =   219 bits (557),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  866  RPPTPTRGRPQPDLDRSSLAYI  887



>ref|XP_007050742.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
 gb|EOX94899.1| BRI1 suppressor 1 (BSU1)-like 1 [Theobroma cacao]
Length=887

 Score =   217 bits (552),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVADDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  866  RPPTPTRGRPQPDLDRSSLAYI  887



>emb|CDP03570.1| unnamed protein product [Coffea canephora]
Length=883

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  742  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  801

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+ WMQELNIQ
Sbjct  802  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEENWMQELNIQ  861

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  862  RPPTPTRGRPQPDLDRNSLAYI  883



>ref|XP_009593091.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
tomentosiformis]
Length=879

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  738  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  797

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQ
Sbjct  798  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQ  857

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  858  RPPTPTRGRPQPDHDRSSLAYI  879



>gb|KJB22563.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
 gb|KJB22564.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=670

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  529  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  588

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  589  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  648

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  649  RPPTPTRGRPQPDHDRSSLAYI  670



>ref|XP_009778415.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778416.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778417.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
 ref|XP_009778418.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Nicotiana 
sylvestris]
Length=879

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  738  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  797

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNIQ
Sbjct  798  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNIQ  857

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  858  RPPTPTRGRPQPDHDRSSLAYI  879



>ref|XP_008449460.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Cucumis 
melo]
Length=883

 Score =   216 bits (550),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  742  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  801

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  EDTWMQELNIQ
Sbjct  802  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERTVEDTWMQELNIQ  861

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  862  RPPTPTRGRPQPDLDRSSLAYI  883



>ref|XP_008777710.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Phoenix dactylifera]
Length=552

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  411  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  470

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRG V+VPKLIHPLPPPL SPD+SP+ V EDTWMQELNIQ
Sbjct  471  LFSATNYCGTANNAGAILVVGRGFVVVPKLIHPLPPPLRSPDSSPDHVLEDTWMQELNIQ  530

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  531  RPPTPTRGRPQSANDRNSLAYI  552



>ref|XP_004140092.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1-like [Cucumis sativus]
Length=905

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  764  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  823

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQ
Sbjct  824  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERMIEDTWMQELNIQ  883

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  884  RPPTPTRGRPQPDLDRSSLAYI  905



>ref|XP_006366382.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Solanum 
tuberosum]
Length=293

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  152  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  211

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELNIQ
Sbjct  212  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQ  271

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  272  RPPTPTRGRPQPDHDRSSLAYI  293



>ref|NP_001169882.1| uncharacterized protein LOC100383776 [Zea mays]
 gb|ACN35157.1| unknown [Zea mays]
Length=187

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  47   PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  106

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  107  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQ  165

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  166  RPPTPTRGRPQAAGDRNSLAYI  187



>ref|XP_010279479.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Nelumbo 
nucifera]
Length=885

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV ++TWMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVLDETWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTP RGRPQPDLDR+SLAYI
Sbjct  864  RPPTPIRGRPQPDLDRSSLAYI  885



>emb|CAC11128.1| protein phosphatase [Fagus sylvatica]
Length=262

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQLIT
Sbjct  121  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQLIT  180

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNIQ
Sbjct  181  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNIQ  240

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  241  RPPTPTRGRPQPDLDRSSLAYI  262



>ref|XP_010522673.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=837

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  696  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  755

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQ
Sbjct  756  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQ  815

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  816  RPPTPTRGRPQPDLDRNSLAYI  837



>ref|XP_010522672.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
Length=887

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPERSGDDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  866  RPPTPTRGRPQPDLDRNSLAYI  887



>gb|KJB22562.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=891

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  750  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  809

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  810  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  869

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  870  RPPTPTRGRPQPDHDRSSLAYI  891



>gb|KJB22561.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=777

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  636  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  695

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  696  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  755

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  756  RPPTPTRGRPQPDHDRSSLAYI  777



>gb|KJB22560.1| hypothetical protein B456_004G054500 [Gossypium raimondii]
Length=887

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  866  RPPTPTRGRPQPDHDRSSLAYI  887



>gb|KHG21887.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=827

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  686  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  745

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  746  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  805

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  806  RPPTPTRGRPQPDHDRSSLAYI  827



>gb|KHG21886.1| Serine/threonine-protein phosphatase BSL1 [Gossypium arboreum]
Length=854

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  713  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  772

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  773  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPIQSPETSPERVGDDTWMQELNIQ  832

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  833  RPPTPTRGRPQPDHDRSSLAYI  854



>gb|AEK86563.1| serine/threonine-protein phosphatase [Camellia sinensis]
Length=888

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  747  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  806

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGA+LVVGRGLVIVPKLIHPLPPP  SP+TSPERV  D WMQELNIQ
Sbjct  807  LFSATNYCGTANNAGALLVVGRGLVIVPKLIHPLPPPFQSPETSPERVVHDAWMQELNIQ  866

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP+LDRNSLAYI
Sbjct  867  RPPTPTRGRPQPELDRNSLAYI  888



>ref|XP_011082512.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Sesamum 
indicum]
Length=882

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  741  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  800

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPER+ E+TWMQELNIQ
Sbjct  801  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERMTEETWMQELNIQ  860

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  861  RPPTPTRGRPQPDHDRSSLAYI  882



>dbj|BAK04150.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  239  PTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  298

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  299  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  358

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  359  RPPTPTRGRPHSAGDRNSLAYI  380



>ref|XP_010684726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Beta vulgaris 
subsp. vulgaris]
Length=877

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  736  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAHGQLIT  795

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELNIQ
Sbjct  796  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPETSPERCLDDTWMQELNIQ  855

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DRNSLAYI
Sbjct  856  RPPTPTRGRPQPDHDRNSLAYI  877



>ref|XP_011033646.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Populus euphratica]
Length=885

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RP TPTRGRPQPD DR+SLAYI
Sbjct  864  RPQTPTRGRPQPDHDRSSLAYI  885



>ref|XP_011033645.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Populus euphratica]
Length=886

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV GRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVGGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RP TPTRGRPQPD DR+SLAYI
Sbjct  865  RPQTPTRGRPQPDHDRSSLAYI  886



>ref|XP_010556798.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010556799.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Tarenaya hassleriana]
Length=887

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGR LVIVPKLIHPLPPP+LSP+ SPER  +DTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRELVIVPKLIHPLPPPILSPENSPERSMDDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  866  RPPTPTRGRPQPDFDRSSLAYI  887



>ref|XP_007201214.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
 gb|EMJ02413.1| hypothetical protein PRUPE_ppa001177mg [Prunus persica]
Length=887

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  866  RPPTPTRGRPQPDLDRNSLAYI  887



>ref|NP_192217.2| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
 sp|Q8L7U5.2|BSL1_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL1; AltName: 
Full=BSU1-like protein 1 [Arabidopsis thaliana]
 gb|AEE82268.1| serine/threonine-protein phosphatase BSL1 [Arabidopsis thaliana]
Length=881

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>gb|KDO87444.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=475

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  334  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  393

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  394  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  453

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  454  RPPTPTRGRPQPDLDRNSLAYI  475



>ref|XP_008234964.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 [Prunus mume]
Length=873

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  732  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  791

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV EDTWMQELNIQ
Sbjct  792  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDTWMQELNIQ  851

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  852  RPPTPTRGRPQPDLDRNSLAYI  873



>ref|XP_009385028.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Musa acuminata subsp. malaccensis]
Length=893

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  752  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  811

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GRGLV+VPKLIHPLPPPL SP++SPE   EDTWMQELNIQ
Sbjct  812  LFSATNYCGTANNAGAILVIGRGLVVVPKLIHPLPPPLQSPESSPEHAVEDTWMQELNIQ  871

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR+SLAYI
Sbjct  872  RPPTPTRGRPQSANDRSSLAYI  893



>gb|AAC79097.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
 emb|CAB77793.1| putative phospho-ser/thr phosphatase [Arabidopsis thaliana]
Length=894

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  753  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  812

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  813  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  872

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  873  RPPTPTRGRPQPDFDRSSLAYI  894



>gb|AFN44702.1| Ser/Thr phosphatase-containing Kelch repeat domain protein, partial 
[Nicotiana benthamiana]
Length=490

