BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012M12

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623844.1|  PREDICTED: glutamate--glyoxylate aminotransf...    472   1e-162   Nicotiana tomentosiformis
ref|XP_009765091.1|  PREDICTED: glutamate--glyoxylate aminotransf...    471   4e-162   Nicotiana sylvestris
ref|XP_004239121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    467   1e-160   Solanum lycopersicum
gb|KGN51765.1|  hypothetical protein Csa_5G598730                       466   2e-160   Cucumis sativus [cucumbers]
ref|XP_006357614.1|  PREDICTED: glutamate--glyoxylate aminotransf...    466   2e-160   Solanum tuberosum [potatoes]
gb|KDP26646.1|  hypothetical protein JCGZ_17804                         466   3e-160   Jatropha curcas
emb|CDP13207.1|  unnamed protein product                                463   4e-159   Coffea canephora [robusta coffee]
ref|XP_010100388.1|  Glutamate--glyoxylate aminotransferase 2           462   5e-159   Morus notabilis
emb|CBI23368.3|  unnamed protein product                                461   2e-158   Vitis vinifera
ref|NP_001268094.1|  uncharacterized protein LOC100261274               461   3e-158   Vitis vinifera
ref|XP_004155366.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    460   6e-158   
emb|CAN62302.1|  hypothetical protein VITISV_023686                     458   2e-157   Vitis vinifera
gb|EYU28421.1|  hypothetical protein MIMGU_mgv1a005535mg                457   6e-157   Erythranthe guttata [common monkey flower]
ref|XP_008340115.1|  PREDICTED: glutamate--glyoxylate aminotransf...    457   9e-157   Malus domestica [apple tree]
ref|XP_006438274.1|  hypothetical protein CICLE_v10031381mg             456   1e-156   Citrus clementina [clementine]
ref|XP_009359228.1|  PREDICTED: glutamate--glyoxylate aminotransf...    455   3e-156   Pyrus x bretschneideri [bai li]
ref|XP_008221924.1|  PREDICTED: glutamate--glyoxylate aminotransf...    455   5e-156   Prunus mume [ume]
ref|XP_008389735.1|  PREDICTED: glutamate--glyoxylate aminotransf...    455   6e-156   
ref|XP_004135487.1|  PREDICTED: glutamate--glyoxylate aminotransf...    454   7e-156   
gb|KDO82251.1|  hypothetical protein CISIN_1g041151mg                   453   2e-155   Citrus sinensis [apfelsine]
ref|XP_007222799.1|  hypothetical protein PRUPE_ppa005017mg             453   3e-155   Prunus persica
ref|XP_011086618.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    453   3e-155   
gb|AAZ43368.1|  AlaT1                                                   452   6e-155   Vitis labrusca [Concord grape]
ref|XP_010023477.1|  PREDICTED: glutamate--glyoxylate aminotransf...    451   2e-154   Eucalyptus grandis [rose gum]
ref|XP_002312679.2|  alanine-2-oxoglutarate aminotransferase 1 fa...    450   5e-154   Populus trichocarpa [western balsam poplar]
ref|XP_010251104.1|  PREDICTED: glutamate--glyoxylate aminotransf...    449   6e-154   Nelumbo nucifera [Indian lotus]
gb|AET06145.1|  PLP-dependent aminotransferase                          449   7e-154   Papaver somniferum
ref|XP_004309987.1|  PREDICTED: glutamate--glyoxylate aminotransf...    449   1e-153   Fragaria vesca subsp. vesca
ref|XP_003613139.1|  Alanine aminotransferase                           449   2e-153   Medicago truncatula
ref|XP_009406515.1|  PREDICTED: glutamate--glyoxylate aminotransf...    448   3e-153   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG15331.1|  Glutamate--glyoxylate aminotransferase 2 -like pr...    447   4e-153   Gossypium arboreum [tree cotton]
gb|KJB31170.1|  hypothetical protein B456_005G179600                    447   7e-153   Gossypium raimondii
gb|KJB31175.1|  hypothetical protein B456_005G179600                    447   8e-153   Gossypium raimondii
ref|XP_010927963.1|  PREDICTED: glutamate--glyoxylate aminotransf...    446   2e-152   Elaeis guineensis
ref|XP_009413361.1|  PREDICTED: glutamate--glyoxylate aminotransf...    446   2e-152   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003519649.1|  PREDICTED: glutamate--glyoxylate aminotransf...    444   8e-152   Glycine max [soybeans]
ref|XP_010552672.1|  PREDICTED: glutamate--glyoxylate aminotransf...    444   1e-151   Tarenaya hassleriana [spider flower]
emb|CDY61225.1|  BnaC06g43710D                                          443   2e-151   Brassica napus [oilseed rape]
ref|XP_009105727.1|  PREDICTED: glutamate--glyoxylate aminotransf...    443   2e-151   Brassica rapa
ref|NP_001237567.1|  alanine aminotransferase 2                         443   2e-151   
ref|XP_009105726.1|  PREDICTED: glutamate--glyoxylate aminotransf...    444   2e-151   Brassica rapa
ref|XP_007158412.1|  hypothetical protein PHAVU_002G150800g             443   2e-151   Phaseolus vulgaris [French bean]
ref|XP_008789746.1|  PREDICTED: glutamate--glyoxylate aminotransf...    443   2e-151   
ref|XP_011071137.1|  PREDICTED: glutamate--glyoxylate aminotransf...    443   3e-151   
ref|XP_004489787.1|  PREDICTED: glutamate--glyoxylate aminotransf...    442   7e-151   Cicer arietinum [garbanzo]
gb|KHN14541.1|  Glutamate--glyoxylate aminotransferase 2                441   1e-150   Glycine soja [wild soybean]
ref|XP_006300456.1|  hypothetical protein CARUB_v10020212mg             441   2e-150   
ref|XP_010682426.1|  PREDICTED: glutamate--glyoxylate aminotransf...    441   2e-150   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010928898.1|  PREDICTED: glutamate--glyoxylate aminotransf...    441   2e-150   Elaeis guineensis
ref|XP_007044762.1|  Alanine-2-oxoglutarate aminotransferase 2 is...    440   4e-150   
ref|XP_002315675.1|  hypothetical protein POPTR_0010s05530g             440   4e-150   Populus trichocarpa [western balsam poplar]
gb|AAM61453.1|  putative alanine aminotransferase                       440   5e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177215.1|  glutamate--glyoxylate aminotransferase 2              439   6e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237581.1|  alanine aminotransferase 3                         439   7e-150   Glycine max [soybeans]
gb|KGN51767.1|  hypothetical protein Csa_5G598750                       439   8e-150   Cucumis sativus [cucumbers]
ref|XP_011014669.1|  PREDICTED: glutamate--glyoxylate aminotransf...    439   8e-150   Populus euphratica
dbj|BAJ90574.1|  predicted protein                                      431   2e-149   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAH20108.1|  AT1G70580                                              438   3e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66294.1|  BnaAnng22050D                                          436   1e-148   Brassica napus [oilseed rape]
emb|CDY25780.1|  BnaA07g10020D                                          433   2e-148   Brassica napus [oilseed rape]
ref|XP_006390865.1|  hypothetical protein EUTSA_v10018474mg             436   2e-148   
ref|XP_009624740.1|  PREDICTED: glutamate--glyoxylate aminotransf...    435   3e-148   Nicotiana tomentosiformis
ref|XP_009759837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    434   5e-148   Nicotiana sylvestris
ref|XP_004228555.1|  PREDICTED: glutamate--glyoxylate aminotransf...    434   5e-148   Solanum lycopersicum
ref|XP_010427837.1|  PREDICTED: glutamate--glyoxylate aminotransf...    434   5e-148   Camelina sativa [gold-of-pleasure]
ref|XP_009110107.1|  PREDICTED: glutamate--glyoxylate aminotransf...    434   5e-148   Brassica rapa
gb|EMS58349.1|  Alanine aminotransferase 2                              434   9e-148   Triticum urartu
ref|XP_006416099.1|  hypothetical protein EUTSA_v10007514mg             434   9e-148   
ref|XP_009115544.1|  PREDICTED: glutamate--glyoxylate aminotransf...    433   1e-147   Brassica rapa
ref|XP_010415743.1|  PREDICTED: glutamate--glyoxylate aminotransf...    433   1e-147   Camelina sativa [gold-of-pleasure]
emb|CDX91708.1|  BnaC08g06270D                                          431   2e-147   
ref|XP_006307377.1|  hypothetical protein CARUB_v10009003mg             433   2e-147   Capsella rubella
gb|AAK68842.1|  alanine aminotransferase-like protein                   429   3e-147   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001058716.1|  Os07g0108300                                       433   3e-147   
gb|AAO84040.1|  alanine aminotransferase                                432   4e-147   Oryza sativa Indica Group [Indian rice]
ref|XP_010498838.1|  PREDICTED: glutamate--glyoxylate aminotransf...    432   4e-147   Camelina sativa [gold-of-pleasure]
ref|XP_010477627.1|  PREDICTED: glutamate--glyoxylate aminotransf...    432   5e-147   Camelina sativa [gold-of-pleasure]
ref|XP_010460118.1|  PREDICTED: glutamate--glyoxylate aminotransf...    432   7e-147   Camelina sativa [gold-of-pleasure]
emb|CDY41452.1|  BnaA08g20540D                                          431   9e-147   Brassica napus [oilseed rape]
tpg|DAA59363.1|  TPA: putative MATE efflux family protein isoform 1     427   2e-146   
ref|XP_010471056.1|  PREDICTED: glutamate--glyoxylate aminotransf...    431   2e-146   Camelina sativa [gold-of-pleasure]
ref|XP_003557680.1|  PREDICTED: glutamate--glyoxylate aminotransf...    430   2e-146   Brachypodium distachyon [annual false brome]
ref|XP_002893277.1|  alanine-2-oxoglutarate aminotransferase 1          430   3e-146   
gb|EPS68501.1|  hypothetical protein M569_06265                         430   3e-146   Genlisea aurea
gb|AAL24255.1|  At1g23310/F26F24_4                                      430   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564192.2|  glutamate:glyoxylate aminotransferase                 430   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955317.1|  PREDICTED: glutamate--glyoxylate aminotransf...    430   4e-146   Setaria italica
ref|XP_006658210.1|  PREDICTED: glutamate--glyoxylate aminotransf...    430   6e-146   
ref|XP_009103182.1|  PREDICTED: glutamate--glyoxylate aminotransf...    429   7e-146   Brassica rapa
ref|XP_002887312.1|  alanine-2-oxoglutarate aminotransferase 2          429   9e-146   Arabidopsis lyrata subsp. lyrata
ref|NP_001151209.1|  alanine aminotransferase 2                         427   3e-145   
emb|CDY12474.1|  BnaC07g13140D                                          429   3e-145   Brassica napus [oilseed rape]
ref|XP_008444367.1|  PREDICTED: glutamate--glyoxylate aminotransf...    427   4e-145   Cucumis melo [Oriental melon]
ref|XP_006840828.1|  hypothetical protein AMTR_s00083p00031040          427   5e-145   Amborella trichopoda
tpg|DAA42658.1|  TPA: LOW QUALITY PROTEIN: alanine aminotransfera...    426   1e-144   
ref|NP_001183048.1|  uncharacterized protein LOC100501386               426   2e-144   Zea mays [maize]
ref|XP_004142968.1|  PREDICTED: glutamate--glyoxylate aminotransf...    425   2e-144   Cucumis sativus [cucumbers]
gb|AAK25905.1|AF360195_1  putative alanine aminotransferase             425   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008467047.1|  PREDICTED: glutamate--glyoxylate aminotransf...    416   5e-144   Cucumis melo [Oriental melon]
ref|XP_006348507.1|  PREDICTED: glutamate--glyoxylate aminotransf...    423   1e-143   
ref|XP_010248614.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    415   3e-142   
gb|ABK25444.1|  unknown                                                 413   1e-139   Picea sitchensis
tpg|DAA42656.1|  TPA: hypothetical protein ZEAMMB73_648980              412   5e-139   
ref|XP_011034252.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate--g...    407   1e-138   Populus euphratica
gb|AFK42206.1|  unknown                                                 403   3e-138   Lotus japonicus
ref|XP_008447004.1|  PREDICTED: glutamate--glyoxylate aminotransf...    390   9e-133   
ref|XP_003613140.1|  Alanine aminotransferase                           370   5e-123   
ref|XP_001763950.1|  predicted protein                                  368   6e-122   
ref|XP_001782822.1|  predicted protein                                  366   3e-121   
ref|XP_001777071.1|  predicted protein                                  362   2e-119   
ref|NP_001031083.1|  glutamate:glyoxylate aminotransferase              360   3e-119   Arabidopsis thaliana [mouse-ear cress]
gb|EMT29455.1|  Alanine aminotransferase 2                              362   6e-119   
ref|XP_004489786.1|  PREDICTED: glutamate--glyoxylate aminotransf...    360   1e-118   
ref|XP_002527918.1|  alanine aminotransferase, putative                 353   2e-116   
ref|XP_002968244.1|  hypothetical protein SELMODRAFT_145611             345   9e-113   Selaginella moellendorffii
ref|XP_005651940.1|  alanine aminotransferase                           318   8e-102   Coccomyxa subellipsoidea C-169
ref|XP_002947519.1|  alanine aminotransferase                           315   6e-101   Volvox carteri f. nagariensis
ref|XP_001698518.1|  alanine aminotransferase                           309   2e-98    Chlamydomonas reinhardtii
gb|AAB01685.1|  alanine aminotransferase                                307   1e-97    Chlamydomonas reinhardtii
ref|XP_009151206.1|  PREDICTED: glutamate--glyoxylate aminotransf...    285   8e-94    
gb|EWM24220.1|  alanine-2-oxoglutarate aminotransferase 2               293   2e-91    Nannochloropsis gaditana
ref|XP_005847240.1|  hypothetical protein CHLNCDRAFT_57929              279   9e-87    Chlorella variabilis
gb|AAM22749.1|  alanine aminotransferase                                262   4e-85    Deschampsia antarctica
ref|XP_010230121.1|  PREDICTED: glutamate--glyoxylate aminotransf...    263   5e-85    
gb|KJB31174.1|  hypothetical protein B456_005G179600                    270   1e-84    Gossypium raimondii
ref|XP_003291733.1|  alanine transaminase                               272   4e-84    Dictyostelium purpureum
ref|XP_011398130.1|  putative alanine aminotransferase, mitochond...    271   4e-84    Auxenochlorella protothecoides
gb|KIZ07569.1|  alanine transaminase                                    273   1e-83    Monoraphidium neglectum
ref|XP_004955316.1|  PREDICTED: glutamate--glyoxylate aminotransf...    269   8e-83    
tpg|DAA63613.1|  TPA: hypothetical protein ZEAMMB73_743428              261   4e-82    
ref|XP_004992298.1|  alanine aminotransferase                           265   5e-82    Salpingoeca rosetta
ref|NP_001060284.1|  Os07g0617800                                       259   2e-81    
gb|EEE58449.1|  hypothetical protein OsJ_09677                          256   3e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004345426.2|  alanine aminotransferase                           263   4e-81    Capsaspora owczarzaki ATCC 30864
emb|CBJ25743.1|  nicotinanamine aminotransferase A                      263   9e-81    Ectocarpus siliculosus
gb|EFA80185.1|  alanine transaminase                                    265   1e-80    Heterostelium album PN500
gb|KJE95383.1|  alanine aminotransferase                                263   2e-80    Capsaspora owczarzaki ATCC 30864
ref|XP_006657961.1|  PREDICTED: alanine aminotransferase 2-like i...    260   2e-80    Oryza brachyantha
gb|AAV64199.1|  putative alanine aminotransferase                       262   3e-80    Zea mays [maize]
gb|ESA18192.1|  hypothetical protein GLOINDRAFT_334935                  261   4e-80    
ref|XP_006649511.1|  PREDICTED: alanine aminotransferase 2-like         260   5e-80    
ref|XP_006657960.1|  PREDICTED: alanine aminotransferase 2-like i...    260   6e-80    Oryza brachyantha
ref|XP_008653343.1|  PREDICTED: alanine aminotransferase 2              262   6e-80    Zea mays [maize]
gb|AAV64237.1|  putative alanine aminotransferase                       261   6e-80    Zea mays [maize]
gb|EXX69945.1|  alanine transaminase ALT1                               261   7e-80    Rhizophagus irregularis DAOM 197198w
dbj|GAM23260.1|  hypothetical protein SAMD00019534_064350               261   9e-80    Acytostelium subglobosum LB1
dbj|BAC79866.1|  putative alanine aminotransferase                      259   1e-79    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA41461.1|  TPA: hypothetical protein ZEAMMB73_764403              255   1e-79    
gb|ETP13560.1|  hypothetical protein F441_11279                         260   1e-79    Phytophthora parasitica CJ01A1
gb|ETP41623.1|  hypothetical protein F442_11247                         259   1e-79    Phytophthora parasitica P10297
ref|XP_006661735.1|  PREDICTED: alanine aminotransferase 2-like         259   2e-79    Oryza brachyantha
ref|NP_001064504.1|  Os10g0390500                                       259   2e-79    