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKL LIIRAHECVMDGFERFAQGQL T
Sbjct  361  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLXLIIRAHECVMDGFERFAQGQLXT  420

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  392
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPL SP+TSPERV EDTWMQELNI
Sbjct  421  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLQSPETSPERVMEDTWMQELNI  479



>ref|XP_009144526.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Brassica 
rapa]
Length=880

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  739  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  798

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  799  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  858

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  859  RPPTPTRGRPQPDFDRSSLAYI  880



>emb|CDX97296.1| BnaA02g20870D [Brassica napus]
Length=874

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  733  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  792

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  793  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  852

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  853  RPPTPTRGRPQPDFDRSSLAYI  874



>emb|CDY62088.1| BnaC02g46770D [Brassica napus]
Length=877

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  736  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  795

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  796  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  855

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  856  RPPTPTRGRPQPDFDRSSLAYI  877



>emb|CDX90906.1| BnaA03g25860D [Brassica napus]
Length=886

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  865  RPPTPTRGRPQPDFDRSSLAYI  886



>ref|XP_006396534.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
 gb|ESQ37987.1| hypothetical protein EUTSA_v10028417mg [Eutrema salsugineum]
Length=881

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_006286760.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
 gb|EOA19658.1| hypothetical protein CARUB_v10003201mg [Capsella rubella]
Length=881

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>emb|CDY17964.1| BnaC03g30360D [Brassica napus]
Length=886

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  865  RPPTPTRGRPQPDFDRSSLAYI  886



>ref|XP_010455968.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Camelina sativa]
 ref|XP_010455970.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Camelina sativa]
Length=882

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  741  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  800

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  801  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  860

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  861  RPPTPTRGRPQPDFDRSSLAYI  882



>ref|XP_010430668.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=882

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  741  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  800

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  801  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  860

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  861  RPPTPTRGRPQPDFDRSSLAYI  882



>ref|XP_010422504.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Camelina 
sativa]
Length=881

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>ref|XP_002872798.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49057.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=881

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>gb|AFN44700.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=878

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  737  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSP+TSPERV +D WMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPLLSPETSPERVMDDNWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  857  RPPTPTRGRPQPDHDRSSLAYI  878



>ref|XP_009134374.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Brassica 
rapa]
Length=878

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  737  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  857  RPPTPTRGRPQPDFDRSSLAYI  878



>ref|XP_010231726.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Brachypodium distachyon]
Length=900

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  759  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  818

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  819  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQ  878

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  879  RPPTPTRGRPHSASDRNSLAYI  900



>ref|XP_010231727.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Brachypodium distachyon]
Length=868

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  727  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  786

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  787  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQ  846

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  847  RPPTPTRGRPHSASDRNSLAYI  868



>ref|XP_003568959.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Brachypodium distachyon]
Length=889

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  748  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  807

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  808  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPINSPESSPERAMDATWMQELNIQ  867

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  868  RPPTPTRGRPHSASDRNSLAYI  889



>ref|XP_006654987.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Oryza brachyantha]
Length=829

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLIT
Sbjct  688  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLIT  747

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  748  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  807

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  808  RPPTPTRGRPQSASDRNSLAYI  829



>gb|AAM83219.1| AT4g03080/T4I9_4 [Arabidopsis thaliana]
Length=881

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  740  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAPGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  860  RPPTPTRGRPQPDFDRSSLAYI  881



>gb|EEE62303.1| hypothetical protein OsJ_17091 [Oryza sativa Japonica Group]
Length=877

 Score =   204 bits (519),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLIT
Sbjct  736  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLIT  795

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  796  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  855

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  856  RPPTPTRGRPQSASDRNSLAYI  877



>ref|NP_001054625.1| Os05g0144400 [Oryza sativa Japonica Group]
 sp|Q60EX6.1|BSL1_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL1 homolog; 
AltName: Full=BSU1-like protein 1 homolog [Oryza sativa 
Japonica Group]
 gb|AAU90203.1| putative Serine/threonine protein phosphatase BSL1 [Oryza sativa 
Japonica Group]
 dbj|BAF16539.1| Os05g0144400 [Oryza sativa Japonica Group]
 dbj|BAG99920.1| unnamed protein product [Oryza sativa Japonica Group]
Length=883

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQLIT
Sbjct  742  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQLIT  801

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  802  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  861

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  862  RPPTPTRGRPQSASDRNSLAYI  883



>gb|EMS55151.1| Serine/threonine-protein phosphatase BSL1-like protein [Triticum 
urartu]
Length=770

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  629  PTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  688

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  689  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  748

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  749  RPPTPTRGRPHSAGDRNSLAYI  770



>emb|CAC09573.1| protein phosphatase 1 (PP1) [Fagus sylvatica]
Length=139

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQLIT
Sbjct  7    PTENDSAEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQLIT  66

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  392
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER+ EDTWMQELNI
Sbjct  67   LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELNI  125



>ref|XP_003591594.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=425

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  284  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  343

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQ
Sbjct  344  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQ  403

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  404  RPPTPTRGRPQPDLDRGSLAYI  425



>gb|KDO87443.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=646

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  505  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  564

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  565  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  624

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  625  RPPTPTRGRPQPDLDRNSLAYI  646



>ref|XP_008368903.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
 ref|XP_008363688.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Malus domestica]
Length=884

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  743  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  802

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQ
Sbjct  803  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQ  862

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  863  RPPTPTRGRPQPDLDRNSLAYI  884



>ref|XP_008368904.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
 ref|XP_008363689.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Malus domestica]
Length=882

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  741  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  800

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQ
Sbjct  801  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQ  860

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  861  RPPTPTRGRPQPDLDRNSLAYI  882



>gb|EMT11348.1| Serine/threonine phosphatase BSL1-like protein [Aegilops tauschii]
Length=840

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  699  PTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  758

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  759  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELNIQ  818

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DRNSLAYI
Sbjct  819  RPPTPTRGRPHSAGDRNSLAYI  840



>gb|KDO87442.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=679

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  538  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  597

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  598  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  657

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  658  RPPTPTRGRPQPDLDRNSLAYI  679



>ref|XP_002270638.2| PREDICTED: serine/threonine-protein phosphatase BSL1 [Vitis vinifera]
 emb|CBI32287.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  747  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  806

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  +DTWMQELNIQ
Sbjct  807  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERTVDDTWMQELNIQ  866

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  867  RPPTPTRGRPQPDLDRNSLAYI  888



>gb|KDP21537.1| hypothetical protein JCGZ_22008 [Jatropha curcas]
Length=886

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  865  RPPTPTRGRPQPDLDRSSLAYI  886



>ref|XP_002520710.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF41672.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=885

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVMDDTWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  864  RPPTPTRGRPQPDLDRSSLAYI  885



>ref|XP_004290707.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Fragaria 
vesca subsp. vesca]
Length=883

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTEND VEGLRPNARGPGLVTFGPDRV DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  742  PTENDGVEGLRPNARGPGLVTFGPDRVMDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  801

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+TSPERV +DTWMQELNIQ
Sbjct  802  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIQSPETSPERVIDDTWMQELNIQ  861

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  862  RPPTPTRGRPQPDLDRNSLAYI  883



>ref|XP_011011092.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
 ref|XP_011012419.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Populus euphratica]
Length=886

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  865  RPPTPTRGRPQPDLDRNSLAYI  886



>gb|KDO87440.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87441.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=810

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  669  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  728

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  729  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  788

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  789  RPPTPTRGRPQPDLDRNSLAYI  810



>ref|XP_011011093.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
 ref|XP_011012420.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Populus euphratica]
Length=885

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV  D WMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIHDAWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  RPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_006444191.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479835.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Citrus sinensis]
 gb|ESR57431.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87437.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
 gb|KDO87438.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=885

 Score =   202 bits (513),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  RPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_006444192.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006444193.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 ref|XP_006479834.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Citrus sinensis]
 gb|ESR57432.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|ESR57433.1| hypothetical protein CICLE_v10018791mg [Citrus clementina]
 gb|KDO87439.1| hypothetical protein CISIN_1g002713mg [Citrus sinensis]
Length=889

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  748  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  807

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  808  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQ  867

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  868  RPPTPTRGRPQPDLDRNSLAYI  889



>ref|XP_008386603.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
 ref|XP_008350076.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Malus 
domestica]
Length=886

 Score =   202 bits (513),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCKRNKLQLI+RAHECVMDGFERFAQGQLIT
Sbjct  745  PTENDSVEGLRPNARGPGLVTFGPDRVAEFCKRNKLQLIVRAHECVMDGFERFAQGQLIT  804

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +DTWMQELNIQ
Sbjct  805  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDTWMQELNIQ  864

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  865  RPPTPTRGRPQPDLDRNSLAYI  886



>ref|XP_009347104.1| PREDICTED: serine/threonine-protein phosphatase BSL1 [Pyrus x 
bretschneideri]
Length=885

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLI+RAHECVMDGFERFAQGQLIT
Sbjct  744  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIVRAHECVMDGFERFAQGQLIT  803

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  804  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQ  863

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  864  RPPTPTRGRPQPDLDRNSLAYI  885



>ref|XP_002301559.1| phosphatase family protein [Populus trichocarpa]
 gb|EEE80832.1| phosphatase family protein [Populus trichocarpa]
Length=890

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV+DFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  749  PTENDSIEGLRPNARGPGLVTFGPDRVSDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  808

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV +D WMQELNIQ
Sbjct  809  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDAWMQELNIQ  868

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  869  RPPTPTRGRPQPDLDRNSLAYI  890



>ref|XP_002439264.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
 gb|EES17694.1| hypothetical protein SORBIDRAFT_09g003440 [Sorghum bicolor]
Length=895

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  755  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  814

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  815  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQ  873

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  874  RPPTPTRGRPQAAGDRNSLAYI  895



>ref|XP_008655295.1| PREDICTED: uncharacterized protein LOC100383776 isoform X2 [Zea 
mays]
Length=979

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  839  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  898

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  899  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQ  957

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  958  RPPTPTRGRPQAAGDRNSLAYI  979



>ref|XP_008655294.1| PREDICTED: uncharacterized protein LOC100383776 isoform X1 [Zea 
mays]
Length=987

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  847  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  906

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  907  LFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQ  965

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  966  RPPTPTRGRPQAAGDRNSLAYI  987



>gb|KHN46606.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=818

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  677  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  736

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELNIQ
Sbjct  737  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQ  796

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  797  RPPTPTRGRPQPDLDRGSLAYI  818



>ref|XP_003518942.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X1 [Glycine max]
Length=881

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPERV ++TWMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERVMDETWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  860  RPPTPTRGRPQPDLDRGSLAYI  881



>ref|XP_007201685.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
 gb|EMJ02884.1| hypothetical protein PRUPE_ppa022807mg, partial [Prunus persica]
Length=729

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKR KLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  481  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRKKLQLIIRAHECVMDGFERFAQGQLIT  540

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPERV ED WMQELNIQ
Sbjct  541  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIEDMWMQELNIQ  600

Query  388  rpptptrgrpqPDLDRNSLA  329
            RPPTPTRGRPQPDLDRNSLA
Sbjct  601  RPPTPTRGRPQPDLDRNSLA  620



>ref|XP_010244625.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X2 [Nelumbo nucifera]
Length=888

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  747  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  806

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELNIQ
Sbjct  807  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQ  866

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  867  RPPTPTRGRPQPDLDRSSLAYI  888



>ref|XP_010244624.1| PREDICTED: serine/threonine-protein phosphatase BSL1 isoform 
X1 [Nelumbo nucifera]
Length=897

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  756  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  815

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V ++TWMQELNIQ
Sbjct  816  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVLDETWMQELNIQ  875

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR+SLAYI
Sbjct  876  RPPTPTRGRPQPDLDRSSLAYI  897



>gb|AES61845.2| serine/threonine-protein phosphatase [Medicago truncatula]
Length=879

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  738  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  797

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQ
Sbjct  798  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQ  857

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  858  RPPTPTRGRPQPDLDRGSLAYI  879



>ref|XP_003591586.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=771

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  630  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  689

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQ
Sbjct  690  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQ  749

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  750  RPPTPTRGRPQPDLDRGSLAYI  771



>ref|XP_004496006.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like isoform 
X2 [Cicer arietinum]
Length=876

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  735  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  794

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP++SPERV ++TWMQELNIQ
Sbjct  795  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPESSPERVMDETWMQELNIQ  854

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  855  RPPTPTRGRPQPDLDRGSLAYI  876



>ref|XP_007144577.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
 gb|ESW16571.1| hypothetical protein PHAVU_007G167400g [Phaseolus vulgaris]
Length=878

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  737  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPER  ++TWMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERGMDETWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  857  RPPTPTRGRPQPDLDRGSLAYI  878



>ref|XP_002321044.2| phosphatase family protein [Populus trichocarpa]
 gb|EEE99359.2| phosphatase family protein [Populus trichocarpa]
Length=892

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  751  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  810

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP+TSPE V +DTWMQELNIQ
Sbjct  811  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPEHVIDDTWMQELNIQ  870

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RP TPTRGRPQPD DR+SLAYI
Sbjct  871  RPQTPTRGRPQPDHDRSSLAYI  892



>ref|XP_006826451.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
 gb|ERM93688.1| hypothetical protein AMTR_s00004p00179740, partial [Amborella 
trichopoda]
Length=671

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFAQG LIT
Sbjct  530  PTENDSIEGLRPNARGPGLVTFGPDRVLDFCKKNRLQLIIRAHECVMDGFERFAQGHLIT  589

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGR LV+VPKLIHPLPPP  SP++SP+   E+TWMQELNIQ
Sbjct  590  LFSATNYCGTANNAGAILVVGRDLVVVPKLIHPLPPPFQSPESSPDHALEETWMQELNIQ  649

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP  DRNSLA+I
Sbjct  650  RPPTPTRGRPQPAHDRNSLAFI  671



>ref|XP_010914371.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X3 [Elaeis guineensis]
Length=611

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  470  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  529

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQ
Sbjct  530  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQ  589

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR+SLAYI
Sbjct  590  RPPTPTRGRPQSANDRHSLAYI  611



>gb|KGN66603.1| hypothetical protein Csa_1G638500 [Cucumis sativus]
Length=288

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  147  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  206

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  
Sbjct  207  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNAN  266

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA++
Sbjct  267  RPPTPTRGRPQVANDRGSLAWM  288



>ref|XP_010914370.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X2 [Elaeis guineensis]
Length=619

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  478  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  537

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQ
Sbjct  538  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQ  597

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR+SLAYI
Sbjct  598  RPPTPTRGRPQSANDRHSLAYI  619



>ref|XP_003536338.1| PREDICTED: serine/threonine-protein phosphatase BSL1-like [Glycine 
max]
Length=881

 Score =   196 bits (499),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  740  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  799

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER  ++TWMQELNIQ
Sbjct  800  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGMDETWMQELNIQ  859

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDR SLAYI
Sbjct  860  RPPTPTRGRPQPDLDRGSLAYI  881



>ref|XP_010914369.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
isoform X1 [Elaeis guineensis]
Length=669

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  528  PTENDSIEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  587

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPL SP++SP+ V EDTWMQELNIQ
Sbjct  588  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLRSPESSPDHVLEDTWMQELNIQ  647

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR+SLAYI
Sbjct  648  RPPTPTRGRPQSANDRHSLAYI  669



>gb|AFY26889.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Morella rubra]
Length=887

 Score =   196 bits (498),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  746  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  805

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +D WMQELNIQ
Sbjct  806  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVIDDAWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPDLDRNSLAYI
Sbjct  866  RPPTPTRGRPQPDLDRNSLAYI  887



>ref|NP_001266004.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 ref|XP_010326541.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326542.1| PREDICTED: hop-interacting protein THI129 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69819.1| Hop-interacting protein THI129 [Solanum lycopersicum]
 gb|AFU48608.1| BSL1, partial [Solanum lycopersicum]
Length=878

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  737  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPPLLSP+TSPERV +DTWMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLLSPETSPERVMDDTWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  857  RPPTPTRGRPQPDHDRSSLAYI  878



>gb|ACR38393.1| unknown [Zea mays]
Length=213

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  71   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  130

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  131  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  188



>gb|KJB42021.1| hypothetical protein B456_007G132700 [Gossypium raimondii]
Length=878