gb|AAK52114.1|AC079936_10  Putative alanine aminotransferase            259   2e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EEE67593.1|  hypothetical protein OsJ_25140                          259   4e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82447.1|  hypothetical protein OsI_26881                          259   4e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_008907369.1|  hypothetical protein PPTG_13440                    258   6e-79    Phytophthora parasitica INRA-310
gb|KDE04574.1|  hypothetical protein MVLG_05042                         259   1e-78    Microbotryum lychnidis-dioicae p1A1 Lamole
gb|KDD76740.1|  aminotransferase                                        256   2e-78    Helicosporidium sp. ATCC 50920
ref|XP_002463187.1|  hypothetical protein SORBIDRAFT_02g039340          257   4e-78    Sorghum bicolor [broomcorn]
ref|XP_008797360.1|  PREDICTED: alanine aminotransferase 2-like         256   5e-78    Phoenix dactylifera
ref|XP_002906656.1|  alanine aminotransferase 2                         255   8e-78    Phytophthora infestans T30-4
gb|ETI43749.1|  hypothetical protein F443_11362                         255   9e-78    Phytophthora parasitica P1569
ref|XP_008783332.1|  PREDICTED: alanine aminotransferase 2              255   1e-77    Phoenix dactylifera
gb|EEC74641.1|  hypothetical protein OsI_10280                          254   1e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_010939850.1|  PREDICTED: alanine aminotransferase 2 isofor...    248   3e-77    
ref|XP_005833147.1|  hypothetical protein GUITHDRAFT_157749             253   3e-77    Guillardia theta CCMP2712
ref|XP_005443445.1|  PREDICTED: alanine aminotransferase 2-like         251   4e-77    Falco cherrug
emb|CCI42079.1|  unnamed protein product                                253   5e-77    Albugo candida
ref|NP_001086104.1|  alanine aminotransferase 2                         254   6e-77    Xenopus laevis [clawed frog]
ref|XP_005230442.1|  PREDICTED: alanine aminotransferase 2-like         251   7e-77    
gb|KFH70378.1|  alanine transaminase                                    252   8e-77    Mortierella verticillata NRRL 6337
ref|XP_002887430.1|  ALAAT2                                             253   1e-76    
ref|XP_008800517.1|  PREDICTED: alanine aminotransferase 2-like         251   4e-76    
ref|XP_637993.1|  alanine transaminase                                  251   5e-76    Dictyostelium discoideum AX4
gb|KJB68682.1|  hypothetical protein B456_011G0552001                   245   6e-76    Gossypium raimondii
ref|XP_005514471.1|  PREDICTED: alanine aminotransferase 2-like         248   6e-76    
gb|EIE85592.1|  hypothetical protein RO3G_10302                         249   6e-76    Rhizopus delemar RA 99-880
gb|KJB68683.1|  hypothetical protein B456_011G0552001                   245   6e-76    Gossypium raimondii
ref|XP_009380146.1|  PREDICTED: alanine aminotransferase 2-like         251   8e-76    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMC77259.1|  Alanine aminotransferase 2                              248   1e-75    
ref|XP_010937250.1|  PREDICTED: alanine aminotransferase 2              250   1e-75    Elaeis guineensis
gb|ETK88933.1|  hypothetical protein L915_06890                         242   1e-75    Phytophthora parasitica
ref|XP_002969652.1|  hypothetical protein SELMODRAFT_91640              249   1e-75    
ref|XP_002970914.1|  hypothetical protein SELMODRAFT_94316              249   1e-75    
ref|XP_008620886.1|  alanine transaminase                               249   1e-75    Saprolegnia diclina VS20
ref|XP_008869166.1|  hypothetical protein H310_06043                    249   1e-75    Aphanomyces invadans
ref|XP_007441690.1|  PREDICTED: alanine aminotransferase 2-like i...    249   1e-75    
ref|XP_010939849.1|  PREDICTED: alanine aminotransferase 2 isofor...    248   2e-75    Elaeis guineensis
ref|XP_007441689.1|  PREDICTED: alanine aminotransferase 2-like i...    249   2e-75    
ref|XP_009515714.1|  hypothetical protein PHYSODRAFT_476244             248   2e-75    Phytophthora sojae
sp|P52894.1|ALA2_HORVU  RecName: Full=Alanine aminotransferase 2;...    248   2e-75    Hordeum vulgare [barley]
ref|XP_003429759.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    248   2e-75    
ref|XP_002499950.1|  alanine aminotransferase                           248   3e-75    Micromonas commoda
gb|AET06148.1|  PLP-dependent aminotransferase                          248   3e-75    Papaver somniferum
emb|CCA27196.1|  unnamed protein product                                249   3e-75    Albugo laibachii Nc14
ref|XP_009389580.1|  PREDICTED: alanine aminotransferase 2-like         248   3e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007441688.1|  PREDICTED: alanine aminotransferase 2-like i...    249   3e-75    
emb|CEG73189.1|  Putative Alanine transaminase                          248   3e-75    Rhizopus microsporus
emb|CEI91975.1|  Putative Alanine transaminase                          248   3e-75    Rhizopus microsporus
pdb|3TCM|A  Chain A, Crystal Structure Of Alanine Aminotransferas...    248   3e-75    Hordeum vulgare [barley]
ref|XP_004235528.1|  PREDICTED: alanine aminotransferase 2, mitoc...    248   5e-75    
ref|XP_003573850.1|  PREDICTED: alanine aminotransferase 2              248   5e-75    Brachypodium distachyon [annual false brome]
ref|XP_010318452.1|  PREDICTED: alanine aminotransferase 2, mitoc...    248   5e-75    Solanum lycopersicum
gb|AAK59591.2|  putative alanine aminotransferase                       248   6e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185380.1|  alanine aminotransferase 2                         249   6e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565040.2|  alanine aminotransferase 2                            248   7e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010235387.1|  PREDICTED: alanine aminotransferase 2-like i...    248   8e-75    Brachypodium distachyon [annual false brome]
ref|XP_010939848.1|  PREDICTED: alanine aminotransferase 2 isofor...    248   9e-75    Elaeis guineensis
ref|XP_006342898.1|  PREDICTED: alanine aminotransferase 2, mitoc...    247   1e-74    Solanum tuberosum [potatoes]
ref|XP_008157904.1|  PREDICTED: alanine aminotransferase 1              247   1e-74    Eptesicus fuscus
ref|XP_006746371.1|  PREDICTED: alanine aminotransferase 1              241   1e-74    Leptonychotes weddellii
ref|XP_007217248.1|  hypothetical protein PRUPE_ppa003850mg             248   1e-74    Prunus persica
ref|XP_001745052.1|  hypothetical protein                               246   1e-74    Monosiga brevicollis MX1
ref|XP_002681562.1|  alanine aminotransferase                           246   1e-74    Naegleria gruberi strain NEG-M
ref|XP_009557985.1|  PREDICTED: alanine aminotransferase 2-like         244   1e-74    Cuculus canorus
ref|XP_008228107.1|  PREDICTED: alanine aminotransferase 2, mitoc...    248   2e-74    Prunus mume [ume]
gb|ADE77246.1|  unknown                                                 241   2e-74    Picea sitchensis
ref|XP_004166923.1|  PREDICTED: alanine aminotransferase 2, mitoc...    246   2e-74    
ref|XP_010415979.1|  PREDICTED: alanine aminotransferase 2, mitoc...    248   2e-74    Camelina sativa [gold-of-pleasure]
ref|XP_008462239.1|  PREDICTED: alanine aminotransferase 1, mitoc...    246   2e-74    Cucumis melo [Oriental melon]
ref|XP_011072689.1|  PREDICTED: alanine aminotransferase 2              248   2e-74    Sesamum indicum [beniseed]
ref|XP_006342897.1|  PREDICTED: alanine aminotransferase 2, mitoc...    247   2e-74    Solanum tuberosum [potatoes]
ref|XP_004303756.1|  PREDICTED: alanine aminotransferase 2              247   2e-74    Fragaria vesca subsp. vesca
ref|XP_006828623.1|  hypothetical protein AMTR_s00129p00080070          243   2e-74    
ref|XP_004144444.1|  PREDICTED: alanine aminotransferase 2, mitoc...    247   3e-74    
ref|XP_008460348.1|  PREDICTED: alanine aminotransferase 2, mitoc...    246   3e-74    Cucumis melo [Oriental melon]
ref|XP_006426798.1|  hypothetical protein CICLE_v10025334mg             247   3e-74    Citrus clementina [clementine]
ref|XP_006426797.1|  hypothetical protein CICLE_v10025334mg             246   3e-74    
gb|KHG30536.1|  Alanine aminotransferase 2, mitochondrial -like p...    245   3e-74    Gossypium arboreum [tree cotton]
gb|KFO75258.1|  Alanine aminotransferase 2                              244   3e-74    Cuculus canorus
gb|KGN58474.1|  hypothetical protein Csa_3G646610                       247   3e-74    Cucumis sativus [cucumbers]
ref|XP_010428116.1|  PREDICTED: alanine aminotransferase 2, mitoc...    247   4e-74    Camelina sativa [gold-of-pleasure]
ref|XP_005775483.1|  alanine aminotransferase                           246   4e-74    Emiliania huxleyi CCMP1516
emb|CDJ93113.1|  Aminotransferase domain containing protein             246   4e-74    Haemonchus contortus [red stomach worm]
emb|CEP13768.1|  hypothetical protein                                   246   4e-74    Parasitella parasitica
ref|XP_008460347.1|  PREDICTED: alanine aminotransferase 2-like i...    246   5e-74    Cucumis melo [Oriental melon]
ref|XP_010490704.1|  PREDICTED: glutamate--glyoxylate aminotransf...    236   5e-74    Camelina sativa [gold-of-pleasure]
ref|XP_009515719.1|  hypothetical protein PHYSODRAFT_477603             245   5e-74    Phytophthora sojae
ref|XP_005852218.1|  hypothetical protein CHLNCDRAFT_29318              245   6e-74    Chlorella variabilis
ref|XP_010235383.1|  PREDICTED: alanine aminotransferase 2-like i...    248   6e-74    Brachypodium distachyon [annual false brome]
ref|XP_004510570.1|  PREDICTED: alanine aminotransferase 2, mitoc...    246   6e-74    Cicer arietinum [garbanzo]
ref|XP_004141733.1|  PREDICTED: alanine aminotransferase 2, mitoc...    244   6e-74    Cucumis sativus [cucumbers]
gb|KGB32667.1|  Alanine aminotransferase 2                              245   6e-74    Schistosoma haematobium
gb|ETI43741.1|  hypothetical protein F443_11357                         244   7e-74    Phytophthora parasitica P1569
ref|XP_001372290.1|  PREDICTED: alanine aminotransferase 1 isofor...    244   8e-74    
gb|KDO24164.1|  hypothetical protein SPRG_10592                         244   8e-74    Saprolegnia parasitica CBS 223.65
ref|XP_011079322.1|  PREDICTED: alanine aminotransferase 2-like         246   8e-74    Sesamum indicum [beniseed]
gb|EMT23015.1|  Alanine aminotransferase 2                              245   9e-74    
gb|EYU45916.1|  hypothetical protein MIMGU_mgv1a005454mg                244   9e-74    Erythranthe guttata [common monkey flower]
ref|XP_010471259.1|  PREDICTED: alanine aminotransferase 2, mitoc...    246   9e-74    Camelina sativa [gold-of-pleasure]
gb|EPB88721.1|  alanine transaminase                                    245   9e-74    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_007488862.1|  PREDICTED: alanine aminotransferase 1 isofor...    244   1e-73    Monodelphis domestica
gb|KDO53767.1|  hypothetical protein CISIN_1g009517mg                   245   1e-73    Citrus sinensis [apfelsine]
ref|XP_006465804.1|  PREDICTED: alanine aminotransferase 2, mitoc...    245   1e-73    Citrus sinensis [apfelsine]
ref|XP_004155894.1|  PREDICTED: alanine aminotransferase 2, mitoc...    244   1e-73    
ref|XP_008120969.1|  PREDICTED: alanine aminotransferase 1-like         244   1e-73    Anolis carolinensis [Carolina anole]
ref|NP_001016805.1|  alanine aminotransferase 2                         244   1e-73    Xenopus tropicalis [western clawed frog]
gb|EMS46317.1|  Alanine aminotransferase 2                              244   2e-73    Triticum urartu
gb|EPS60556.1|  hypothetical protein M569_14246                         244   2e-73    Genlisea aurea
ref|XP_007024768.1|  Alanine aminotransferase 2                         245   2e-73    
ref|XP_009899311.1|  PREDICTED: alanine aminotransferase 1              241   2e-73    Picoides pubescens
gb|AIT69941.1|  alanine transaminase                                    243   3e-73    Gloiopeltis furcata
gb|KHN39571.1|  Alanine aminotransferase 2, mitochondrial               244   3e-73    Glycine soja [wild soybean]
emb|CEG76882.1|  Putative Alanine transaminase                          244   3e-73    Rhizopus microsporus
ref|XP_001769989.1|  predicted protein                                  243   3e-73    
ref|XP_006634237.1|  PREDICTED: alanine aminotransferase 2-like         243   3e-73    
gb|KFV67752.1|  Alanine aminotransferase 2                              242   3e-73    Picoides pubescens
ref|XP_003228933.1|  PREDICTED: alanine aminotransferase 1-like         243   3e-73    Anolis carolinensis [Carolina anole]
ref|XP_007516096.1|  PREDICTED: alanine aminotransferase 1              243   3e-73    Erinaceus europaeus [common hedgehog]
ref|XP_009826737.1|  hypothetical protein H257_04062                    243   3e-73    Aphanomyces astaci
gb|ETP13552.1|  hypothetical protein F441_11274                         243   4e-73    Phytophthora parasitica CJ01A1
ref|XP_010096539.1|  Alanine aminotransferase 2                         244   5e-73    Morus notabilis
ref|XP_009175684.1|  hypothetical protein T265_10908                    242   5e-73    Opisthorchis viverrini [Southeast Asian liver fluke]
dbj|GAN09782.1|  alanine transaminase                                   243   6e-73    Mucor ambiguus
ref|XP_004580835.1|  PREDICTED: alanine aminotransferase 1              242   7e-73    Ochotona princeps [southern American pika]
dbj|GAA29952.1|  alanine transaminase                                   242   8e-73    Clonorchis sinensis [oriental liver fluke]
ref|XP_004235527.1|  PREDICTED: alanine aminotransferase 2-like         244   8e-73    
ref|XP_004342401.1|  alanine aminotransferase, mitochondrial, put...    242   9e-73    Acanthamoeba castellanii str. Neff
gb|AIT69922.1|  alanine transaminase                                    242   9e-73    Sargassum fusiforme
ref|XP_571848.1|  transaminase                                          242   1e-72    
ref|XP_008150574.1|  PREDICTED: alanine aminotransferase 2 isofor...    241   1e-72    
ref|XP_010685211.1|  PREDICTED: alanine aminotransferase 2              243   1e-72    
ref|XP_003627448.1|  Alanine aminotransferase                           243   1e-72    
ref|XP_004400797.1|  PREDICTED: alanine aminotransferase 1              242   1e-72    
ref|XP_006300438.1|  hypothetical protein CARUB_v10020102mg             243   1e-72    
ref|XP_005062449.1|  PREDICTED: alanine aminotransferase 2-like i...    240   1e-72    
ref|XP_003760591.1|  PREDICTED: alanine aminotransferase 1              241   1e-72    
gb|KIR88856.1|  alanine transaminase                                    242   1e-72    
ref|XP_009382959.1|  PREDICTED: alanine aminotransferase 2              242   1e-72    
emb|CCD81366.1|  putative alanine aminotransferase                      241   2e-72    
emb|CDJ93112.1|  Aminotransferase domain containing protein             239   2e-72    
gb|KIR54768.1|  alanine transaminase                                    241   2e-72    
gb|KGB76334.1|  transaminase                                            241   2e-72    
gb|KIR49354.1|  alanine transaminase                                    241   2e-72    
ref|XP_010959534.1|  PREDICTED: alanine aminotransferase 1              239   2e-72    
gb|AGV14561.1|  alanine transaminase, variant                           241   2e-72    
gb|KIR99100.1|  alanine transaminase                                    241   2e-72    
ref|XP_005062450.1|  PREDICTED: alanine aminotransferase 2-like i...    240   3e-72    
emb|CEG73119.1|  Putative Alanine transaminase                          241   3e-72    
emb|CEF68484.1|  Alanine aminotransferase 1                             240   3e-72    
emb|CEG73120.1|  Putative Alanine transaminase                          241   3e-72    
ref|XP_004697404.1|  PREDICTED: alanine aminotransferase 1              240   3e-72    
ref|XP_008150573.1|  PREDICTED: alanine aminotransferase 2 isofor...    241   3e-72    
gb|AFR96660.1|  alanine transaminase                                    241   3e-72    
gb|ADB91976.1|  alanine aminotransferase                                240   3e-72    
ref|XP_003195327.1|  glutamate-pyruvate transaminase/Glutamate-al...    241   3e-72    
emb|CEI94294.1|  Putative Alanine transaminase                          241   4e-72    
ref|XP_010628764.1|  PREDICTED: alanine aminotransferase 1              240   4e-72    