 Score =   194 bits (493),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQLIT
Sbjct  737  PTENDSVEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP++DRNSLAYI
Sbjct  857  RPPTPTRGRPQPEVDRNSLAYI  878



>gb|EYU41290.1| hypothetical protein MIMGU_mgv1a0202662mg, partial [Erythranthe 
guttata]
Length=554

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  413  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  472

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN  
Sbjct  473  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNAN  532

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  533  RPPTPTRGRPQVTNDRGSLAWI  554



>gb|KHG15629.1| Serine/threonine-protein phosphatase BSL1 -like protein [Gossypium 
arboreum]
Length=838

 Score =   193 bits (491),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRV DFCK+N+LQLIIRAHECVMDGFERFA GQLIT
Sbjct  697  PTENDSIEGLRPNARGPGLVTFGPDRVADFCKKNRLQLIIRAHECVMDGFERFAHGQLIT  756

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP+ SPERV +D WMQELNIQ
Sbjct  757  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPIHSPEASPERVGDDAWMQELNIQ  816

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP++DRNSLAYI
Sbjct  817  RPPTPTRGRPQPEVDRNSLAYI  838



>ref|XP_001760494.1| predicted protein [Physcomitrella patens]
 gb|EDQ74569.1| predicted protein [Physcomitrella patens]
Length=954

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  813  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLIT  872

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP++SPER  EDTWMQELN+Q
Sbjct  873  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAITSPESSPERHLEDTWMQELNVQ  932

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  933  RPPTPTRGRPQAGNDRGSLAWI  954



>ref|XP_001769730.1| predicted protein [Physcomitrella patens]
 gb|EDQ65531.1| predicted protein [Physcomitrella patens]
Length=962

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  821  PTENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLIT  880

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ+LN+ 
Sbjct  881  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQDLNVA  940

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQP  DRNSLA+I
Sbjct  941  RPPTPTRGRPQPTSDRNSLAWI  962



>gb|KFK30905.1| hypothetical protein AALP_AA6G041300 [Arabis alpina]
Length=878

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  737  PTENDSIEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  796

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+LSP+ SPE   +D WMQELNIQ
Sbjct  797  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPILSPENSPEHSGDDAWMQELNIQ  856

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQPD DR+SLAYI
Sbjct  857  RPPTPTRGRPQPDFDRSSLAYI  878



>gb|EYU25965.1| hypothetical protein MIMGU_mgv1a0006241mg, partial [Erythranthe 
guttata]
Length=701

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  560  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  619

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER+ EDTWMQELN  
Sbjct  620  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERLIEDTWMQELNAN  679

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  680  RPPTPTRGRPQVTNDRGSLAWI  701



>ref|NP_001131445.1| uncharacterized LOC100192777 [Zea mays]
 gb|ACF79850.1| unknown [Zea mays]
Length=290

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  148  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  207

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  208  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  265



>ref|NP_001167772.1| uncharacterized protein LOC100381465 [Zea mays]
 gb|ACN26023.1| unknown [Zea mays]
Length=157

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  16   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  75

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  76   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  132



>gb|KJB55562.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=528

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  387  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  446

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  447  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  506

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  507  RPPTPTRGRPQVANDRGSLAWI  528



>ref|XP_010647448.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
 ref|XP_010647506.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Vitis 
vinifera]
Length=660

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  519  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  578

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  579  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  638

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  639  RPPTPTRGRPQVTNDRGSLAWI  660



>ref|XP_003538088.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=1010

 Score =   192 bits (487),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  869   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  928

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN  
Sbjct  929   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNAN  988

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  989   RPPTPTRGRPQVTNDRGSLAWI  1010



>ref|NP_180289.3| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 sp|Q9SHS7.2|BSL3_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL3; AltName: 
Full=BSU1-like protein 3 [Arabidopsis thaliana]
 gb|AEC07953.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1006

 Score =   192 bits (487),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  865   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  924

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN+ 
Sbjct  925   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVN  984

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  985   RPPTPTRGRPQNPNDRGSLAWI  1006



>ref|NP_001189614.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
 gb|AEC07954.1| serine/threonine-protein phosphatase BSL3 [Arabidopsis thaliana]
Length=1001

 Score =   191 bits (486),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN+ 
Sbjct  920   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNVN  979

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  980   RPPTPTRGRPQNPNDRGSLAWI  1001



>ref|XP_006591057.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Glycine max]
Length=1014

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  873   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  932

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPDTSPER  EDTWMQELN  
Sbjct  933   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDTSPERHIEDTWMQELNAN  992

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  993   RPPTPTRGRPQVTNDRGSLAWI  1014



>emb|CDY57791.1| BnaCnng32470D [Brassica napus]
Length=997

 Score =   191 bits (486),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  856  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLIT  915

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  
Sbjct  916  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHVDDTWMQELNAN  975

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  976  RPPTPTRGRPQTPDDRGSLAWI  997



>gb|KHN36505.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=861

 Score =   190 bits (483),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  720  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  779

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  780  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  839

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  840  RPPTPTRGRPPVTNDRGSLAWI  861



>gb|KEH38997.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=882

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  741  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  800

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  801  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  860

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  861  RPPTPTRGRPPVTNDRGSLAWI  882



>ref|XP_006408677.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
 gb|ESQ50130.1| hypothetical protein EUTSA_v10001894mg [Eutrema salsugineum]
Length=1005

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  864   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  923

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  924   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNAN  983

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  984   RPPTPTRGRPQTPNDRGSLAWI  1005



>ref|XP_004170230.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=654

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  513  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  572

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  573  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNAN  632

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  633  RPPTPTRGRPQVTNDRGSLAWI  654



>ref|XP_003543410.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Glycine max]
Length=988

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  847  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  906

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  907  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  966

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  967  RPPTPTRGRPPVTNDRGSLAWI  988



>ref|XP_007150014.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
 gb|ESW22008.1| hypothetical protein PHAVU_005G118700g [Phaseolus vulgaris]
Length=996

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  855  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  914

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  915  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  974

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  975  RPPTPTRGRPPVTNDRGSLAWI  996



>ref|XP_003596905.1| Serine/threonine protein phosphatase [Medicago truncatula]
 gb|AES67156.1| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=995

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  854  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  913

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  914  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  973

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  974  RPPTPTRGRPPVTNDRGSLAWI  995



>ref|XP_004291538.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Fragaria 
vesca subsp. vesca]
Length=998

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  857  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  916

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  917  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  976

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  977  RPPTPTRGRPQVANDRGSLAWI  998



>ref|XP_003540821.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1001

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  920   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  979

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  980   RPPTPTRGRPQVTNDRGSLAWI  1001



>ref|XP_010045170.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Eucalyptus 
grandis]
 gb|KCW87326.1| hypothetical protein EUGRSUZ_B03812 [Eucalyptus grandis]
Length=999

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  858  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNINDLQLIVRAHECVMDGFERFAQGHLIT  917

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  918  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  977

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  978  RPPTPTRGRPQVATDRGSLAWI  999



>ref|XP_011090288.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Sesamum indicum]
Length=1007

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  866   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  925

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  926   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  985

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  986   RPPTPTRGRPQVPNDRGSLAWI  1007



>ref|XP_007208428.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
 gb|EMJ09627.1| hypothetical protein PRUPE_ppa000783mg [Prunus persica]
Length=1005

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  864   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  923

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  924   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  983

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  984   RPPTPTRGRPQVANDRGSLAWI  1005



>ref|XP_002264614.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Vitis vinifera]
Length=1006

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  865   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  924

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  925   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNAN  984

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  985   RPPTPTRGRPQVTNDRGSLAWI  1006



>ref|XP_011090289.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Sesamum indicum]
Length=1006

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  865   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  924

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  925   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  984

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  985   RPPTPTRGRPQVPNDRGSLAWI  1006



>ref|XP_009336399.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009336400.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Pyrus x bretschneideri]
Length=1001

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  920   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  979

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  980   RPPTPTRGRPQGANDRGSLAWI  1001



>ref|XP_004487445.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cicer 
arietinum]
Length=1003

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  862   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  921

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  922   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  981

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  982   RPPTPTRGRPQVTNDRGSLAWI  1003



>ref|XP_008230036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Prunus mume]
Length=1005

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  864   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  923