gb|AIT69936.1|  alanine transaminase                                    239   4e-72    
ref|XP_004779455.1|  PREDICTED: alanine aminotransferase 1 isofor...    240   4e-72    
gb|ACJ85860.1|  unknown                                                 241   5e-72    
emb|CDS14202.1|  hypothetical protein LRAMOSA06372                      240   5e-72    
ref|XP_004227217.1|  PREDICTED: alanine aminotransferase 2              240   7e-72    
ref|XP_004826063.1|  PREDICTED: alanine aminotransferase 1 isofor...    240   7e-72    
ref|XP_004779454.1|  PREDICTED: alanine aminotransferase 1 isofor...    240   7e-72    
ref|XP_003757274.1|  PREDICTED: alanine aminotransferase 2              239   7e-72    
gb|AIT69935.1|  alanine transaminase                                    239   7e-72    
ref|XP_001363190.1|  PREDICTED: alanine aminotransferase 2 isofor...    240   9e-72    
gb|AIT69930.1|  alanine transaminase                                    239   1e-71    
ref|XP_010776891.1|  PREDICTED: alanine aminotransferase 2-like         236   1e-71    
ref|XP_004356702.1|  alanine aminotransferase, mitochondrial, put...    238   1e-71    
ref|XP_010884988.1|  PREDICTED: alanine aminotransferase 2-like i...    239   1e-71    
ref|XP_009606549.1|  PREDICTED: alanine aminotransferase 2              240   1e-71    
ref|XP_004265286.1|  PREDICTED: alanine aminotransferase 1              239   2e-71    
ref|XP_005613478.1|  PREDICTED: alanine aminotransferase 1              236   2e-71    
ref|XP_007135364.1|  hypothetical protein PHAVU_010G123200g             239   2e-71    
ref|XP_002906651.1|  alanine aminotransferase 2                         238   2e-71    
emb|CAD58795.1|  glutamic-pyruvate transaminase                         233   2e-71    
gb|AIT69940.1|  alanine transaminase                                    238   2e-71    
gb|ETN63742.1|  alanine aminotransferase                                238   2e-71    
ref|XP_005608301.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   2e-71    
ref|XP_006172385.1|  PREDICTED: LOW QUALITY PROTEIN: glutamic-pyr...    236   2e-71    
ref|XP_006530622.1|  PREDICTED: alanine aminotransferase 2 isofor...    232   2e-71    
ref|XP_008903570.1|  hypothetical protein PPTG_10079                    238   2e-71    
emb|CEI89079.1|  Putative Alanine transaminase                          238   3e-71    
emb|CEI89078.1|  Putative Alanine transaminase                          238   3e-71    
ref|XP_010285870.1|  PREDICTED: alanine aminotransferase 2              236   3e-71    
ref|XP_011226824.1|  PREDICTED: alanine aminotransferase 1 isofor...    240   3e-71    
ref|XP_006064662.1|  PREDICTED: alanine aminotransferase 1 isofor...    238   3e-71    
gb|AIT69932.1|  alanine transaminase                                    237   3e-71    
ref|XP_009079156.1|  PREDICTED: alanine aminotransferase 2              233   3e-71    
ref|XP_010716082.1|  PREDICTED: alanine aminotransferase 2              235   3e-71    
ref|XP_010917380.1|  PREDICTED: alanine aminotransferase 2-like i...    238   3e-71    
ref|XP_010842208.1|  PREDICTED: alanine aminotransferase 2              236   3e-71    
ref|XP_009798100.1|  PREDICTED: alanine aminotransferase 2-like         239   3e-71    
ref|XP_010884980.1|  PREDICTED: alanine aminotransferase 2-like i...    239   4e-71    
ref|XP_007474882.1|  PREDICTED: alanine aminotransferase 2 isofor...    239   4e-71    
gb|AIT69942.1|  alanine transaminase                                    237   4e-71    
emb|CDH53092.1|  alanine transaminase                                   239   4e-71    
ref|XP_003802370.1|  PREDICTED: alanine aminotransferase 1              238   4e-71    
gb|AFK39904.1|  unknown                                                 238   4e-71    
ref|XP_008507870.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   4e-71    
ref|NP_001077209.1|  alanine aminotransferase 1                         238   5e-71    
gb|EMT05433.1|  Alanine aminotransferase 2                              238   5e-71    
gb|KFQ69505.1|  Alanine aminotransferase 2                              236   5e-71    
ref|XP_008436808.1|  PREDICTED: alanine aminotransferase 1              237   5e-71    
ref|XP_007547926.1|  PREDICTED: alanine aminotransferase 1              237   6e-71    
ref|XP_009939421.1|  PREDICTED: alanine aminotransferase 2              235   6e-71    
ref|XP_008584771.1|  PREDICTED: alanine aminotransferase 2              236   6e-71    
ref|XP_004944250.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   6e-71    
ref|XP_010812871.1|  PREDICTED: alanine aminotransferase 2 isofor...    235   6e-71    
ref|XP_004618719.1|  PREDICTED: alanine aminotransferase 1              237   6e-71    
ref|XP_005401471.1|  PREDICTED: alanine aminotransferase 2-like i...    235   6e-71    
ref|XP_001919896.1|  PREDICTED: alanine aminotransferase 1              237   7e-71    
ref|XP_005318527.1|  PREDICTED: alanine aminotransferase 2              236   7e-71    
gb|KFR15864.1|  Alanine aminotransferase 2                              235   8e-71    
ref|XP_008246599.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    238   8e-71    
ref|XP_005608300.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   8e-71    
gb|AIT69931.1|  alanine transaminase                                    237   8e-71    
ref|XP_004600748.1|  PREDICTED: alanine aminotransferase 2              237   8e-71    
gb|EMS62762.1|  Alanine aminotransferase 2                              238   9e-71    
ref|XP_006191406.1|  PREDICTED: alanine aminotransferase 2              236   9e-71    
ref|XP_008524431.1|  PREDICTED: alanine aminotransferase 1              236   1e-70    
ref|XP_006211266.1|  PREDICTED: alanine aminotransferase 1              236   1e-70    
ref|XP_007537772.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   1e-70    
ref|XP_010394851.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_006121251.1|  PREDICTED: alanine aminotransferase 2              238   1e-70    
dbj|BAN21041.1|  alanine aminotransferase                               237   1e-70    
ref|XP_010113991.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_010917378.1|  PREDICTED: alanine aminotransferase 2-like i...    238   1e-70    
ref|XP_010015482.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_005426315.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_008068165.1|  PREDICTED: alanine aminotransferase 1              236   1e-70    
ref|XP_006729760.1|  PREDICTED: alanine aminotransferase 2 isofor...    237   1e-70    
ref|XP_008700888.1|  PREDICTED: alanine aminotransferase 2              236   1e-70    
ref|XP_005401470.1|  PREDICTED: alanine aminotransferase 2-like i...    235   1e-70    
gb|KFP35282.1|  Alanine aminotransferase 2                              235   1e-70    
ref|XP_011235435.1|  PREDICTED: LOW QUALITY PROTEIN: alanine amin...    236   1e-70    
ref|XP_006416720.1|  hypothetical protein EUTSA_v10007290mg             238   1e-70    
ref|XP_009816631.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_005490144.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_009976045.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_009274977.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_010193171.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
gb|KFQ52041.1|  Alanine aminotransferase 2                              235   1e-70    
ref|XP_004324928.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_005664519.1|  PREDICTED: alanine aminotransferase 2 isofor...    237   1e-70    
ref|XP_004472119.1|  PREDICTED: alanine aminotransferase 1              235   1e-70    
ref|XP_010151513.1|  PREDICTED: alanine aminotransferase 2              234   1e-70    
ref|XP_004443056.1|  PREDICTED: alanine aminotransferase 1              236   2e-70    
gb|EDL29603.1|  glutamic pyruvic transaminase 1, soluble, isoform...    234   2e-70    
ref|XP_009487594.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
emb|CDX91589.1|  BnaC02g15710D                                          224   2e-70    
gb|KFQ20610.1|  Alanine aminotransferase 2                              234   2e-70    
ref|XP_009700544.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
ref|XP_007059708.1|  PREDICTED: alanine aminotransferase 2              238   2e-70    
ref|XP_006034404.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
ref|XP_005401469.1|  PREDICTED: alanine aminotransferase 2-like i...    235   2e-70    
gb|KFZ65228.1|  Alanine aminotransferase 2                              234   2e-70    
gb|KFP49490.1|  Alanine aminotransferase 2                              233   2e-70    
gb|KFU99477.1|  Alanine aminotransferase 2                              234   2e-70    
gb|AIT69921.1|  alanine transaminase                                    236   2e-70    
ref|XP_010078751.1|  PREDICTED: alanine aminotransferase 2              231   2e-70    
gb|KFV58998.1|  Alanine aminotransferase 2                              234   2e-70    
ref|XP_010166043.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
gb|AIT69918.1|  alanine transaminase                                    236   2e-70    
ref|XP_004656487.1|  PREDICTED: alanine aminotransferase 1              236   2e-70    
ref|XP_004906842.1|  PREDICTED: alanine aminotransferase 1 isofor...    236   2e-70    
emb|CDO97792.1|  unnamed protein product                                235   2e-70    
ref|XP_009571057.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
ref|XP_004362319.1|  alanine transaminase                               236   2e-70    
gb|KFV00293.1|  Alanine aminotransferase 2                              231   2e-70    
ref|XP_009920931.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
ref|XP_005233896.1|  PREDICTED: alanine aminotransferase 2              234   2e-70    
gb|AAR05449.1|  alanine aminotransferase                                235   2e-70    
ref|XP_005608298.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   2e-70    
ref|XP_008053205.1|  PREDICTED: alanine aminotransferase 2              235   2e-70    
gb|KFO61771.1|  Alanine aminotransferase 2                              235   2e-70    
ref|XP_003463744.1|  PREDICTED: alanine aminotransferase 1 isofor...    236   2e-70    
ref|XP_006641441.1|  PREDICTED: alanine aminotransferase 2-like         237   2e-70    
emb|CBK19835.2|  Alanine aminotransferase 2                             235   2e-70    
ref|XP_004583880.1|  PREDICTED: alanine aminotransferase 2 isofor...    235   3e-70    
ref|XP_005395954.1|  PREDICTED: alanine aminotransferase 1              235   3e-70    
gb|AIT69938.1|  alanine transaminase                                    236   3e-70    
ref|XP_002166762.2|  PREDICTED: alanine aminotransferase 2-like         234   3e-70    
ref|XP_010140032.1|  PREDICTED: alanine aminotransferase 2              233   3e-70    
ref|XP_005692006.1|  PREDICTED: alanine aminotransferase 2              233   3e-70    
ref|NP_001237553.1|  alanine aminotransferase 1                         235   3e-70    
gb|KFP59082.1|  Alanine aminotransferase 2                              234   3e-70    
ref|XP_005526440.1|  PREDICTED: alanine aminotransferase 2 isofor...    234   3e-70    
gb|KFQ54613.1|  Alanine aminotransferase 2                              234   3e-70    
ref|XP_006887880.1|  PREDICTED: alanine aminotransferase 2              236   3e-70    
ref|XP_004403733.1|  PREDICTED: alanine aminotransferase 2              236   3e-70    
gb|KFZ58051.1|  Alanine aminotransferase 2                              234   3e-70    
ref|XP_010309159.1|  PREDICTED: alanine aminotransferase 2              233   3e-70    
gb|KFQ05762.1|  Alanine aminotransferase 2                              234   3e-70    
ref|XP_007537771.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   3e-70    
gb|AHJ25706.1|  GPT2                                                    227   3e-70    
gb|KFP94695.1|  Alanine aminotransferase 2                              234   4e-70    
ref|XP_007439806.1|  PREDICTED: alanine aminotransferase 2              233   4e-70    
gb|KFO93213.1|  Alanine aminotransferase 2                              234   4e-70    
ref|XP_003127043.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   4e-70    
ref|XP_414111.3|  PREDICTED: alanine aminotransferase 2 isoform X2      236   4e-70    
ref|XP_006530621.1|  PREDICTED: alanine aminotransferase 2 isofor...    232   4e-70    
gb|AIT69937.1|  alanine transaminase                                    236   4e-70    
ref|XP_004744170.1|  PREDICTED: alanine aminotransferase 2 isofor...    236   4e-70    
ref|XP_002430266.1|  Alanine aminotransferase, putative                 234   4e-70    
ref|XP_008635361.1|  PREDICTED: alanine aminotransferase 1              235   4e-70    
ref|XP_005215289.1|  PREDICTED: alanine aminotransferase 1 isofor...    235   4e-70    
gb|EIE90509.1|  hypothetical protein RO3G_15220                         234   4e-70    
ref|XP_006261713.1|  PREDICTED: alanine aminotransferase 2              233   4e-70    
ref|XP_001490415.3|  PREDICTED: alanine aminotransferase 2 isofor...    236   4e-70    
ref|XP_004690373.1|  PREDICTED: alanine aminotransferase 2              235   5e-70    
ref|XP_006207932.1|  PREDICTED: alanine aminotransferase 2              235   5e-70    
ref|XP_010273809.1|  PREDICTED: alanine aminotransferase 2-like         235   5e-70    
ref|XP_003792568.1|  PREDICTED: alanine aminotransferase 2              235   5e-70    
gb|EYC32542.1|  hypothetical protein Y032_0003g1641                     234   5e-70    
ref|NP_001135938.1|  alanine aminotransferase 2 isoform 2               233   5e-70    
ref|NP_001012057.1|  alanine aminotransferase 2                         235   6e-70    
gb|ETK83815.1|  hypothetical protein L915_11053                         225   6e-70    
gb|KFO06425.1|  Alanine aminotransferase 2                              233   6e-70    
ref|XP_009461778.1|  PREDICTED: alanine aminotransferase 2 isofor...    234   6e-70    
ref|XP_008936281.1|  PREDICTED: alanine aminotransferase 2              233   6e-70    
ref|XP_010884160.1|  PREDICTED: alanine aminotransferase 1 isofor...    233   6e-70    
dbj|BAC04465.1|  unnamed protein product                                233   6e-70    
dbj|BAO51933.1|  alanine aminotransferase                               234   6e-70    
gb|KFK41654.1|  hypothetical protein AALP_AA2G155600                    236   6e-70    
ref|XP_006064660.1|  PREDICTED: alanine aminotransferase 1 isofor...    237   7e-70    
gb|KFQ82063.1|  Alanine aminotransferase 2                              233   7e-70    
ref|XP_005289905.1|  PREDICTED: alanine aminotransferase 2              236   7e-70    
ref|XP_005662864.1|  PREDICTED: alanine aminotransferase 1 isofor...    232   7e-70    
ref|XP_003055208.1|  predicted protein                                  234   7e-70    
gb|KFQ16813.1|  Alanine aminotransferase 2                              233   7e-70    
ref|XP_004629253.1|  PREDICTED: alanine aminotransferase 2              235   7e-70    
ref|XP_009636322.1|  PREDICTED: alanine aminotransferase 2              232   7e-70    
ref|XP_005218795.1|  PREDICTED: alanine aminotransferase 2 isofor...    235   8e-70    
ref|NP_001180116.1|  alanine aminotransferase 2                         235   8e-70    
ref|NP_877957.1|  alanine aminotransferase 1                            234   8e-70    
ref|XP_009676627.1|  PREDICTED: alanine aminotransferase 2              233   8e-70    
ref|XP_009088853.1|  PREDICTED: alanine aminotransferase 2              232   8e-70    
gb|ENN78579.1|  hypothetical protein YQE_04947                          235   9e-70    
ref|XP_008499534.1|  PREDICTED: alanine aminotransferase 2              234   9e-70    
ref|XP_006062821.1|  PREDICTED: alanine aminotransferase 2              235   9e-70    
ref|XP_009059448.1|  hypothetical protein LOTGIDRAFT_192553             234   9e-70    
ref|XP_006186085.1|  PREDICTED: alanine aminotransferase 1              232   9e-70    
ref|XP_001660470.1|  AAEL009872-PA                                      235   1e-69    
gb|KFB49063.1|  AGAP000901-PA-like protein                              235   1e-69    
ref|XP_010615561.1|  PREDICTED: alanine aminotransferase 2              232   1e-69    
gb|KFP15258.1|  Alanine aminotransferase 2                              233   1e-69    
ref|XP_008283496.1|  PREDICTED: alanine aminotransferase 2-like i...    234   1e-69    