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  924   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  983

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  984   RPPTPTRGRPQVANDRGSLAWI  1005



>ref|XP_008385576.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Malus domestica]
Length=1002

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  980

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  981   RPPTPTRGRPQVANDRGSLAWI  1002



>dbj|BAK06303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  255  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  314

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  315  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPTITSPETSPEHHIEDTWMQELN  372



>ref|XP_008230041.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Prunus mume]
Length=1004

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  863   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  922

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  923   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  982

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  983   RPPTPTRGRPQVANDRGSLAWI  1004



>ref|XP_004506226.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Cicer arietinum]
 ref|XP_004506227.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Cicer arietinum]
Length=1003

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  862   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  921

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN  
Sbjct  922   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELNAN  981

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRP    DR SLA+I
Sbjct  982   RPPTPTRGRPPVANDRGSLAWI  1003



>gb|KJB55561.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=700

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  559  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  618

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  619  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  678

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  679  RPPTPTRGRPQVANDRGSLAWI  700



>ref|XP_002879075.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55334.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein [Arabidopsis lyrata subsp. lyrata]
Length=1002

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNAN  980

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  981   RPPTPTRGRPQNPNDRGSLAWI  1002



>ref|XP_009368358.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Pyrus x 
bretschneideri]
Length=1004

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  863   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  922

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  923   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  982

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  983   RPPTPTRGRPQVANDRGSLAWI  1004



>ref|XP_010513312.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Camelina 
sativa]
Length=1045

 Score =   190 bits (483),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  904   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  963

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  964   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNAN  1023

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  1024  RPPTPTRGRPQNPNDRGSLAWI  1045



>ref|XP_009373887.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Pyrus 
x bretschneideri]
Length=1001

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  920   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  979

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  980   RPPTPTRGRPQGANDRGSLAWI  1001



>ref|XP_008361620.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Malus 
domestica]
Length=1001

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  920   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  979

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  980   RPPTPTRGRPQGANDRGSLAWI  1001



>ref|XP_009412503.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=981

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  840  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  899

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SPD SPE   EDTWMQELN  
Sbjct  900  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPDASPEHHTEDTWMQELNAN  959

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  960  RPPTPTRGRPQSSNDRGSLAWI  981



>gb|KDP42962.1| hypothetical protein JCGZ_23904 [Jatropha curcas]
Length=1008

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  867   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  926

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  927   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  986

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  987   RPPTPTRGRPQVANDRGSLAWI  1008



>ref|XP_004164757.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like, partial 
[Cucumis sativus]
Length=864

 Score =   189 bits (479),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  723  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  782

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  
Sbjct  783  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNAN  842

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA++
Sbjct  843  RPPTPTRGRPQVANDRGSLAWM  864



>ref|XP_006295510.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
 gb|EOA28408.1| hypothetical protein CARUB_v10024614mg [Capsella rubella]
Length=999

 Score =   189 bits (481),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  858  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  917

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  918  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNAN  977

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  978  RPPTPTRGRPQNPNDRGSLAWI  999



>ref|XP_007015660.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
 gb|EOY33279.1| BRI1 suppressor 1 (BSU1)-like 3 isoform 4 [Theobroma cacao]
Length=822

 Score =   188 bits (478),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  681  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  740

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  741  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  800

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  801  RPPTPTRGRPQVTNDRGSLAWI  822



>ref|XP_009418973.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=982

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  841  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  900

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  901  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAINSPEASPERHTEDTWMQELNAN  960

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  961  RPPTPTRGRPQTSNDRGSLAWI  982



>ref|XP_009398341.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=986

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG LIT
Sbjct  845  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHLIT  904

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  905  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNAN  964

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  965  RPPTPTRGRPQVANDRGSLAWI  986



>ref|XP_009398342.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=985

 Score =   189 bits (481),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLIIRAHECVMDGFERFAQG LIT
Sbjct  844  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIIRAHECVMDGFERFAQGHLIT  903

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  904  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPVINSPETSPERRIEDTWMQELNAN  963

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  964  RPPTPTRGRPQVANDRGSLAWI  985



>ref|XP_009775149.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nicotiana 
sylvestris]
Length=286

 Score =   179 bits (455),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  148  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  207

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR   +V       P P  SP+ SPER+ EDTWMQELN  
Sbjct  208  LFSATNYCGTANNAGAILVLGRD--LVVVPKLIHPLPPASPENSPERM-EDTWMQELNAN  264

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  265  RPPTPTRGRPQTANDRGSLAWI  286



>ref|XP_008450272.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450273.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
 ref|XP_008450274.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Cucumis 
melo]
Length=1008

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  867   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  926

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  
Sbjct  927   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNAN  986

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA++
Sbjct  987   RPPTPTRGRPQVANDRGSLAWM  1008



>ref|XP_010685448.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  878   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  937

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  938   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  997

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  998   RPPTPTRGRPQVANDRGSLAWI  1019



>emb|CBI24435.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   189 bits (481),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  908   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  967

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  968   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHLEDTWMQELNAN  1027

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  1028  RPPTPTRGRPQVTNDRGSLAWI  1049



>ref|XP_010904839.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL1 homolog [Elaeis guineensis]
Length=888

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDS+EGLRPNARGPGLV FGPDRV DFC +N+LQLIIRAHECVMDGFERFAQGQLIT
Sbjct  747  PTENDSIEGLRPNARGPGLVAFGPDRVADFCTKNQLQLIIRAHECVMDGFERFAQGQLIT  806

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            +FSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP  SP++SPE V EDTWMQELNIQ
Sbjct  807  VFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPQQSPESSPEHVLEDTWMQELNIQ  866

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  867  RPPTPTRGRPQSANDRNSLAYI  888



>ref|XP_010544322.1| PREDICTED: serine/threonine-protein phosphatase BSL2 isoform 
X2 [Tarenaya hassleriana]
Length=991

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  850  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  909

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  910  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  969

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  970  RPPTPTRGRPQSPNDRGSLAWI  991



>ref|XP_004139147.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
Length=981

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  840  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  899

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPER  EDTWMQELN  
Sbjct  900  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPERHMEDTWMQELNAN  959

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA++
Sbjct  960  RPPTPTRGRPQVANDRGSLAWM  981



>ref|XP_009140775.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Brassica 
rapa]
Length=998

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  857  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  916

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  
Sbjct  917  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNAN  976

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  977  RPPTPTRGRPQTPDDRGSLAWI  998



>gb|KHN03759.1| Serine/threonine-protein phosphatase BSL1 [Glycine soja]
Length=820

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 131/153 (86%), Positives = 138/153 (90%), Gaps = 11/153 (7%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCK+NKLQLIIRAHECVMDGFERFAQGQLIT
Sbjct  668  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKKNKLQLIIRAHECVMDGFERFAQGQLIT  727

Query  568  LFSATNYC-----------GTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVN  422
            LFSATNYC           GTANNAGAILVVGRGLV+VPKLIHP+PPPL SP+TSPER  
Sbjct  728  LFSATNYCAFQSHAGCVILGTANNAGAILVVGRGLVVVPKLIHPIPPPLQSPETSPERGM  787

Query  421  EDTWMQELNIqrpptptrgrpqPDLDRNSLAYI  323
            ++TWMQELNIQRPPTPTRGRPQPDLDR SLAYI
Sbjct  788  DETWMQELNIQRPPTPTRGRPQPDLDRGSLAYI  820



>emb|CDY57485.1| BnaAnng14650D [Brassica napus]
Length=998

 Score =   189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  857  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  916

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  
Sbjct  917  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIDDTWMQELNAN  976

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  977  RPPTPTRGRPQTPDDRGSLAWI  998



>ref|XP_010557449.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Tarenaya 
hassleriana]
Length=1008

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  867   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCSNNDLQLIVRAHECVMDGFERFAQGHLIT  926

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  927   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  986

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  987   RPPTPTRGRPQAPNDRGSLAWI  1008



>gb|KHG22818.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1015

 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  934   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  993

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  994   RPPTPTRGRPQVANDRGSLAWI  1015



>ref|XP_010544321.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Tarenaya hassleriana]
Length=1015

 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  934   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  993

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  994   RPPTPTRGRPQSPNDRGSLAWI  1015



>ref|XP_011044597.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   189 bits (479),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  870   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  929

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+ P+ IHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  930   LFSATNYCGTANNAGAILVLGRDLVVGPQHIHPLPPAISSPEASPERHIEDTWMQELNAN  989

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  990   RPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_007015657.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015658.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 ref|XP_007015659.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33276.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33277.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
 gb|EOY33278.1| BRI1 suppressor 1 (BSU1)-like 2 isoform 1 [Theobroma cacao]
Length=1019

 Score =   189 bits (479),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  878   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  937

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  938   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  997

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  998   RPPTPTRGRPQVTNDRGSLAWI  1019



>ref|XP_008449600.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Cucumis 
melo]
Length=1002

 Score =   189 bits (479),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNAN  980

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  981   RPPTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_006369377.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
 gb|ERP65946.1| hypothetical protein POPTR_0001s22320g [Populus trichocarpa]
Length=1000

 Score =   189 bits (479),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  859  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  918

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  919  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNAN  978

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  979  RPPTPTRGRPQVTNDRGSLAWI  1000



>ref|XP_011008648.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Populus 
euphratica]
Length=1011

 Score =   189 bits (479),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  870   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  929

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  930   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNAN  989

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  990   RPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_011008746.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Populus 
euphratica]
Length=1011

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  870   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  929

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  930   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELNAN  989

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  990   RPPTPTRGRPQVTNDRGSLAWI  1011



>ref|XP_004140171.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Cucumis 
sativus]
 gb|KGN48053.1| hypothetical protein Csa_6G426880 [Cucumis sativus]
Length=1002

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMTSPEASPERHLEDTWMQELNAN  980

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  981   RPPTPTRGRPQVTNDRGSLAWI  1002



>ref|XP_007132502.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
 gb|ESW04496.1| hypothetical protein PHAVU_011G099600g [Phaseolus vulgaris]
Length=1007

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  866   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  925

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  926   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  985

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   +R SLA+I
Sbjct  986   RPPTPTRGRPQVTNERGSLAWI  1007



>gb|EYU36016.1| hypothetical protein MIMGU_mgv1a000720mg [Erythranthe guttata]
Length=1005

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  864   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  923

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  +DTWMQELN  
Sbjct  924   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIDDTWMQELNAN  983

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  984   RPPTPTRGRPQVANDRGSLAWI  1005



>gb|KHG29076.1| Serine/threonine-protein phosphatase BSL3 -like protein [Gossypium 
arboreum]
Length=1016

 Score =   188 bits (478),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  875   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  934

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  935   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  994

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  995   RPPTPTRGRPQVANDRGSLAWI  1016



>gb|KJB35468.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35469.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=682

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  541  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  600

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  601  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  660

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA I
Sbjct  661  RPPTPTRGRPQVANDRGSLACI  682



>gb|KJB55556.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55557.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55558.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55559.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
 gb|KJB55560.1| hypothetical protein B456_009G082300 [Gossypium raimondii]
Length=1016

 Score =   188 bits (477),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  875   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  934

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  935   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  994

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  995   RPPTPTRGRPQVANDRGSLAWI  1016



>ref|XP_004960470.1| PREDICTED: serine/threonine-protein phosphatase BSL1 homolog 
[Setaria italica]
Length=887

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQLIT
Sbjct  747  PTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAHGQLIT  806

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILVVGRGLV+VPKLIHPLPPP+ SP++SPER  + TWMQELNIQ
Sbjct  807  LFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPVNSPESSPER-GDATWMQELNIQ  865

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DRNSLAYI
Sbjct  866  RPPTPTRGRPQAAGDRNSLAYI  887



>ref|XP_011088983.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Sesamum indicum]
Length=1015

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  934   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELNAN  993

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  994   RPPTPTRGRPQVANDRGSLAWI  1015



>ref|XP_009606099.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana tomentosiformis]
Length=643

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  503  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  562

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  563  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  621

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  622  RPPTPTRGRPQVANDRGSLAWI  643



>gb|KHN17986.1| Serine/threonine-protein phosphatase BSL2 [Glycine soja]
Length=929

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  788  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  847

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  848  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNAN  907

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  908  RPPTPTRGRPPVTNDRGSLAWI  929



>ref|XP_010263036.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Nelumbo 
nucifera]
Length=1015

 Score =   187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP TSPE   EDTWMQELN  
Sbjct  934   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVASPQTSPEHHIEDTWMQELNAN  993

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  994   RPPTPTRGRPQVANDRGSLAWI  1015



>dbj|BAF02235.1| putative protein serine/threonine phosphatase alpha [Arabidopsis 
thaliana]
Length=737

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  595  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  654

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  655  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  712



>ref|XP_008787777.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Phoenix dactylifera]
Length=825

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  684  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  743

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  
Sbjct  744  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNAN  803

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  804  RPPTPTRGRPQVANDRGSLAWI  825



>ref|XP_009606096.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana tomentosiformis]
Length=678

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  538  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  597

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  598  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  656

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  657  RPPTPTRGRPQVANDRGSLAWI  678



>ref|XP_009388972.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Musa acuminata subsp. malaccensis]
Length=986

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  845  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  904

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+ SPE   EDTWMQELN  
Sbjct  905  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAVSSPEASPEHHIEDTWMQELNAN  964

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  965  RPPTPTRGRPQVASDRGSLAWI  986



>gb|KDO46579.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=744

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  607  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  666

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  667  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  724



>ref|XP_008787776.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Phoenix dactylifera]
Length=826

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  685  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  744

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  
Sbjct  745  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNAN  804

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  805  RPPTPTRGRPQVANDRGSLAWI  826



>ref|XP_003539489.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Glycine max]
Length=1003

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  862   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  921

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  922   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEPHIEDTWMQELNAN  981

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRP    DR SLA+I
Sbjct  982   RPPTPTRGRPPVTNDRGSLAWI  1003



>ref|XP_001765008.1| predicted protein [Physcomitrella patens]
 gb|EDQ70224.1| predicted protein [Physcomitrella patens]
Length=986

 Score =   187 bits (474),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 130/147 (88%), Gaps = 5/147 (3%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVT+GPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  840  PTENDSVEGLRPNARGPGLVTYGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLIT  899

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQ-----  404
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPER  EDTWMQ     
Sbjct  900  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPESSPERHLEDTWMQARNSK  959

Query  403  ELNIqrpptptrgrpqPDLDRNSLAYI  323
            +LN+ RPPTPTRGRPQP  DRNSLA+I
Sbjct  960  DLNVARPPTPTRGRPQPTSDRNSLAWI  986



>ref|NP_001275238.1| serine/threonine-protein phosphatase BSL3-like [Solanum tuberosum]
 gb|AFN44701.1| Ser/Thr phosphatase-containing Kelch repeat domain protein [Solanum 
tuberosum]
Length=999

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  858  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  917

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  918  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  977

Query  388  rpptptrgrpqPDLDRNSLAY  326
            RPPTPTRGRPQ   DR S+A+
Sbjct  978  RPPTPTRGRPQVANDRGSVAW  998



>gb|KJB35474.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=982

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  841  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  900

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  901  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  960

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA I
Sbjct  961  RPPTPTRGRPQVANDRGSLACI  982



>ref|XP_003605992.1| Serine/threonine protein phosphatase [Medicago truncatula]
Length=875

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  735  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  794

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN  
Sbjct  795  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNAN  853

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  854  RPPTPTRGRPPVANDRGSLAWI  875



>ref|XP_010473113.1| PREDICTED: serine/threonine-protein phosphatase BSL3 [Camelina 
sativa]
Length=1011

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  872   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  931

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  932   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELNAN  991

Query  388   rpptptrgrpqPDLDRNSLA  329
             RPPTPTRGRPQ   DR SLA
Sbjct  992   RPPTPTRGRPQNPNDRGSLA  1011



>ref|XP_010247574.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Nelumbo 
nucifera]
Length=1021

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  880   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  939

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + +P TSPE   EDTWMQELN  
Sbjct  940   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAIATPQTSPEHHIEDTWMQELNAN  999

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA+I
Sbjct  1000  RPPTPTRGRPQVASDRGSLAWI  1021



>ref|XP_006367582.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Solanum 
tuberosum]
Length=744

 Score =   185 bits (469),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  604  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  663