>ref|XP_009623844.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
tomentosiformis]
Length=481

 Score =   472 bits (1214),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 222/241 (92%), Positives = 234/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E+ VLLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QESLVLLGDEVYQQNIYQDERPFISARKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNPPKPGDISYDQ+VRE KGIL
Sbjct  301  GGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+ LGK PDV+YCL+L
Sbjct  361  ESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKKLGKVPDVFYCLRL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_009765091.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nicotiana 
sylvestris]
Length=481

 Score =   471 bits (1211),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/241 (92%), Positives = 234/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E+ VLLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QESLVLLGDEVYQQNIYQDERPFISARKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP+SVEEIYKVASISLSPNVPGQIF+GLMVNPPKPGDISYDQ+VRE KGIL
Sbjct  301  GGYFEMTNIPPKSVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK PDV+YCL+L
Sbjct  361  ESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKLGKVPDVFYCLRL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_004239121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Solanum 
lycopersicum]
Length=481

 Score =   467 bits (1202),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/241 (91%), Positives = 234/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVLLDMG P+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNPPKPGDISYDQ+VRE KGIL
Sbjct  301  GGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIETA  LGKAPDV YCL+L
Sbjct  361  ESLRKRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIETANKLGKAPDVLYCLRL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++YEDH+GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|KGN51765.1| hypothetical protein Csa_5G598730 [Cucumis sativus]
Length=481

 Score =   466 bits (1200),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQN+YQDERPF+SSRKVLLDMGPPISKELQL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNVYQDERPFISSRKVLLDMGPPISKELQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISYDQF+RE KGIL
Sbjct  301  GGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK PDV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++YEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEEYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_006357614.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=481

 Score =   466 bits (1199),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/241 (90%), Positives = 234/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVLLDMG P+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLLDMGLPLSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++VEEIYKVASISLSPNVPGQIF+GLMVNPPKPGDISYDQ+VRE KGIL
Sbjct  301  GGYFEMTNIPPKAVEEIYKVASISLSPNVPGQIFMGLMVNPPKPGDISYDQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETA  LGKA DV+YCL+L
Sbjct  361  ESLRRRAHMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETANKLGKAADVFYCLRL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM++YEDH+GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEKYEDHKGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|KDP26646.1| hypothetical protein JCGZ_17804 [Jatropha curcas]
Length=481

 Score =   466 bits (1199),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 217/241 (90%), Positives = 233/241 (97%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+S+RKVLLDMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISARKVLLDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNPPKPGDISYDQFVREGKGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYDQFVREGKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+ LGK PDV+YCLKL
Sbjct  361  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRLGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+QYEDH GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMSSFKKFNDEFMEQYEDHTGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>emb|CDP13207.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   463 bits (1191),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 215/241 (89%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPI+KELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPINKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP+SVEEIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY+++VRE K +L
Sbjct  301  GGYFEMTNIPPKSVEEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYERYVRESKAVL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRKRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDH+GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHKGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_010100388.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
 gb|EXB82522.1| Glutamate--glyoxylate aminotransferase 2 [Morus notabilis]
Length=481

 Score =   462 bits (1190),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SSRKVLLDMGPPISKE+QL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISSRKVLLDMGPPISKEVQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKV+SISLSPNVP QIFLGLMVNPP+PGDISY+Q+VRE KGIL
Sbjct  301  GGYFEMTNIPPETVDEIYKVSSISLSPNVPAQIFLGLMVNPPRPGDISYEQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRASIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGMFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>emb|CBI23368.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   461 bits (1186),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP PGDISY QF+RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKL
Sbjct  361  ESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|NP_001268094.1| uncharacterized protein LOC100261274 [Vitis vinifera]
 gb|AAZ43369.1| AlaT1 [Vitis vinifera]
Length=484

 Score =   461 bits (1185),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP PGDISY QF+RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKL
Sbjct  361  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIMESFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMESFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_004155366.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Cucumis sativus]
Length=481

 Score =   460 bits (1183),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 230/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQN+YQDERPF+SSRKVLLDMGPPISKELQL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNVYQDERPFISSRKVLLDMGPPISKELQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISYDQF+RE KGIL
Sbjct  301  GGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK PDV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++YED  GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEEYEDXWGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>emb|CAN62302.1| hypothetical protein VITISV_023686 [Vitis vinifera]
Length=481

 Score =   458 bits (1179),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 215/241 (89%), Positives = 231/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP PGDISY QF+RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKL
Sbjct  361  ESLKRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE MPAIMESFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEXMPAIMESFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|EYU28421.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
 gb|EYU28422.1| hypothetical protein MIMGU_mgv1a005535mg [Erythranthe guttata]
Length=480

 Score =   457 bits (1176),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 211/241 (88%), Positives = 231/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + N VLLGDEVYQQNIYQDERPF+S+RKVL+DMG PI+KELQLVSFHTVSKGYWGECGQR
Sbjct  240  QNNVVLLGDEVYQQNIYQDERPFISARKVLMDMGAPINKELQLVSFHTVSKGYWGECGQR  299

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++VEEIYKVASI+LSPNVP QIF+GLMVNPPKPGDISY++F+RE KGIL
Sbjct  300  GGYFEMTNIPPKAVEEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYERFIRESKGIL  359

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA++MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE AQ  GK  DV+YCLKL
Sbjct  360  ESLRRRAQLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAQKAGKVADVFYCLKL  419

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDH+GYSR
Sbjct  420  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHKGYSR  479

Query  43   M  41
            M
Sbjct  480  M  480



>ref|XP_008340115.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
 ref|XP_008340116.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Malus domestica]
Length=481

 Score =   457 bits (1175),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             E+ VLLGDEVYQQNIYQDERPF+SSRKVL+ MG PISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  HESLVLLGDEVYQQNIYQDERPFISSRKVLMGMGLPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNPPKPGDISY+QF+RE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK  DV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQYEDQRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_006438274.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438275.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438276.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438277.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006438278.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 ref|XP_006483938.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483939.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Citrus sinensis]
 ref|XP_006483940.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X3 [Citrus sinensis]
 gb|ESR51514.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51515.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51516.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51517.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
 gb|ESR51518.1| hypothetical protein CICLE_v10031381mg [Citrus clementina]
Length=481

 Score =   456 bits (1174),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 232/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SS+KVL+DMGPP SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFVSSKKVLMDMGPPFSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP KPGDISY+QFVRE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKPGDISYEQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCL+L
Sbjct  361  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLRL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYED+RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDYRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_009359228.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Pyrus x 
bretschneideri]
Length=481

 Score =   455 bits (1171),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 213/241 (88%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             E+ VLLGDEVYQQNIYQDERPF+SSRKVL+ MG PISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  HESLVLLGDEVYQQNIYQDERPFISSRKVLMGMGLPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNPPKPGDISY+QF+RE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE AQ  GK  DV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAQRAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFN+EFMDQYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMDQYEDQRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_008221924.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221925.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
 ref|XP_008221927.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Prunus mume]
Length=481

 Score =   455 bits (1170),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 214/241 (89%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             E  VLLGDEVYQQNIYQDERPF+S+RKVL+ MG PISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  HEGLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNPPKPGDISY+QFVRE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYEQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRARIMTDGFN+CRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK  DV+YCLKL
Sbjct  361  ESLRKRARIMTDGFNNCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_008389735.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Malus 
domestica]
Length=481

 Score =   455 bits (1170),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE+ VLLGDEVYQQNIYQDERPF+S+RKVL+ MG P+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  RESLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPVSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKV SI+LSPNVP QIF+GLMVNPPKPGDISY+QF+RE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKVVSIALSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFMDQYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMDQYEDRRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_004135487.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
Length=460

 Score =   454 bits (1167),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 209/232 (90%), Positives = 224/232 (97%), Gaps = 0/232 (0%)
 Frame = -3

Query  736  EVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNI  557
            EVYQQN+YQDERPF+SSRKVLLDMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNI
Sbjct  229  EVYQQNVYQDERPFISSRKVLLDMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNI  288

Query  556  PPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARI  377
            PPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISYDQF+RE KGILESLR+RARI
Sbjct  289  PPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARI  348

Query  376  MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTV  197
            MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+ LGK PDV+YCLKLLEATGISTV
Sbjct  349  MTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKKLGKVPDVFYCLKLLEATGISTV  408

Query  196  PGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            PGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  409  PGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDSFMEEYEDHRGYSRM  460



>gb|KDO82251.1| hypothetical protein CISIN_1g041151mg [Citrus sinensis]
Length=463

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 210/241 (87%), Positives = 231/241 (96%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQR
Sbjct  223  QENLVLLGDEVYQQNIYQDERPFVSSKKVLMDMGLPFSKEVQLVSFHTVSKGYWGECGQR  282

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASI+LSPNVP QIF+GLMVNP KPGDISY+QFVRE KGIL
Sbjct  283  GGYFEMTNIPPKTVDEIYKIASIALSPNVPAQIFMGLMVNPLKPGDISYEQFVRESKGIL  342

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCL+L
Sbjct  343  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLRL  402

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEG+FHLRTTILPAEEDMPAIMESFKKFNDEFM+QYED+RGYSR
Sbjct  403  LEATGISTVPGSGFGQKEGIFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDYRGYSR  462

Query  43   M  41
            M
Sbjct  463  M  463



>ref|XP_007222799.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
 gb|EMJ23998.1| hypothetical protein PRUPE_ppa005017mg [Prunus persica]
Length=481

 Score =   453 bits (1166),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             E  VLLGDEVYQQNIYQDERPF+S+RKVL+ MG PISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  HEGLVLLGDEVYQQNIYQDERPFISARKVLMGMGLPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVP QIF+GLMVNPPKPGDISY+QFVRE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASIALSPNVPAQIFMGLMVNPPKPGDISYEQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFN+CRN+VCNFTEGAMYSFPQIRLPPRAIE A+  GK  DV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNNCRNIVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_011086618.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2-like [Sesamum indicum]
Length=478

 Score =   453 bits (1165),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + N VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKE QLVSFHTVSKGYWGECGQR
Sbjct  238  QNNLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKECQLVSFHTVSKGYWGECGQR  297

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNI P++VEEIYKVASISLSPNVP QIF+GLMVNP KPGDISY+++VRE KGIL
Sbjct  298  GGYFEMTNISPKTVEEIYKVASISLSPNVPAQIFMGLMVNPLKPGDISYERYVRESKGIL  357

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKL
Sbjct  358  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKL  417

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSR
Sbjct  418  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHRGYSR  477

Query  43   M  41
            M
Sbjct  478  M  478



>gb|AAZ43368.1| AlaT1 [Vitis labrusca]
Length=477

 Score =   452 bits (1163),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 212/237 (89%), Positives = 227/237 (96%), Gaps = 0/237 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RK L+DMGPPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKALMDMGPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLG+MVNPP PGDISY QF+RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASISLSPNVPGQIFLGVMVNPPTPGDISYLQFMRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK  DV+YCLKL
Sbjct  361  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKKAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRG  53
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFM+QYEDHRG
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMEQYEDHRG  477



>ref|XP_010023477.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
 ref|XP_010023478.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Eucalyptus 
grandis]
Length=481

 Score =   451 bits (1160),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 208/241 (86%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLLGDEVYQQNIYQDERPF+S++KVLL+MGPPIS+ELQLVSFHTVSKGYWGECGQR
Sbjct  241  QEKLVLLGDEVYQQNIYQDERPFISAKKVLLNMGPPISRELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QI +G+MV+PPKPGDISYD +VRE KGI+
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQILMGMMVDPPKPGDISYDLYVRESKGII  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKQAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMASFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_002312679.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
 gb|EEE90046.2| alanine-2-oxoglutarate aminotransferase 1 family protein [Populus 
trichocarpa]
Length=481

 Score =   450 bits (1157),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 230/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+S+RKVL+ MGPP+SKE+QL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISARKVLMGMGPPVSKEVQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNPPKPGDISY+QF+RE KGIL
Sbjct  301  GGYFEMTNIPPKAVDEIYKVASVSLSPNVPAQIFMGLMVNPPKPGDISYEQFIRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNV+CNFTEGAMYSFPQIRLPP+AI+ A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARMMTDGFNSCRNVICNFTEGAMYSFPQIRLPPKAIDAAKMAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+QYE H GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMDSFKKFNDEFMEQYEGHGGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_010251104.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251105.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
 ref|XP_010251106.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Nelumbo 
nucifera]
Length=481

 Score =   449 bits (1156),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 208/241 (86%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S++KVL+D+G P+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNIYQDERPFISAKKVLMDLGAPLSREVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIFLGLMVNPPKPGDISY +FV E K IL
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFLGLMVNPPKPGDISYLKFVTESKAIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK PDV+YCLKL
Sbjct  361  DSLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKNAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|AET06145.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=480

 Score =   449 bits (1156),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 212/241 (88%), Positives = 225/241 (93%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE  VLL DEVYQQN+YQDERPF+SSRKVL+DMG PISK++QLVSFHTVSKGYWGECGQR
Sbjct  240  REKLVLLADEVYQQNVYQDERPFISSRKVLMDMGTPISKDVQLVSFHTVSKGYWGECGQR  299

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIP  SV+EIYKVASISLSPNVPGQIFLGLMVNPPKPGDISY +FV+E K IL
Sbjct  300  GGYFEMTNIPAESVDEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYQKFVQESKTIL  359

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRA IMT+GFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDVYYCLKL
Sbjct  360  ESLRKRAHIMTNGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEVAKMAGKVPDVYYCLKL  419

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM+SFKKFND FM+QYED RGYSR
Sbjct  420  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMDSFKKFNDAFMEQYEDQRGYSR  479

Query  43   M  41
            M
Sbjct  480  M  480



>ref|XP_004309987.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457416.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   449 bits (1154),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 208/241 (86%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQN+YQDERPF+S+RKVL+ MGP ISKELQLVSFH+VSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNVYQDERPFISARKVLMGMGPFISKELQLVSFHSVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS++LSPNVP QIF+GLMVNPPKPGDISYDQF RE K IL
Sbjct  301  GGYFEMTNIPPQTVDEIYKVASVALSPNVPAQIFMGLMVNPPKPGDISYDQFARESKEIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAI+ A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIQAAKSAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQK+GVFHLRTTILPAEEDMPAIM+SFKKFN+EFM+QYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMDSFKKFNNEFMEQYEDDRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_003613139.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96097.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=481

 Score =   449 bits (1154),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 232/240 (97%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQ NIYQDERPF+S++KVL+D+GPP+SKE+QLVSFH+VSKGY+GECGQRG
Sbjct  242  ENLVLLGDEVYQTNIYQDERPFISAKKVLMDIGPPLSKEVQLVSFHSVSKGYFGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NPPKPGDISYD+FVRE KG+LE
Sbjct  302  GYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINPPKPGDISYDRFVRESKGVLE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ETA+  GKA DVYYCLKLL
Sbjct  362  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALETAKQAGKAADVYYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFND+FM+QY+DHRGYSR+
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDDFMEQYDDHRGYSRL  481