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN  
Sbjct  664  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNAN  722

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  723  RPPTPTRGRPQTANDRGSLAWI  744



>ref|XP_004241349.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Solanum lycopersicum]
Length=996

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/141 (83%), Positives = 125/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  855  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  914

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN  
Sbjct  915  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELNAN  974

Query  388  rpptptrgrpqPDLDRNSLAY  326
            RPPTPTRGRPQ   DR S+A+
Sbjct  975  RPPTPTRGRPQVANDRGSVAW  995



>gb|KJB35470.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35471.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
 gb|KJB35472.1| hypothetical protein B456_006G116600 [Gossypium raimondii]
Length=1015

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN  
Sbjct  934   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASPERHIEDTWMQELNAN  993

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA I
Sbjct  994   RPPTPTRGRPQVANDRGSLACI  1015



>ref|XP_010907354.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Elaeis guineensis]
Length=1028

 Score =   186 bits (473),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  888   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  947

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN  
Sbjct  948   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNAN  1006

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGR Q   DR+SLA+I
Sbjct  1007  RPPTPTRGRSQAANDRSSLAWI  1028



>ref|XP_009770255.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Nicotiana sylvestris]
Length=949

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  809  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  868

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  869  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  927

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  928  RPPTPTRGRPQVANDRGSLAWI  949



>ref|XP_009770253.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X1 [Nicotiana sylvestris]
Length=984

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  844  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  903

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  904  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  962

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  963  RPPTPTRGRPQVANDRGSLAWI  984



>ref|XP_010941606.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Elaeis guineensis]
Length=978

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  837  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  896

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   EDTWMQELN  
Sbjct  897  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHHIEDTWMQELNAN  956

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  957  RPPTPTRGRPQVANDRGSLAWI  978



>ref|XP_010907353.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Elaeis guineensis]
Length=1029

 Score =   186 bits (473),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  889   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  948

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE + EDTWMQELN  
Sbjct  949   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPEHI-EDTWMQELNAN  1007

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGR Q   DR+SLA+I
Sbjct  1008  RPPTPTRGRSQAANDRSSLAWI  1029



>ref|XP_008811285.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Phoenix dactylifera]
Length=995

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  854  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  913

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  
Sbjct  914  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNAN  973

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGR Q   DR+SLA+I
Sbjct  974  RPPTPTRGRSQAANDRSSLAWI  995



>gb|AES88189.2| serine/threonine-protein phosphatase BSL2-like protein [Medicago 
truncatula]
Length=999

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  859  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  918

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP LSP+TSPER  EDTWMQELN  
Sbjct  919  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPALSPETSPERHIEDTWMQELNAN  977

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRP    DR SLA+I
Sbjct  978  RPPTPTRGRPPVANDRGSLAWI  999



>ref|XP_009795596.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 
BSL3-like [Nicotiana sylvestris]
Length=989

 Score =   186 bits (472),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  849  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  908

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  909  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  967

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  968  RPPTPTRGRPQVANDRGSLAWI  989



>ref|XP_008811284.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Phoenix dactylifera]
Length=995

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  854  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  913

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  
Sbjct  914  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNAN  973

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGR Q   DR+SLA+I
Sbjct  974  RPPTPTRGRSQAANDRSSLAWI  995



>ref|XP_008811286.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Phoenix dactylifera]
Length=994

 Score =   186 bits (472),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  853  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  912

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+   EDTWMQELN  
Sbjct  913  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPDHHIEDTWMQELNAN  972

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGR Q   DR+SLA+I
Sbjct  973  RPPTPTRGRSQAANDRSSLAWI  994



>ref|XP_006424083.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 ref|XP_006487860.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like [Citrus 
sinensis]
 gb|ESR37323.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46577.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=998

 Score =   186 bits (471),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  921  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_006424082.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|ESR37322.1| hypothetical protein CICLE_v10027742mg [Citrus clementina]
 gb|KDO46576.1| hypothetical protein CISIN_1g001895mg [Citrus sinensis]
Length=999

 Score =   186 bits (471),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  921  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  978



>ref|XP_010488844.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like [Camelina 
sativa]
Length=1022

 Score =   186 bits (472),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  880  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  939

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  940  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  997



>ref|XP_010458078.1| PREDICTED: serine/threonine-protein phosphatase BSL2 [Camelina 
sativa]
Length=1017

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  875  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  934

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  935  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>ref|XP_006592359.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Glycine max]
Length=996

 Score =   186 bits (471),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  860  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  919

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  920  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  977



>ref|XP_010475640.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X1 [Camelina sativa]
 ref|XP_010475641.1| PREDICTED: serine/threonine-protein phosphatase BSL2-like isoform 
X2 [Camelina sativa]
Length=1023

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  881  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  940

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  941  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  998



>ref|XP_002513730.1| bsu-protein phosphatase, putative [Ricinus communis]
 gb|EEF48677.1| bsu-protein phosphatase, putative [Ricinus communis]
Length=874

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  733  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  792

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + S + SPER  EDTWMQELN  
Sbjct  793  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSAEASPERHIEDTWMQELNAN  852

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  853  RPPTPTRGRPQVTNDRGSLAWI  874



>ref|XP_006303893.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
 gb|EOA36791.1| hypothetical protein CARUB_v10008182mg [Capsella rubella]
Length=1018

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  876  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  935

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  936  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|NP_001266022.1| Hop-interacting protein THI140 [Solanum lycopersicum]
 gb|AEW69826.1| Hop-interacting protein THI140 [Solanum lycopersicum]
Length=982

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  842  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  901

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+ SPER+ EDTWMQELN  
Sbjct  902  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPENSPERM-EDTWMQELNAN  960

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SLA+I
Sbjct  961  RPPTPTRGRPQTANDRGSLAWI  982



>ref|NP_172318.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 sp|Q9SJF0.2|BSL2_ARATH RecName: Full=Serine/threonine-protein phosphatase BSL2; AltName: 
Full=BSU1-like protein 2 [Arabidopsis thaliana]
 gb|AEE28287.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1018

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  876  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  935

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  936  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|XP_010322449.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Solanum lycopersicum]
Length=994

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  855  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  914

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  915  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  972



>dbj|BAH19666.1| AT1G08420 [Arabidopsis thaliana]
Length=1018

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  876  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  935

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  936  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  993



>ref|NP_001184935.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
 gb|AEE28288.1| serine/threonine-protein phosphatase BSL2 [Arabidopsis thaliana]
Length=1013

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  871  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  930

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  931  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  988



>ref|XP_011090290.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X3 [Sesamum indicum]
Length=1005

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  866  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  925

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  926  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHIEDTWMQELN  983



>gb|AFW68155.1| putative kelch repeat-containing protein containing ser/thr protein 
kinase family protein [Zea mays]
Length=396

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 107/118 (91%), Gaps = 1/118 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  255  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  314

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SP+ + EDTWMQELN
Sbjct  315  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEASPDHI-EDTWMQELN  371



>ref|XP_002889692.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65951.1| kelch repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=1017

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  875  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  934

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP L SP+TSPER  EDTWMQELN
Sbjct  935  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTWMQELN  992



>gb|EEE65895.1| hypothetical protein OsJ_21718 [Oryza sativa Japonica Group]
Length=944

 Score =   185 bits (469),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  802  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  861

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  862  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNAN  921

Query  388  rpptptr-grpqPDLDRNSLAYI  323
            RPPTPTR      + DR SLA+I
Sbjct  922  RPPTPTRGRPQAANNDRGSLAWI  944



>emb|CDP15567.1| unnamed protein product [Coffea canephora]
Length=1012

 Score =   185 bits (470),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  873  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  932

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQELN
Sbjct  933  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQELN  990



>ref|NP_001067290.1| Os12g0617900 [Oryza sativa Japonica Group]
 sp|Q2QM47.2|BSL2_ORYSJ RecName: Full=Serine/threonine-protein phosphatase BSL2 homolog; 
AltName: Full=BSU1-like protein 2 homolog [Oryza sativa 
Japonica Group]
 gb|ABA99873.2| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF30309.1| Os12g0617900 [Oryza sativa Japonica Group]
 dbj|BAG89347.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69687.1| hypothetical protein OsI_39138 [Oryza sativa Indica Group]
Length=1009

 Score =   185 bits (469),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  867   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  926

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-  392
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  927   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNAN  986

Query  391   qrpptptrgrpqPDLDRNSLAYI  323
             + P          + DR SLA+I
Sbjct  987   RPPTPTRGRPQAANNDRGSLAWI  1009



>ref|XP_004963199.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Setaria italica]
Length=997

 Score =   184 bits (468),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  855  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  914

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-  392
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  915  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNAN  974

Query  391  qrpptptrgrpqPDLDRNSLAYI  323
            + P         P+ DR SLA+I
Sbjct  975  RPPTPTRGRPQAPNNDRGSLAWI  997



>gb|EMS59471.1| Serine/threonine-protein phosphatase BSL2-like protein [Triticum 
urartu]
Length=864

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  721  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  780

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  781  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  838



>ref|XP_008674098.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Zea mays]
 tpg|DAA54714.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=998

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  856  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  915

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-  392
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  916  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNAN  975

Query  391  qrpptptrgrpqPDLDRNSLAYI  323
            + P         P+ DR SLA+I
Sbjct  976  RPPTPTRGRPQAPNNDRGSLAWI  998



>ref|XP_002976889.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
 gb|EFJ21999.1| hypothetical protein SELMODRAFT_175932 [Selaginella moellendorffii]
Length=994

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  852  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHLIT  911

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  392
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN+
Sbjct  912  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELNV  970



>ref|XP_009587053.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X3 [Nicotiana tomentosiformis]
Length=956

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  816  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  875

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  876  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  934

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SL +I
Sbjct  935  RPPTPTRGRPQVANDRGSLTWI  956



>ref|XP_002980607.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
 gb|EFJ18258.1| hypothetical protein SELMODRAFT_268371 [Selaginella moellendorffii]
Length=995

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  853  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNNLQLIVRAHECVMDGFERFAQGHLIT  912

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI  392
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP++SPE   EDTWM ELN+
Sbjct  913  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAVTSPESSPEHQLEDTWMHELNV  971



>ref|XP_001781021.1| predicted protein [Physcomitrella patens]
 gb|EDQ54130.1| predicted protein [Physcomitrella patens]
Length=1047

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FCK N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  906   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCKNNDLQLIVRAHECVMDGFERFAQGHLIT  965

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPE   +D WMQELN  
Sbjct  966   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPEHSPEHHLDDIWMQELNEH  1025

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQP  DR SLA+I
Sbjct  1026  RPPTPTRGRPQPAHDRGSLAWI  1047



>gb|KJB21740.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
 gb|KJB21741.1| hypothetical protein B456_004G011600 [Gossypium raimondii]
Length=1013

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  872   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  931

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ S ER  EDTWMQELN  
Sbjct  932   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAMSSPEASSERHIEDTWMQELNAN  991

Query  388   rpptptrgrpqPDLDRNSLAYI  323
             RPPTPTRGRPQ   DR SLA++
Sbjct  992   RPPTPTRGRPQVTNDRGSLAWV  1013



>ref|XP_009587040.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=991

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  851  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  910

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN  
Sbjct  911  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELNAN  969

Query  388  rpptptrgrpqPDLDRNSLAYI  323
            RPPTPTRGRPQ   DR SL +I
Sbjct  970  RPPTPTRGRPQVANDRGSLTWI  991



>ref|XP_002443577.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
 gb|EES17415.1| hypothetical protein SORBIDRAFT_08g021850 [Sorghum bicolor]
Length=1008

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 118/143 (83%), Gaps = 1/143 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  866   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  925

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-  392
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  926   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNAN  985

Query  391   qrpptptrgrpqPDLDRNSLAYI  323
             + P         P+ DR SLA+I
Sbjct  986   RPPTPTRGRPQAPNNDRGSLAWI  1008



>ref|XP_002313501.2| kelch repeat-containing family protein [Populus trichocarpa]
 gb|EEE87456.2| kelch repeat-containing family protein [Populus trichocarpa]
Length=993

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  851  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  910

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+ SPER  EDTWMQELN
Sbjct  911  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPEASPERHIEDTWMQELN  968



>gb|EEE59591.1| hypothetical protein OsJ_11899 [Oryza sativa Japonica Group]
Length=936

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  794  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  853

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  854  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  911



>ref|XP_006651637.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=940

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  798  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  857

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  858  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  915



>ref|XP_006361106.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Solanum tuberosum]
Length=997

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  858  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  917

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  ED WMQELN
Sbjct  918  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPERHMEDIWMQELN  975



>gb|EPS70499.1| hypothetical protein M569_04238, partial [Genlisea aurea]
Length=1011

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  869   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  928

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVN-EDTWMQELNI  392
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHP+PP + SP+TSPE  + EDTWMQELN 
Sbjct  929   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPIPPAISSPETSPEHHHIEDTWMQELNA  988

Query  391   qrpptptrgrpqPDLDRNSLAYI  323
              RPPTPTRGRPQ   DR SLA++
Sbjct  989   NRPPTPTRGRPQVTNDRGSLAWM  1011



>ref|XP_008681503.1| PREDICTED: uncharacterized protein LOC100192777 isoform X2 [Zea 
mays]
Length=995

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  853  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  912

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  913  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  970



>gb|ABF97885.1| kelch repeat-containing serine/threonine phosphoesterase family 
protein, putative, expressed [Oryza sativa Japonica Group]
Length=1003

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNAN  980

Query  388   rpptptrgrpqPDL-DRNSLAYI  323
             RPPTPTRGRPQ    DR SLA+I
Sbjct  981   RPPTPTRGRPQVAANDRGSLAWI  1003



>ref|XP_006664752.1| PREDICTED: serine/threonine-protein phosphatase BSL2 homolog 
[Oryza brachyantha]
Length=941

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 117/143 (82%), Gaps = 1/143 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQL++RAHECVMDGFERFAQG LIT
Sbjct  799  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLMVRAHECVMDGFERFAQGHLIT  858

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNI-  392
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  859  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHLEDTWMQELNAN  918

Query  391  qrpptptrgrpqPDLDRNSLAYI  323
            + P          + DR SLA+I
Sbjct  919  RPPTPTRGRPQVANNDRGSLAWI  941



>gb|EEC75832.1| hypothetical protein OsI_12812 [Oryza sativa Indica Group]
Length=1003

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  748   PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
             PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  861   PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  920

Query  568   LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELNIq  389
             LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN  
Sbjct  921   LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELNAN  980

Query  388   rpptptrgrpqPDL-DRNSLAYI  323
             RPPTPTRGRPQ    DR SLA+I
Sbjct  981   RPPTPTRGRPQVAANDRGSLAWI  1003



>ref|XP_008681453.1| PREDICTED: uncharacterized protein LOC100192777 isoform X1 [Zea 
mays]
 tpg|DAA47544.1| TPA: putative kelch repeat-containing protein containing ser/thr 
protein kinase family protein [Zea mays]
Length=996

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  854  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  913

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  914  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQELN  971



>ref|XP_011088984.1| PREDICTED: serine/threonine-protein phosphatase BSL3-like isoform 
X2 [Sesamum indicum]
Length=1013

 Score =   183 bits (465),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  874  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  933

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPE   EDTWMQELN
Sbjct  934  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAISSPETSPEHHIEDTWMQELN  991



>ref|XP_009606098.1| PREDICTED: serine/threonine-protein phosphatase BSL3 isoform 
X2 [Nicotiana tomentosiformis]
Length=676

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  538  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  597

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQELN  395
            LFSATNYCGTANNAGAILV+GR  ++V   +    PP  SP+TSPER  EDTWMQELN
Sbjct  598  LFSATNYCGTANNAGAILVLGR-DLVVVPKLIHPLPPATSPETSPERHIEDTWMQELN  654



>gb|AAD26883.1| putative phosphoprotein phosphatase [Arabidopsis thaliana]
Length=715

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -1

Query  748  PTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLIT  569
            PTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG LIT
Sbjct  594  PTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLIT  653

Query  568  LFSATNYCGTANNAGAILVVGRGlvivpklihplppplLSPDTSPERVNEDTWMQ  404
            LFSATNYCGTANNAGAILV+GR LV+VPKLIHPLPP + SP+TSPER  EDTWMQ
Sbjct  654  LFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQ  708



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630