>ref|XP_009406515.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406516.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   448 bits (1152),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 209/241 (87%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RK+LLDMGPP+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNIYQDERPFISARKILLDMGPPMSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIP ++V+EIYKVAS+SLSPNVPGQIF+GLMVNP KPGDISY +FV E   IL
Sbjct  301  GGYFEMTNIPAKTVDEIYKVASVSLSPNVPGQIFMGLMVNPLKPGDISYLRFVAESTAIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GKAPDV+YCLKL
Sbjct  361  ESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKSAGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYED+RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDEFMEQYEDYRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|KHG15331.1| Glutamate--glyoxylate aminotransferase 2 -like protein [Gossypium 
arboreum]
Length=481

 Score =   447 bits (1151),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 209/241 (87%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KPGD+SYDQ+VRE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI LPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIHLPPKAIEAAKQAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+  +SR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNHSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|KJB31170.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31171.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31172.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
 gb|KJB31173.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=481

 Score =   447 bits (1150),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 209/241 (87%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KPGD+SYDQFVRE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+   SR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNRSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|KJB31175.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=495

 Score =   447 bits (1150),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 209/241 (87%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++QLVSFHTVSKGYWGECGQR
Sbjct  255  QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDVQLVSFHTVSKGYWGECGQR  314

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KPGD+SYDQFVRE KGIL
Sbjct  315  GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGIL  374

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIE A+  GK PDV+YCLKL
Sbjct  375  ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQLRLPPKAIEAAKQAGKVPDVFYCLKL  434

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM QYED+   SR
Sbjct  435  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMAQYEDNWNRSR  494

Query  43   M  41
            M
Sbjct  495  M  495



>ref|XP_010927963.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Elaeis guineensis]
Length=481

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 208/241 (86%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RK+L DMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNIYQDERPFISARKILFDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPKPGDIS+ +FV E K +L
Sbjct  301  GGYFEMTNLPPQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKPGDISHLKFVVESKAVL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE A+ +GKAPDV+YCLKL
Sbjct  361  ESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEAAKKVGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM SFKKFNDEFM+QYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMASFKKFNDEFMEQYEDCRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_009413361.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009413362.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Musa 
acuminata subsp. malaccensis]
Length=481

 Score =   446 bits (1146),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 207/241 (86%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            REN VLL DEVYQQNIYQDERPF+S+RK+LLDMGPPIS E+QLVSFHTVSKGYWGECGQR
Sbjct  241  RENIVLLADEVYQQNIYQDERPFISARKILLDMGPPISTEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPKPGDISY +F  E   IL
Sbjct  301  GGYFEMTNLPAKTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKPGDISYLRFAAESNAIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GKAPDV+YCLKL
Sbjct  361  ESLKRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            +EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFNDEFM+QYED+RGYSR
Sbjct  421  VEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDEFMEQYEDYRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_003519649.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
2 [Glycine max]
 gb|KHN00386.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   444 bits (1143),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQ NIYQDERPF+SSRKVL+++GPPISKE+QL+SFH+VSKGY+GECGQR
Sbjct  241  QENLALLGDEVYQTNIYQDERPFISSRKVLMELGPPISKEVQLISFHSVSKGYYGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NPP+PGDISYD+FVRE  GIL
Sbjct  301  GGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLNPPQPGDISYDKFVRESTGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK PDVYYCLKL
Sbjct  361  ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKVPDVYYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+QYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKFNDEFMEQYEDDRGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_010552672.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Tarenaya 
hassleriana]
Length=481

 Score =   444 bits (1142),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 227/240 (95%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+GDEVYQQNIYQDERPF+SS+KVL+DMGPP+S+E+QL+SFHTVSKGYWGECGQRG
Sbjct  242  EKLVLMGDEVYQQNIYQDERPFISSKKVLMDMGPPVSREVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNVP QIF+GLMV+PP PGDISY+QF+RE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVPAQIFMGLMVSPPNPGDISYEQFIRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP RAIE A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPARAIEAARQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYED+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYEDNFGYSRM  481



>emb|CDY61225.1| BnaC06g43710D [Brassica napus]
Length=481

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>ref|XP_009105727.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Brassica rapa]
Length=481

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  481



>ref|NP_001237567.1| alanine aminotransferase 2 [Glycine max]
 gb|ABW17197.1| alanine aminotransferase 2 [Glycine max]
Length=481

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/241 (85%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+QL+SFH+VSKGY+GECGQR
Sbjct  241  QENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEVQLISFHSVSKGYYGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+PGDISYD+FVRE  GIL
Sbjct  301  GGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQPGDISYDKFVRESTGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK PDVYYCLKL
Sbjct  361  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKVPDVYYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM+SFKKFNDEFM+QYED RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPDIMDSFKKFNDEFMEQYEDDRGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_009105726.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Brassica rapa]
Length=509

 Score =   444 bits (1142),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 226/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+QL+SFHTVSKGYWGECGQRG
Sbjct  270  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEVQLISFHTVSKGYWGECGQRG  329

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  330  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  389

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  390  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  449

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFNDEFM QY D+ GYSRM
Sbjct  450  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNDEFMSQYGDNFGYSRM  509



>ref|XP_007158412.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
 gb|ESW30406.1| hypothetical protein PHAVU_002G150800g [Phaseolus vulgaris]
Length=481

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 205/241 (85%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+SS+KVL+D+GPPISKE+QL+SFH+VSKGY+GECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISSKKVLMDLGPPISKEVQLISFHSVSKGYYGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M+NP KPGDISYDQFVRE  GIL
Sbjct  301  GGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMINPLKPGDISYDQFVRESNGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK  DV+YCLKL
Sbjct  361  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKQAGKVADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFK FNDEFM+QYED+RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKNFNDEFMEQYEDNRGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_008789746.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
 ref|XP_008789747.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Phoenix 
dactylifera]
Length=481

 Score =   443 bits (1140),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/241 (86%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RK+L DMGPP+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNIYQDERPFVSARKILFDMGPPMSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+P ++V+EIYKVASISLSPNVPGQIFLGLMVNPPKPGDISY +FV+E K +L
Sbjct  301  GGYFEMTNLPSQTVDEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYLKFVQESKAVL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GKAPDV+YCL L
Sbjct  361  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAARKAGKAPDVFYCLGL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KFNDEFM+QYE+ RGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFRKFNDEFMEQYENCRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_011071137.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Sesamum 
indicum]
Length=481

 Score =   443 bits (1139),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = -3

Query  757  NXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGG  578
            N VLLGDEVYQQNIYQDERPF+S+RKVL+DMGPPISKE+QLVSFHTVSKGYWGECGQRGG
Sbjct  243  NLVLLGDEVYQQNIYQDERPFISARKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQRGG  302

Query  577  YFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILES  398
            YFEMTNI P++VEEIYKVASISLSPNVPGQIF+GLMV+PPKPGDISY+++VRE KGILES
Sbjct  303  YFEMTNISPQTVEEIYKVASISLSPNVPGQIFMGLMVSPPKPGDISYERYVRESKGILES  362

Query  397  LRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLE  218
            LR+RARIMTDGFN CRNVVCNFTEGAMYSFPQIRLP + +E A+  GK  DV+YCLKLLE
Sbjct  363  LRRRARIMTDGFNCCRNVVCNFTEGAMYSFPQIRLPLKVMEAAKRAGKVADVFYCLKLLE  422

Query  217  ATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            ATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFNDEFM+QYED+ GYSRM
Sbjct  423  ATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMASFKKFNDEFMEQYEDNGGYSRM  481



>ref|XP_004489787.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X2 [Cicer arietinum]
Length=481

 Score =   442 bits (1137),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 229/240 (95%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQ NIYQDERPF+SS+KVL+D+GPP+SKE+QLVSFH+VSKGY+GECGQRG
Sbjct  242  ENLVLLGDEVYQTNIYQDERPFISSKKVLMDIGPPLSKEVQLVSFHSVSKGYYGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISY+Q++RE KGIL 
Sbjct  302  GYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYEQYLRESKGILG  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ETA+  GKAPDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALETAKQAGKAPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MPAIM+SFKKFND+FM+QYEDHRGYSR+
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDDFMEQYEDHRGYSRL  481



>gb|KHN14541.1| Glutamate--glyoxylate aminotransferase 2 [Glycine soja]
Length=481

 Score =   441 bits (1134),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 203/241 (84%), Positives = 229/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+QL+SFH+VSKGY+GECGQR
Sbjct  241  QENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEVQLISFHSVSKGYYGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+PGDISYD+FVRE  GIL
Sbjct  301  GGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQPGDISYDKFVRESTGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKFNDEFM+QYED+RGYSR
Sbjct  421  LEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKFNDEFMEQYEDNRGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_006300456.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
 gb|EOA33354.1| hypothetical protein CARUB_v10020212mg [Capsella rubella]
Length=481

 Score =   441 bits (1134),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D  GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYGDSFGYSRM  481



>ref|XP_010682426.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682427.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=481

 Score =   441 bits (1134),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/241 (86%), Positives = 226/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQQNIYQDERPF+S+RKVL++MG P+SKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QEKLVLLADEVYQQNIYQDERPFISARKVLMNMGLPMSKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIP  SV+EIYK+ASI+LSPNVPGQIFLGLMVNPPKPGDISY ++ +E KGIL
Sbjct  301  GGYFEMTNIPQESVDEIYKIASIALSPNVPGQIFLGLMVNPPKPGDISYLRYEQESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQICLPPKAIEDAKKAGKHPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFH+RTTILPAEEDMPAIM+SFKKFND FM+QYEDHRGYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHMRTTILPAEEDMPAIMDSFKKFNDAFMEQYEDHRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_010928898.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
 ref|XP_010928907.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Elaeis 
guineensis]
Length=481

 Score =   441 bits (1133),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 205/241 (85%), Positives = 226/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RK+L DMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNIYQDERPFVSARKILFDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+P ++V+EIYKVAS+SLSPNVPGQIFLGLMVNPPK GDISY + V+E K +L
Sbjct  301  GGYFEMTNLPSQTVDEIYKVASVSLSPNVPGQIFLGLMVNPPKAGDISYLKLVQESKAVL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP +AIE A+  GKAPDV+YCLKL
Sbjct  361  ESLRRRAHIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPLKAIEAARKAGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGI+TVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SF+KFNDEFM+QYED+RGYSR
Sbjct  421  LEATGIATVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFRKFNDEFMEQYEDYRGYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_007044762.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044763.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 ref|XP_007044764.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00594.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00595.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
 gb|EOY00596.1| Alanine-2-oxoglutarate aminotransferase 2 isoform 1 [Theobroma 
cacao]
Length=481

 Score =   440 bits (1132),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/241 (85%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDE PF+S+RKVL+DMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDEHPFISARKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK++SISLSPNVP QIF+GLMVNP KPGDISY+Q+VRE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKISSISLSPNVPAQIFMGLMVNPLKPGDISYEQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP+A+E A+  GK PDV+YCLKL
Sbjct  361  DSLRRRAWIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPKAVEAAKKAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFNDEFM+QYED+  +SR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMSSFKKFNDEFMEQYEDNWSHSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>ref|XP_002315675.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
 gb|EEF01846.1| hypothetical protein POPTR_0010s05530g [Populus trichocarpa]
Length=481

 Score =   440 bits (1131),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 202/241 (84%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+SSRKVL+ MGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISSRKVLMGMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP KPG+ISY+QF+RE KGI+
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKPGNISYEQFIRESKGII  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+QY+D  GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQYDDRSGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>gb|AAM61453.1| putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   440 bits (1131),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|NP_177215.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_974122.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031262.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 ref|NP_001031263.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9S7E9.1|GGT2_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 2; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT2; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT2; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis 
thaliana]
 gb|AAG52344.1|AC011663_23 putative alanine aminotransferase; 91367-88744 [Arabidopsis thaliana]
 gb|AAG52480.1|AC010796_19 putative alanine aminotransferase; 63135-65758 [Arabidopsis thaliana]
 gb|AAN62333.1|AF479640_1 glutamate:glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AAK59635.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AAL34156.1| putative alanine aminotransferase [Arabidopsis thaliana]
 dbj|BAH19506.1| AT1G70580 [Arabidopsis thaliana]
 gb|AEE35082.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35083.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35084.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35085.1| glutamate--glyoxylate aminotransferase 2 [Arabidopsis thaliana]
Length=481

 Score =   439 bits (1130),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>ref|NP_001237581.1| alanine aminotransferase 3 [Glycine max]
 gb|ABW17198.1| alanine aminotransferase 3 [Glycine max]
Length=480

 Score =   439 bits (1130),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 202/241 (84%), Positives = 228/241 (95%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQ NIYQDERPF+SSRKVL+D+GPPISKE+QL+SFH+VSKGY+GECGQR
Sbjct  240  QENLALLGDEVYQTNIYQDERPFISSRKVLMDLGPPISKEVQLISFHSVSKGYYGECGQR  299

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V+EIYKVASISLSPNVP QIF+G+M++PP+PGDISYD+FVRE  GIL
Sbjct  300  GGYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGVMLHPPQPGDISYDKFVRESTGIL  359

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRA+E A+   K PDV+YCLKL
Sbjct  360  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRALEAAKQAAKVPDVFYCLKL  419

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQ+EGVFHLRTTILP EEDMPAIM+SFKKFNDEFM+QYED+RGYSR
Sbjct  420  LEATGISTVPGSGFGQREGVFHLRTTILPDEEDMPAIMDSFKKFNDEFMEQYEDNRGYSR  479

Query  43   M  41
            +
Sbjct  480  L  480



>gb|KGN51767.1| hypothetical protein Csa_5G598750 [Cucumis sativus]
Length=474

 Score =   439 bits (1129),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 205/232 (88%), Positives = 220/232 (95%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQN+YQDERPF+SSRKVLLDMGPPIS ELQL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNVYQDERPFISSRKVLLDMGPPISNELQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPPR+V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISYDQ++ E KGIL
Sbjct  301  GGYFEMTNIPPRTVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQYISESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAIE A+ LGK PDV YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIEAAKQLGKVPDVLYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP IM SFKKFND FM++Y
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPEIMTSFKKFNDAFMEEY  472



>ref|XP_011014669.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X1 
[Populus euphratica]
 ref|XP_011014670.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 isoform X2 
[Populus euphratica]
Length=481

 Score =   439 bits (1129),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 227/241 (94%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+S+RKVL+ MGPP+SKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISARKVLMGMGPPMSKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVAS+SLSPNVP QIF+GLMVNP KPGDISY+QF+RE KGI+
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKPGDISYEQFIRESKGII  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKL
Sbjct  361  ESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIRLPPKAIEAAKKAGKVPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFN+EFM+QY+D  GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNNEFMEQYDDRSGYSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>dbj|BAJ90574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   431 bits (1108),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 197/235 (84%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+QL+SFHTVSKGYWGECGQR
Sbjct  58   QEKLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREVQLISFHTVSKGYWGECGQR  117

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY ++  E K IL
Sbjct  118  GGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKYSAESKSIL  177

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GK PDVYYCLKL
Sbjct  178  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKEPDVYYCLKL  237

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+DH
Sbjct  238  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDQYQDH  292



>dbj|BAH20108.1| AT1G70580 [Arabidopsis thaliana]
Length=481

 Score =   438 bits (1126),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 225/240 (94%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEI+KVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIHKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYADNFGYSRM  481



>emb|CDY66294.1| BnaAnng22050D [Brassica napus]
Length=481

 Score =   436 bits (1122),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P+SKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPLSKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPK GDISYDQFVRE +GILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKSGDISYDQFVRESEGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN EFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMESFKKFNHEFMSQYGDNFGYSRM  481



>emb|CDY25780.1| BnaA07g10020D [Brassica napus]
Length=403

 Score =   433 bits (1113),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  164  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  223

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  224  GYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFTRESKGILE  283

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLL
Sbjct  284  SLRRRANIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLL  343

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            E TGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  344  ETTGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  403



>ref|XP_006390865.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390866.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390867.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 ref|XP_006390868.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28151.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28152.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28153.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
 gb|ESQ28154.1| hypothetical protein EUTSA_v10018474mg [Eutrema salsugineum]
Length=481

 Score =   436 bits (1120),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 223/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+ VLLGDEVYQQNIYQDE PF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ESLVLLGDEVYQQNIYQDEHPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+ EEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTAEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFNDEFM QY D+ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMGSFKKFNDEFMSQYGDNFGYSRM  481



>ref|XP_009624740.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009625366.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   435 bits (1119),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 204/233 (88%), Positives = 220/233 (94%), Gaps = 0/233 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDE PF+S+RKVL+DMGPPI+KELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDEHPFISARKVLMDMGPPITKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NPPKPGDISYDQFVRE KGIL
Sbjct  301  GGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANPPKPGDISYDQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA +MTDGFNSCRNVVCNFTEGAMYSFPQI+LP   I+ A+ LGK PDV+YC+KL
Sbjct  361  ESLRRRAHLMTDGFNSCRNVVCNFTEGAMYSFPQIQLPRGVIDAAKKLGKTPDVFYCIKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM+QYE
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMEQYE  473



>ref|XP_009759837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Nicotiana 
sylvestris]
Length=473

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 206/233 (88%), Positives = 219/233 (94%), Gaps = 0/233 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDE PF+S+RKVL+DM PPISKELQLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDEHPFISARKVLMDMDPPISKELQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGLM NPPKPGDISYDQFVRE KGIL
Sbjct  301  GGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLMANPPKPGDISYDQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA IMT GFNSCRNV+CNFTEGAMYSFPQI+LP  AI+ A+ LGKAPDV+YCLKL
Sbjct  361  ESLRRRAHIMTGGFNSCRNVLCNFTEGAMYSFPQIQLPRGAIDAAKKLGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMP+IM SFKKFND+FM QYE
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPSIMASFKKFNDDFMKQYE  473



>ref|XP_004228555.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
lycopersicum]
Length=473

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 204/232 (88%), Positives = 219/232 (94%), Gaps = 0/232 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQQNIYQDE PF+S+RKVL DMGPP+SKELQLVSFHTVSKGYWGECGQRG
Sbjct  242  ENLVLLGDEVYQQNIYQDEHPFISARKVLFDMGPPVSKELQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+ NPPKPGDISY+QF RE KGILE
Sbjct  302  GYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLLANPPKPGDISYEQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPPRAI+ A+ L KAPDV+YCLKLL
Sbjct  362  SLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPRAIDAAKKLEKAPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP+IM SFKKFNDEFM +YE
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPSIMASFKKFNDEFMARYE  473



>ref|XP_010427837.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Camelina 
sativa]
Length=479

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 224/240 (93%), Gaps = 2/240 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>ref|XP_009110107.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Brassica 
rapa]
Length=478

 Score =   434 bits (1117),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +QLVSFHTVSKGYWGECGQRG
Sbjct  239  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGVQLVSFHTVSKGYWGECGQRG  298

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  299  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  358

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GKAPDV+YCLKLL
Sbjct  359  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKAPDVFYCLKLL  418

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  419  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYENGFGYSRM  478



>gb|EMS58349.1| Alanine aminotransferase 2 [Triticum urartu]
Length=478

 Score =   434 bits (1115),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 221/235 (94%), Gaps = 0/235 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+QL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREVQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY ++  E K IL
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKYSAESKSIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GKAPDVYYCLKL
Sbjct  361  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKAPDVYYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+QY+DH
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQYQDH  475



>ref|XP_006416099.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416100.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 ref|XP_006416101.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34452.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34453.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
 gb|ESQ34454.1| hypothetical protein EUTSA_v10007514mg [Eutrema salsugineum]
Length=478

 Score =   434 bits (1115),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 224/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+S++KVL+DMG P+SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  239  EKLVLLGDEVYQQNIYQDERPFISAKKVLMDMGLPLSKEVQLVSFHTVSKGYWGECGQRG  298

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  299  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFSRESKGILE  358

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLL
Sbjct  359  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLL  418

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  419  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  478



>ref|XP_009115544.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
 emb|CDY44130.1| BnaA09g31220D [Brassica napus]
 emb|CDY04729.1| BnaC05g18600D [Brassica napus]
Length=478

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  239  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  298

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  299  GYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  358

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP A++ A+  GK PDV+YCLKLL
Sbjct  359  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPGALQAAKQAGKVPDVFYCLKLL  418

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  419  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYENSFGYSRM  478



>ref|XP_010415743.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   433 bits (1114),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 224/240 (93%), Gaps = 2/240 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILE
Sbjct  302  GYFEMTNIPPKTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY    GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQY--GVGYSRM  479



>emb|CDX91708.1| BnaC08g06270D [Brassica napus]
Length=403

 Score =   431 bits (1107),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +QLVSFHTVSKGYWGECGQRG
Sbjct  164  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGVQLVSFHTVSKGYWGECGQRG  223

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  224  GYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  283

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLL
Sbjct  284  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLL  343

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QYE+  GYSRM
Sbjct  344  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYENGFGYSRM  403



>ref|XP_006307377.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
 gb|EOA40275.1| hypothetical protein CARUB_v10009003mg [Capsella rubella]
Length=481

 Score =   433 bits (1114),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>gb|AAK68842.1| alanine aminotransferase-like protein [Arabidopsis thaliana]
Length=379

 Score =   429 bits (1103),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  140  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRG  199

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  200  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILE  259

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  260  SLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLL  319

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  320  EATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  379



>ref|NP_001058716.1| Os07g0108300 [Oryza sativa Japonica Group]
 dbj|BAD30627.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF20630.1| Os07g0108300 [Oryza sativa Japonica Group]
 gb|EAZ02507.1| hypothetical protein OsI_24612 [Oryza sativa Indica Group]
 gb|EAZ38438.1| hypothetical protein OsJ_22816 [Oryza sativa Japonica Group]
 dbj|BAG90568.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   433 bits (1113),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 204/241 (85%), Positives = 223/241 (93%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  248  HENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGYWGECGQR  307

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY +F  E K IL
Sbjct  308  GGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFSAESKSIL  367

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+YCLKL
Sbjct  368  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVFYCLKL  427

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+   GYSR
Sbjct  428  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD---GYSR  484

Query  43   M  41
            M
Sbjct  485  M  485



>gb|AAO84040.1| alanine aminotransferase [Oryza sativa Indica Group]
Length=484

 Score =   432 bits (1112),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 204/241 (85%), Positives = 223/241 (93%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  247  HENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGYWGECGQR  306

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY +F  E K IL
Sbjct  307  GGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFSAESKSIL  366

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AI+ A+  GKA DV+YCLKL
Sbjct  367  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAADVFYCLKL  426

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMDQY+   GYSR
Sbjct  427  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD---GYSR  483

Query  43   M  41
            M
Sbjct  484  M  484



>ref|XP_010498838.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498839.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
 ref|XP_010498840.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   432 bits (1111),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFTRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNTVGYSRM  481



>ref|XP_010477627.1| PREDICTED: glutamate--glyoxylate aminotransferase 1 [Camelina 
sativa]
Length=481

 Score =   432 bits (1111),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NV CNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRAKIMTDGFNSCKNVACNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>ref|XP_010460118.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=481

 Score =   432 bits (1110),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND+FM QY+++ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDDFMTQYDNNFGYSRM  481



>emb|CDY41452.1| BnaA08g20540D [Brassica napus]
Length=478

 Score =   431 bits (1109),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SK +QLVSFHTVSKGYWGECGQRG
Sbjct  239  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKGVQLVSFHTVSKGYWGECGQRG  298

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQF RE KGILE
Sbjct  299  GYFEMTNIPPRVVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFARESKGILE  358

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP A++ A+  GK PDV+YCLKLL
Sbjct  359  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGALQAAKQAGKVPDVFYCLKLL  418

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY++  GYSRM
Sbjct  419  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMAQYDNGFGYSRM  478



>tpg|DAA59363.1| TPA: putative MATE efflux family protein isoform 1 [Zea mays]
 tpg|DAA59364.1| TPA: putative MATE efflux family protein isoform 2 [Zea mays]
Length=399

 Score =   427 bits (1099),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 220/241 (91%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQNIYQDERPF+S+RKV+ DMGPPIS ELQ+VSFHTVSKGYWGECGQR
Sbjct  162  HENLVLLADEVYQQNIYQDERPFISARKVMFDMGPPISSELQVVSFHTVSKGYWGECGQR  221

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKPGDISY +F  E K I 
Sbjct  222  GGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIH  281

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+YCLKL
Sbjct  282  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVFYCLKL  341

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE   GYSR
Sbjct  342  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE---GYSR  398

Query  43   M  41
            +
Sbjct  399  L  399



>ref|XP_010471056.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Camelina 
sativa]
Length=479

 Score =   431 bits (1107),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 203/240 (85%), Positives = 223/240 (93%), Gaps = 2/240 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISY QFVRE KGILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYAQFVRESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND+FM QY    GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDDFMSQY--GVGYSRM  479



>ref|XP_003557680.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Brachypodium 
distachyon]
Length=479

 Score =   430 bits (1106),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 224/241 (93%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RKVL DMGPPIS+E+QL+SFHTVSKGYWGECGQR
Sbjct  242  QENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPISREVQLISFHTVSKGYWGECGQR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLM+NPPKPGDISY +F  E K IL
Sbjct  302  GGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMMNPPKPGDISYLKFATESKSIL  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQIRLP RAI+TA+  GK PDV+YCLKL
Sbjct  362  DSLRRRAQIMTDGFNSCQNVVCNFTEGAMYSFPQIRLPKRAIDTAKSAGKEPDVFYCLKL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FM+QY+D   YSR
Sbjct  422  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMEQYQD---YSR  478

Query  43   M  41
            +
Sbjct  479  L  479



>ref|XP_002893277.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH69536.1| alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis lyrata 
subsp. lyrata]
Length=481

 Score =   430 bits (1106),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SK +QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKGVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QI +GLMV+PPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQILMGLMVSPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQIRLPP AI+ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIRLPPGAIQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNVGYSRM  481



>gb|EPS68501.1| hypothetical protein M569_06265, partial [Genlisea aurea]
Length=481

 Score =   430 bits (1106),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -3

Query  757  NXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGG  578
            N VLL DEVYQQNIYQDERPF+S+RKVL+ +GPP+S ELQLVSFHTVSKGYWGECGQRGG
Sbjct  241  NLVLLADEVYQQNIYQDERPFISARKVLMGIGPPMSNELQLVSFHTVSKGYWGECGQRGG  300

Query  577  YFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILES  398
            YFEMTNI P +V+EIYKV+SI+LSPNVP QIF+GLMVNPPKPGDISYD+F+ E KGILES
Sbjct  301  YFEMTNISPETVDEIYKVSSIALSPNVPAQIFMGLMVNPPKPGDISYDKFITESKGILES  360

Query  397  LRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLE  218
            LR+RARIMTDGFNSCRN+VCNFTEGAMYSFPQI+LP RAIE A   GK PDV+YCLKLLE
Sbjct  361  LRRRARIMTDGFNSCRNIVCNFTEGAMYSFPQIQLPARAIEAANRAGKVPDVFYCLKLLE  420

Query  217  ATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED--HRGYSR  44
            ATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM SFKKFND+FMDQYE+  H+ YSR
Sbjct  421  ATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMASFKKFNDDFMDQYEEDHHKAYSR  480

Query  43   M  41
            M
Sbjct  481  M  481



>gb|AAL24255.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAO11559.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
Length=481

 Score =   430 bits (1106),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|NP_564192.2| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q9LR30.1|GGT1_ARATH RecName: Full=Glutamate--glyoxylate aminotransferase 1; Short=AtGGT2; 
AltName: Full=Alanine aminotransferase GGT1; AltName: 
Full=Alanine--glyoxylate aminotransferase GGT1; AltName: 
Full=Alanine-2-oxoglutarate aminotransferase 1 [Arabidopsis 
thaliana]
 gb|AAF87015.1|AC005292_24 F26F24.16 [Arabidopsis thaliana]
 gb|AAN62332.1|AF479639_1 glutamate:glyoxylate aminotransferase 1 [Arabidopsis thaliana]
 gb|AAL08235.1| At1g23310/F26F24_4 [Arabidopsis thaliana]
 gb|AAN12918.1| putative alanine aminotransferase [Arabidopsis thaliana]
 gb|AEE30370.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   430 bits (1105),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_004955317.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X2 [Setaria italica]
Length=478

 Score =   430 bits (1105),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 221/241 (92%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQN+YQDERPF+S++KVL DMGPP+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  241  HENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKPGDISY +F  E K IL
Sbjct  301  GGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GKAPDV+YCLKL
Sbjct  361  DSLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAAKRAGKAPDVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFK FND FM QYE   GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKNFNDSFMAQYE---GYSR  477

Query  43   M  41
            M
Sbjct  478  M  478



>ref|XP_006658210.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Oryza 
brachyantha]
Length=494

 Score =   430 bits (1105),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 223/244 (91%), Gaps = 3/244 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQNIYQDERPF+S+RKVL DMGPP+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  251  QENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGYWGECGQR  310

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY +F  E K IL
Sbjct  311  GGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFAAESKAIL  370

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLP RAI+ A   GKA DV+YCLKL
Sbjct  371  ESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAIDAANRAGKAADVFYCLKL  430

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRG---  53
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFND FMD+Y+ + G   
Sbjct  431  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMSSFKKFNDSFMDEYDGYGGGSS  490

Query  52   YSRM  41
            YSRM
Sbjct  491  YSRM  494



>ref|XP_009103182.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Brassica 
rapa]
Length=478

 Score =   429 bits (1103),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 219/240 (91%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  239  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  298

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  299  GYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFTRESKGILE  358

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+NVVCNFTEGAMYSFPQI LPP A++ A+  GK PDV+YCLKLL
Sbjct  359  SLRRRAKIMTDGFNSCKNVVCNFTEGAMYSFPQILLPPGALQAAKQAGKVPDVFYCLKLL  418

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EA GISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFND FM QY+++ GYSRM
Sbjct  419  EAAGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDAFMTQYDNNFGYSRM  478



>ref|XP_002887312.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63571.1| alanine-2-oxoglutarate aminotransferase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=482

 Score =   429 bits (1103),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 203/241 (84%), Positives = 223/241 (93%), Gaps = 1/241 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG PISKE+QL+SFHTVSKGYWGECGQRG
Sbjct  242  ERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPPR+VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDIS+DQFV E K ILE
Sbjct  302  GYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISHDQFVCESKRILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQI+LP +AIE A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIEAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR-GYSR  44
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY D+  GYSR
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYGDNNFGYSR  481

Query  43   M  41
            M
Sbjct  482  M  482



>ref|NP_001151209.1| alanine aminotransferase 2 [Zea mays]
 gb|ACG41981.1| alanine aminotransferase 2 [Zea mays]
Length=478

 Score =   427 bits (1099),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 220/241 (91%), Gaps = 3/241 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQNIYQDERPF+S+RKV+ DMGPPIS ELQ+VSFHTVSKGYWGECGQR
Sbjct  241  HENLVLLADEVYQQNIYQDERPFISARKVMFDMGPPISSELQVVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKPGDISY +F  E K I 
Sbjct  301  GGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIH  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIE A+  GK+ DV+YCLKL
Sbjct  361  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIEAARRAGKSADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEED PAIM SFKKFND FM+QYE   GYSR
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPAIMSSFKKFNDSFMEQYE---GYSR  477

Query  43   M  41
            +
Sbjct  478  L  478



>emb|CDY12474.1| BnaC07g13140D [Brassica napus]
Length=537

 Score =   429 bits (1104),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL+DMG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  298  EKLVLLGDEVYQQNIYQDERPFISSKKVLMDMGSPFSKEVQLVSFHTVSKGYWGECGQRG  357

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN PPR VEEIYKVASI+LSPNV  QIF+GLMV+ PKPGDISYDQF RE KGILE
Sbjct  358  GYFEMTNFPPRVVEEIYKVASIALSPNVSAQIFMGLMVSSPKPGDISYDQFTRESKGILE  417

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA+IMTDGFNSC+N VCNFTEGAMYSFPQI+LPP A++ A+  GK PDV+YCLKLL
Sbjct  418  SLRRRAKIMTDGFNSCKNAVCNFTEGAMYSFPQIQLPPGALQAAKQAGKVPDVFYCLKLL  477

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEE+MP IM+SFKKFNDEFM QY+++ GYSRM
Sbjct  478  EATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMTQYDNNFGYSRM  537



>ref|XP_008444367.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=473

 Score =   427 bits (1098),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 197/232 (85%), Positives = 220/232 (95%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+SS+KVL+DMGPPISKELQL+SFHTVSKGYWGECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKELQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNPPKPGD+SY+Q+ RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPPKPGDVSYEQYHRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK  DV+YCLKL
Sbjct  361  ESLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP IM SF+KFNDEFM+QY
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPGIMASFRKFNDEFMEQY  472



>ref|XP_006840828.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
 gb|ERN02503.1| hypothetical protein AMTR_s00083p00031040 [Amborella trichopoda]
Length=481

 Score =   427 bits (1098),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 220/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN  LL DEVYQQNIYQDERPF+S++K+L++MG PIS E+QLVS+HTVSKGYWGECGQRG
Sbjct  242  ENLALLADEVYQQNIYQDERPFVSAKKILMEMGLPISMEVQLVSYHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+ P +V+E+YK++SISLSPNVP QIF+GLMVNPPKPGDIS+ +F  E K ILE
Sbjct  302  GYFEMTNLSPETVDEMYKISSISLSPNVPAQIFMGLMVNPPKPGDISFMRFAAESKEILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPP+AIE A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIEAAKRAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAE+DMP IM SFKKFNDEFM+QYE HRGYSRM
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEQDMPEIMASFKKFNDEFMEQYEHHRGYSRM  481



>tpg|DAA42658.1| TPA: LOW QUALITY PROTEIN: alanine aminotransferase 2 [Zea mays]
Length=479

 Score =   426 bits (1095),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 3/240 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+QLVSFHTVSKGYWGECGQRG
Sbjct  243  ENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREVQLVSFHTVSKGYWGECGQRG  302

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKPGDISY +F  E K ILE
Sbjct  303  GYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKPGDISYPKFTAESKSILE  362

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+YCLKLL
Sbjct  363  SLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVFYCLKLL  422

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND FM+QYE   GYSRM
Sbjct  423  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|NP_001183048.1| uncharacterized protein LOC100501386 [Zea mays]
 gb|ACR35540.1| unknown [Zea mays]
Length=479

 Score =   426 bits (1094),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 200/240 (83%), Positives = 219/240 (91%), Gaps = 3/240 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+QLVSFHTVSKGYWGECGQRG
Sbjct  243  ENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREVQLVSFHTVSKGYWGECGQRG  302

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKPGDISY +F  E K ILE
Sbjct  303  GYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKPGDISYPKFTAESKSILE  362

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+YCLKLL
Sbjct  363  SLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVFYCLKLL  422

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND FM+QYE   GYSRM
Sbjct  423  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSFMEQYE---GYSRM  479



>ref|XP_004142968.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 ref|XP_004161062.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Cucumis 
sativus]
 gb|KGN62316.1| hypothetical protein Csa_2G349020 [Cucumis sativus]
Length=473

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 197/232 (85%), Positives = 220/232 (95%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN  LLGDEVYQQNIYQDERPF+SS+KVL+DMGPPISKELQL+SFHTVSKGYWGECGQR
Sbjct  241  QENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKELQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP Q+F+GLMVNP KPGD+SY+Q+ RE KGIL
Sbjct  301  GGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPLKPGDVSYEQYHRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RARIMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP+AIETA+  GK  DV+YCLKL
Sbjct  361  DSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGISTVPGSGFGQKEGVFHLRTTILP EE+MPAIM SFKKFNDEFM+QY
Sbjct  421  LEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKFNDEFMEQY  472



>gb|AAK25905.1|AF360195_1 putative alanine aminotransferase [Arabidopsis thaliana]
Length=481

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/240 (83%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVV NFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARLMTDGFNSCKNVVRNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATGISTVPGSGFGQKEGVFHLRTTILPAE++MP IM+SFKKFNDEFM QY+++ GYS+M
Sbjct  422  EATGISTVPGSGFGQKEGVFHLRTTILPAEDEMPEIMDSFKKFNDEFMTQYDNNFGYSKM  481



>ref|XP_008467047.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Cucumis melo]
Length=238

 Score =   416 bits (1068),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 193/214 (90%), Positives = 206/214 (96%), Gaps = 0/214 (0%)
 Frame = -3

Query  682  KVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSP  503
            +VLLDMGPPISKELQL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSP
Sbjct  25   QVLLDMGPPISKELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSP  84

Query  502  NVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMTDGFNSCRNVVCNFTEG  323
            NVP QIF+GLMVNPPKPGDISYDQF+RE KGILESLR+RARIMTDGFNSCRNV+CNFTEG
Sbjct  85   NVPAQIFMGLMVNPPKPGDISYDQFIRESKGILESLRRRARIMTDGFNSCRNVICNFTEG  144

Query  322  AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  143
            AMYSFPQIRLPP+AIE A+ LGK PDV+YCLKLLEATGISTVPGSGFGQKEGVFHLRTTI
Sbjct  145  AMYSFPQIRLPPKAIEAAKKLGKVPDVFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  204

Query  142  LPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            LPAEEDMP IM SFKKFND FM++YEDHRGYSRM
Sbjct  205  LPAEEDMPEIMASFKKFNDSFMEEYEDHRGYSRM  238



>ref|XP_006348507.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Solanum 
tuberosum]
Length=476

 Score =   423 bits (1088),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 215/235 (91%), Gaps = 3/235 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSS---RKVLLDMGPPISKELQLVSFHTVSKGYWGECG  590
            EN VLLGDEVYQQNIYQDE PF+S    R VL DMGPPISKELQLVSFHTVSKGYWGECG
Sbjct  242  ENLVLLGDEVYQQNIYQDEHPFISKGVYRSVLFDMGPPISKELQLVSFHTVSKGYWGECG  301

Query  589  QRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKG  410
            QRGGYFEMTNIPP+SVEEIYKVASISLSPNVP QIFLGL+ NPPKPGDISY+QF RE KG
Sbjct  302  QRGGYFEMTNIPPKSVEEIYKVASISLSPNVPAQIFLGLLANPPKPGDISYEQFARESKG  361

Query  409  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  230
            ILESLR+RA IMTDGFNSC+NVVCNFTEGAMYSFPQI+LPP AI+ A+ L KAPDV+YCL
Sbjct  362  ILESLRRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPGAIDAAKKLEKAPDVFYCL  421

Query  229  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            KLLEATGISTVPGSGFGQKEGVFHLRTTILP EE+MP+IM SFKKFNDEFM QYE
Sbjct  422  KLLEATGISTVPGSGFGQKEGVFHLRTTILPVEEEMPSIMASFKKFNDEFMAQYE  476



>ref|XP_010248614.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Nelumbo nucifera]
Length=338

 Score =   415 bits (1066),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 215/241 (89%), Gaps = 6/241 (2%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + N VLL DEVYQQNIYQDERPF+S +KVL+D+GPPISKE+QLVSFHTVSKGYWGECGQ 
Sbjct  104  QXNLVLLADEVYQQNIYQDERPFISVKKVLMDLGPPISKEVQLVSFHTVSKGYWGECGQX  163

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASISLSPNVP QIFL LMVNPPKPGDISY +F      I 
Sbjct  164  GGYFEMTNIPPKTVDEIYKVASISLSPNVPIQIFLSLMVNPPKPGDISYLKF------IT  217

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++RA IMTDGFNSC+NVVCNFTEGAMYSFPQ+RLPP+AIETA+  GK PDV+YCLKL
Sbjct  218  ESLKRRAHIMTDGFNSCKNVVCNFTEGAMYSFPQMRLPPKAIETAKRAGKVPDVFYCLKL  277

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGIS VPGSGFGQKE  FHL TTILPAEEDMPAIM SFKKFNDEFM+QY DHRGYS 
Sbjct  278  LEATGISMVPGSGFGQKEEAFHLMTTILPAEEDMPAIMASFKKFNDEFMEQYGDHRGYSW  337

Query  43   M  41
            M
Sbjct  338  M  338



>gb|ABK25444.1| unknown [Picea sitchensis]
 gb|ABR16321.1| unknown [Picea sitchensis]
 gb|ABR17158.1| unknown [Picea sitchensis]
 gb|ACN40300.1| unknown [Picea sitchensis]
Length=480

 Score =   413 bits (1062),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 193/240 (80%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLL DEVYQQNIYQDERPF+S++KVL+DMG P SKELQLVS+HTVSKGYWGECGQRG
Sbjct  242  ENLVLLADEVYQQNIYQDERPFVSAKKVLMDMGLPFSKELQLVSYHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP++V+EIYKVASISLSPNVPGQIFLGLMVNPPKP DISY +FV E K ILE
Sbjct  302  GYFEMTNIPPKTVDEIYKVASISLSPNVPGQIFLGLMVNPPKPADISYQRFVAESKAILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA +MTDGFN+CRNV+CNFTEGAMYSFPQI+LPP+AI  A+  GKAPDV+YCLKLL
Sbjct  362  SLRRRAHLMTDGFNNCRNVICNFTEGAMYSFPQIKLPPKAIAAAKEAGKAPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSRM  41
            EATG+STVPGSGFGQKEGVFHLRTTILP EE+MP IM  FK FND+FM +YE++  +SR+
Sbjct  422  EATGMSTVPGSGFGQKEGVFHLRTTILPPEEEMPEIMNVFKIFNDDFMAKYENY-SWSRL  480



>tpg|DAA42656.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
 tpg|DAA42657.1| TPA: hypothetical protein ZEAMMB73_648980 [Zea mays]
Length=483

 Score =   412 bits (1058),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 191/228 (84%), Positives = 209/228 (92%), Gaps = 0/228 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQN+YQDERPF+S+RKV+ DMGPPIS+E+QLVSFHTVSKGYWGECGQR
Sbjct  242  HENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPISREVQLVSFHTVSKGYWGECGQR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI LSPNVPGQIF+G+MVNPPKPGDISY +F  E K IL
Sbjct  302  GGYFEMTNLPPKTVDEIYKVASIVLSPNVPGQIFMGVMVNPPKPGDISYPKFTAESKSIL  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSCRNVVCNFTEGAMYSFPQI+LP RAIE A+  GKA DV+YCLKL
Sbjct  362  ESLRRRARMMTDGFNSCRNVVCNFTEGAMYSFPQIQLPARAIEAAKRAGKAADVFYCLKL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEF  80
            LEATGISTVPGSGFGQKEGVFHLRTTILPAEED P IM SFKKFND F
Sbjct  422  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDFPTIMSSFKKFNDSF  469



>ref|XP_011034252.1| PREDICTED: LOW QUALITY PROTEIN: glutamate--glyoxylate aminotransferase 
2 [Populus euphratica]
Length=382

 Score =   407 bits (1047),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 191/243 (79%), Positives = 218/243 (90%), Gaps = 3/243 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQN YQDERPF+S+RKVL+ MGPP+SKE+QL+SFHTVSKGYWGECGQR
Sbjct  141  QENLVLLGDEVYQQNTYQDERPFISARKVLMGMGPPVSKEVQLISFHTVSKGYWGECGQR  200

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP +V EIYKVAS+S+SPNVP QIF+GLMVNPPKPGD+SY+QF+RE KGIL
Sbjct  201  GGYFEMTNIPPETVVEIYKVASLSISPNVPAQIFMGLMVNPPKPGDVSYEQFIRESKGIL  260

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RAR+MTDGFNSC+NV+CNFTEGAMYSFPQI  PP+AI+ A+  GK PDV+YCLKL
Sbjct  261  ESLRRRARMMTDGFNSCKNVICNFTEGAMYSFPQIX-PPKAIDAAKRAGKVPDVFYCLKL  319

Query  223  LEATGISTVPGSGF--GQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGY  50
            LEATGISTVP  G    +   VFHLRTTILPAEEDMP IM+SFKKFNDEFM++YE H GY
Sbjct  320  LEATGISTVPQIGLIVIRSCRVFHLRTTILPAEEDMPEIMDSFKKFNDEFMERYEGHGGY  379

Query  49   SRM  41
            SR+
Sbjct  380  SRL  382



>gb|AFK42206.1| unknown [Lotus japonicus]
Length=305

 Score =   403 bits (1036),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 192/220 (87%), Positives = 205/220 (93%), Gaps = 0/220 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQ NIYQDERPF+SS+KVL+DMGPPISKE QLV FH+VSKGY+GECGQRG
Sbjct  86   ENLVLLGDEVYQTNIYQDERPFISSKKVLMDMGPPISKEQQLVCFHSVSKGYFGECGQRG  145

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISYDQFVRE KGILE
Sbjct  146  GYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYDQFVRESKGILE  205

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPPRAIE A+   KAPDVYYCLKLL
Sbjct  206  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPRAIEAAKQARKAPDVYYCLKLL  265

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESF  101
            EATGISTVPGSGFGQK+G FHLRTTILP EE+MPAIM  F
Sbjct  266  EATGISTVPGSGFGQKDGYFHLRTTILPLEEEMPAIMGEF  305



>ref|XP_008447004.1| PREDICTED: glutamate--glyoxylate aminotransferase 2 [Cucumis 
melo]
Length=334

 Score =   390 bits (1003),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -3

Query  682  KVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSP  503
            KVLLDMGPPIS ELQL+SFHTVSKGYWGECGQRGGYFEMTNIPPR+V+EIYKVASISLSP
Sbjct  128  KVLLDMGPPISNELQLISFHTVSKGYWGECGQRGGYFEMTNIPPRTVDEIYKVASISLSP  187

Query  502  NVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMTDGFNSCRNVVCNFTEG  323
            NVP QIF+GLMVNPPKPGD SYDQ++ E KGILESLR+RARIMTDGFNSC+NVVCNFTEG
Sbjct  188  NVPAQIFMGLMVNPPKPGDFSYDQYISESKGILESLRRRARIMTDGFNSCKNVVCNFTEG  247

Query  322  AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  143
            AMYSFPQIRLPPRAIE+A+ LGK PDV YCLKLLEATGISTVPGSGFGQKEGVFHLRTTI
Sbjct  248  AMYSFPQIRLPPRAIESAKQLGKVPDVLYCLKLLEATGISTVPGSGFGQKEGVFHLRTTI  307

Query  142  LPAEEDMPAIMESFKKFNDEFMDQY  68
            LPAEEDMP IM SFKKFND FM++Y
Sbjct  308  LPAEEDMPEIMASFKKFNDAFMEEY  332



>ref|XP_003613140.1| Alanine aminotransferase [Medicago truncatula]
 gb|AES96098.1| glutamate-glyoxylate aminotransferase [Medicago truncatula]
Length=474

 Score =   370 bits (951),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 171/201 (85%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQ NIYQDERPF+S++KVL+D+GPP+SKE+QLVSFH+VSKGY+GECGQRG
Sbjct  242  ENLVLLGDEVYQTNIYQDERPFISAKKVLMDIGPPLSKEVQLVSFHSVSKGYFGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTNIPP +V+EIYKVASISLSPNVP QIF+GLM+NPPKPGDISYD+FVRE KG+LE
Sbjct  302  GYFEMTNIPPETVDEIYKVASISLSPNVPAQIFMGLMINPPKPGDISYDRFVRESKGVLE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI+LPP+A+ETA+  GKA DVYYCLKLL
Sbjct  362  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIKLPPKALETAKQAGKAADVYYCLKLL  421

Query  220  EATGISTVPGSGFGQKEGVFH  158
            EATGISTVPGSGFGQKEG  H
Sbjct  422  EATGISTVPGSGFGQKEGYVH  442



>ref|XP_001763950.1| predicted protein [Physcomitrella patens]
 gb|EDQ71354.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   368 bits (945),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 201/236 (85%), Gaps = 0/236 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE  VL+ DEVYQQN+YQDERPF+S+RKVL+ MGP  S  L+LVSFHTVSKG+ GECGQR
Sbjct  242  RERVVLMADEVYQQNVYQDERPFISARKVLMGMGPRYSSALELVSFHTVSKGFLGECGQR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN  P++VEE+YKVASI+LSPNV GQI +GLMV PP+PGD+S+  +  E   I+
Sbjct  302  GGYFEMTNFHPKTVEELYKVASIALSPNVTGQIMMGLMVKPPRPGDVSFPLYAAESAAIM  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  AI  A+  GKAPDV+YCL+L
Sbjct  362  QSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPKAAIAAARQAGKAPDVFYCLRL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            LEATGISTVPGSGFGQKEG FH+RTTILP+E+DMPAIMESFK FN +FM QY D +
Sbjct  422  LEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPAIMESFKMFNADFMAQYSDSK  477



>ref|XP_001782822.1| predicted protein [Physcomitrella patens]
 gb|EDQ52399.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   366 bits (940),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 175/236 (74%), Positives = 204/236 (86%), Gaps = 0/236 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQQN+YQDERPF+S+RKVL+ MGPP S+ L+LVSFHTVSKG+ GECGQR
Sbjct  242  QERIVLMADEVYQQNVYQDERPFISARKVLMGMGPPASEALELVSFHTVSKGFLGECGQR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN  P++V+E+YKV+SI+LSPNV GQI +GLMVNPPKPGDISY Q+  E K I 
Sbjct  302  GGYFEMTNFHPKTVDELYKVSSIALSPNVSGQIMMGLMVNPPKPGDISYPQYEAESKAIS  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SLRKRA IMTDGFN+C NVVCNFTEGAMYSFPQ++LP  A+  A+  GKAPDV+YCL+L
Sbjct  362  LSLRKRAHIMTDGFNACENVVCNFTEGAMYSFPQVKLPQAAVAAAKKAGKAPDVFYCLRL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            LEATGISTVPGSGFGQKEG FH+RTTILP+E+DMP IMESFKKFN +FM QY D +
Sbjct  422  LEATGISTVPGSGFGQKEGTFHVRTTILPSEKDMPGIMESFKKFNQDFMAQYADAK  477



>ref|XP_001777071.1| predicted protein [Physcomitrella patens]
 gb|EDQ58064.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/236 (73%), Positives = 204/236 (86%), Gaps = 0/236 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQQN+YQDERPF+S+RKVL+ MGPP+S+ L+LVSFHTVSKG+ GECGQR
Sbjct  242  KEKIVLMADEVYQQNVYQDERPFISARKVLMGMGPPVSEALELVSFHTVSKGFLGECGQR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNI P++V+E+YKV+SI+LSPNV GQI +GLMV+PPKPGDISY  +  E + I 
Sbjct  302  GGYFEMTNIHPKTVDELYKVSSIALSPNVTGQIMMGLMVSPPKPGDISYPLYKAESEAIS  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SLRKRA IMTDGFN+C N+VCNFTEGAMYSFPQ++LP  AI  A+  GKAPDV+YCL+L
Sbjct  362  LSLRKRAHIMTDGFNACENIVCNFTEGAMYSFPQVKLPQAAIAAAKKAGKAPDVFYCLRL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            LEATGISTVPGSGFGQKEG FH+RTTILP+E DMP IMESFKKFN +FM Q+ D +
Sbjct  422  LEATGISTVPGSGFGQKEGTFHVRTTILPSERDMPGIMESFKKFNADFMAQHSDTK  477



>ref|NP_001031083.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19579.1| AT1G23310 [Arabidopsis thaliana]
 gb|AEE30371.1| glutamate:glyoxylate aminotransferase [Arabidopsis thaliana]
Length=441

 Score =   360 bits (923),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 183/198 (92%), Gaps = 0/198 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLLGDEVYQQNIYQDERPF+SS+KVL++MG P SKE+QLVSFHTVSKGYWGECGQRG
Sbjct  242  EKLVLLGDEVYQQNIYQDERPFISSKKVLMEMGSPFSKEVQLVSFHTVSKGYWGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEMTN+PPR VEEIYKVASI+LSPNV  QIF+GLMVNPPKPGDISYDQF RE KGILE
Sbjct  302  GYFEMTNLPPRVVEEIYKVASIALSPNVSAQIFMGLMVNPPKPGDISYDQFARESKGILE  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RAR+MTDGFNSC+NVVCNFTEGAMYSFPQIRLP  A++ A+  GK PDV+YCLKLL
Sbjct  362  SLRRRARLMTDGFNSCKNVVCNFTEGAMYSFPQIRLPTGALQAAKQAGKVPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEG  167
            EATGISTVPGSGFGQKEG
Sbjct  422  EATGISTVPGSGFGQKEG  439



>gb|EMT29455.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=523

 Score =   362 bits (928),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/199 (83%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQQN+YQDERPF+S+RKV+ DMGPP+S+E+QL+SFHTVSKGYWGECGQR
Sbjct  241  QENLVLLADEVYQQNVYQDERPFISARKVMFDMGPPVSREVQLISFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYKVASI+LSPNVPGQIF+GLMVNPPKPGDISY ++  E K IL
Sbjct  301  GGYFEMTNIPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKYSAESKSIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+RA+IMTDGFNSCRNVVCNFTEGAMYSFPQIRLP RA++ A+  GKAPDVYYCLKL
Sbjct  361  ESLRRRAQIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPQRAMDVAKSAGKAPDVYYCLKL  420

Query  223  LEATGISTVPGSGFGQKEG  167
            LEATGISTVPGSGFGQKEG
Sbjct  421  LEATGISTVPGSGFGQKEG  439



>ref|XP_004489786.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   360 bits (924),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VLLGDEVYQ NIYQDERPF+SS+KVL+D+GPP+SKE+QLVSFH+VSKGY+GECGQRG
Sbjct  242  ENLVLLGDEVYQTNIYQDERPFISSKKVLMDIGPPLSKEVQLVSFHSVSKGYYGECGQRG  301

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFEM NI P +V+EIYKVASISLSPNVP QIF+GLMVNPPKPGDISY+Q++RE KGIL 
Sbjct  302  GYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYEQYLRESKGILG  361

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RARIMTDGFNSCRNVVCNFTEGAMYSFPQI LPP+A+ETA+  GKAPDV+YCLKLL
Sbjct  362  SLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALETAKQAGKAPDVFYCLKLL  421

Query  220  EATGISTVPGSGFGQKEG  167
            EATGISTVPGSGFGQKEG
Sbjct  422  EATGISTVPGSGFGQKEG  439



>ref|XP_002527918.1| alanine aminotransferase, putative [Ricinus communis]
 gb|EEF34475.1| alanine aminotransferase, putative [Ricinus communis]
Length=452

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 192/246 (78%), Gaps = 39/246 (16%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             E+ VLLGDEVYQQNIYQDERPF+SSRKVLLDMGPPISKE+QLVSFHTVSKGYWGECGQR
Sbjct  241  HEDLVLLGDEVYQQNIYQDERPFISSRKVLLDMGPPISKEVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIP ++V+EIYKVAS+SLSPNVP QIF+GLMVNP KPGDISY+Q+VRE KGIL
Sbjct  301  GGYFEMTNIPAKTVDEIYKVASVSLSPNVPAQIFMGLMVNPLKPGDISYEQYVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFP-----QIRLPPRAIETAQGLGKAPDVY  239
            ESLR+RARIMTDGFNSCRNVVCNFTEGAMYSF      +I    RA+             
Sbjct  361  ESLRRRARIMTDGFNSCRNVVCNFTEGAMYSFLXXSWFRIWTERRALPCR----------  410

Query  238  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
                                    VFHLRTTILPAEEDMPAIM SFKKFNDEFM++YEDH
Sbjct  411  ------------------------VFHLRTTILPAEEDMPAIMASFKKFNDEFMEEYEDH  446

Query  58   RGYSRM  41
            RGYSRM
Sbjct  447  RGYSRM  452



>ref|XP_002968244.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
 ref|XP_002976136.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ23041.1| hypothetical protein SELMODRAFT_267931 [Selaginella moellendorffii]
 gb|EFJ30498.1| hypothetical protein SELMODRAFT_145611 [Selaginella moellendorffii]
Length=481

 Score =   345 bits (884),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 199/241 (83%), Gaps = 0/241 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  +L+ DEVYQ N+YQDERPF+S++KVL+DMG P S  ++LVSFH+VSKG+ GECGQR
Sbjct  241  KERLLLMADEVYQVNVYQDERPFVSAKKVLMDMGAPYSNTVELVSFHSVSKGFLGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNI P++VEE+YKVASISLSPNV GQI +GLMV PP+P DISY Q+  E K I+
Sbjct  301  GGYFEMTNIHPQTVEELYKVASISLSPNVVGQIMMGLMVTPPRPFDISYPQYQAESKAII  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ES+R+RA IMTDGFN C +VVCNFTEGAMYSFP+I+L   A++ A   GKA DV+YCLKL
Sbjct  361  ESMRRRAHIMTDGFNKCEDVVCNFTEGAMYSFPRIKLSKAAMDAAAQAGKAADVFYCLKL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRGYSR  44
            LEATGISTVPGSGFGQKEG  HLRTTILP E+DMP IM  F+KF+ +FM QY D+   SR
Sbjct  421  LEATGISTVPGSGFGQKEGTLHLRTTILPLEQDMPGIMAKFQKFHADFMAQYSDYSVSSR  480

Query  43   M  41
            +
Sbjct  481  L  481



>ref|XP_005651940.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE27396.1| alanine aminotransferase [Coccomyxa subellipsoidea C-169]
Length=523

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 185/231 (80%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN VL+ DEVYQ NI+QDERPF+S +KV++DMG P S E +LVSFHT+SKG  GECG RG
Sbjct  293  ENIVLMADEVYQTNIFQDERPFVSCKKVMMDMGAPYS-EQELVSFHTISKGALGECGMRG  351

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            G  E TNI P +++++YK+ASI+LSPN  GQ  L LMVNPPK GD S++Q   E  GI+ 
Sbjct  352  GMLEATNIHPDTIDQLYKIASINLSPNTFGQAGLALMVNPPKEGDPSHEQHEAEAAGIIA  411

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            S+R+RAR+MTDGFN+C  + CN+TEGAMYSFP++ LPP+A++ A+  GKAPD +YCLKLL
Sbjct  412  SMRRRARMMTDGFNACEGITCNYTEGAMYSFPRLNLPPKALQAAKKAGKAPDTWYCLKLL  471

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            +ATG+ TVPGSGFGQ+EG FHLRTTILP E+ +  ++ SF+KF+  FMD+Y
Sbjct  472  DATGVLTVPGSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKFHASFMDEY  522



>ref|XP_002947519.1| alanine aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ51567.1| alanine aminotransferase [Volvox carteri f. nagariensis]
Length=522

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 185/231 (80%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    ++L+SFHTVSKG  GECG RG
Sbjct  291  ERIVLMADEVYQENVYQDERPFVSAKKVMYEMGEPYRSHVELLSFHTVSKGTAGECGLRG  350

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY EMTNI P ++EE+YK ASI+LSPN  GQI L  +VNPPKPGD SY+ + +E    L 
Sbjct  351  GYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSCLVNPPKPGDSSYEMYTKEKAAELA  410

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA ++TDGFNS   V CNFTEGAMYSFPQI+LPP+A+E A+  GKA DV+YCLKLL
Sbjct  411  SLRRRAHMVTDGFNSLDGVTCNFTEGAMYSFPQIKLPPKALEAAKAAGKAGDVFYCLKLL  470

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E+TGISTVPGSGFGQ++G FHLRTTILP EE M + +E F+KF+ +FM QY
Sbjct  471  ESTGISTVPGSGFGQEDGTFHLRTTILPREEVMSSFVEKFEKFHKDFMKQY  521



>ref|XP_001698518.1| alanine aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP08011.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 185/232 (80%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    ++L+SFHTVSKG  GECG R
Sbjct  289  QEKIVLMADEVYQENVYQDERPFVSAKKVMWEMGEPYRSHVELLSFHTVSKGTAGECGLR  348

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNPPKPGD SYDQ+ +E    L
Sbjct  349  GGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNPPKPGDPSYDQYTKEKASEL  408

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SLR+RA ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLKL
Sbjct  409  VSLRRRAHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLKL  468

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  469  LEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTHFVEKFDKFHKDFMKQY  520



>gb|AAB01685.1| alanine aminotransferase [Chlamydomonas reinhardtii]
Length=521

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 184/232 (79%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQ+N+YQDERPF+S++KV+ +MG P    ++L+SFHTVSKG  GECG R
Sbjct  289  QEKIVLMADEVYQENVYQDERPFVSAKKVMWEMGEPYRSHVELLSFHTVSKGTAGECGLR  348

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY EMTNI P ++EE+YK ASI+LSPN  GQI L ++VNPPKPGD SYDQ+ +E    L
Sbjct  349  GGYVEMTNIHPGAIEEVYKCASINLSPNTMGQIALSVLVNPPKPGDPSYDQYTKEKASEL  408

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SLR+R  ++TDGFN+   V CNFTEGAMYSFPQI+LP +A+E A+  GKA DV+YCLKL
Sbjct  409  VSLRRRRHMVTDGFNALDGVTCNFTEGAMYSFPQIKLPAKALEAAKAAGKAGDVFYCLKL  468

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGISTVPGSGFGQ+EG FHLRTTILP EE M   +E F KF+ +FM QY
Sbjct  469  LEATGISTVPGSGFGQEEGTFHLRTTILPREEVMTTFVEKFDKFHKDFMKQY  520



>ref|XP_009151206.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like [Brassica 
rapa]
Length=155

 Score =   285 bits (728),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = -3

Query  550  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMT  371
            ++VEEIYKVASI+LSPNV  QIF+GLMV+PPKPGDISYDQFVRE KGILESLR+RARIMT
Sbjct  2    QTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISYDQFVRESKGILESLRRRARIMT  61

Query  370  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  191
            DGFNSC+NVVCNFTEGAMYSFPQI+LPP+AI+ A+  GK PDV+YCLKLLEATGISTVPG
Sbjct  62   DGFNSCKNVVCNFTEGAMYSFPQIKLPPKAIQAAKQAGKVPDVFYCLKLLEATGISTVPG  121

Query  190  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  89
            SGFGQKEGVFHLRTTILPAEE+MP IMESFKKFN
Sbjct  122  SGFGQKEGVFHLRTTILPAEEEMPLIMESFKKFN  155



>gb|EWM24220.1| alanine-2-oxoglutarate aminotransferase 2 [Nannochloropsis gaditana]
Length=593

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 174/237 (73%), Gaps = 0/237 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +   VL+ DEVYQ NIYQ  RPF+S+R V L MG P ++ L+L +FHT SKG +GECG R
Sbjct  287  KHKLVLMADEVYQDNIYQTVRPFVSARHVALSMGSPYAQGLELATFHTASKGVYGECGFR  346

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GG  E+ N   R  +E+YK+ASI+LSPNVPGQ+ LGLMVN P+PGD SY Q+ RE + +L
Sbjct  347  GGVMELLNFDERVADELYKLASINLSPNVPGQVILGLMVNGPRPGDESYAQYAREKQDLL  406

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RAR +TD FNSC  +VC  TEGAMYSFP+I LPP A+  A+  GK+PDV+YCLKL
Sbjct  407  DSLRRRARAITDAFNSCEGIVCQETEGAMYSFPKITLPPAAMAAAKAAGKSPDVFYCLKL  466

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHRG  53
            LE TGISTVPGSGF Q++G FH RTTILP E     I++ F  F+  FM +Y+   G
Sbjct  467  LETTGISTVPGSGFKQRDGTFHFRTTILPPESKFQDIIQRFLAFHSAFMAEYKGSTG  523



>ref|XP_005847240.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
 gb|EFN55138.1| hypothetical protein CHLNCDRAFT_57929 [Chlorella variabilis]
Length=529

 Score =   279 bits (714),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 172/232 (74%), Gaps = 0/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQ NIYQDE+PF+S++KVL D+G PIS  ++L SFHTVSKG  GECG R
Sbjct  297  KEKVVLMADEVYQPNIYQDEKPFVSAKKVLGDLGKPISDSVELASFHTVSKGVLGECGLR  356

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+TN  P +V+E+YK  SI+LSPN  GQ+ + LMVNPPKPGD SY Q+  E    L
Sbjct  357  GGYVELTNFHPGTVDELYKAVSINLSPNTTGQVAMSLMVNPPKPGDESYAQWKAEHDEGL  416

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SLR+RA  MTDGFN+   V C FTEGAMYSFP++ LPP+AI  A   GK  D +YCL+L
Sbjct  417  ASLRRRAHAMTDGFNALDGVTCTFTEGAMYSFPRLHLPPKAIAAAAAAGKPADTFYCLQL  476

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGI TVPGSGFGQ+EG FHLRTTILP E  +   ++ F+ F+  FM +Y
Sbjct  477  LEATGIVTVPGSGFGQEEGTFHLRTTILPPEAKIGEFVKLFQDFHKAFMAKY  528



>gb|AAM22749.1| alanine aminotransferase [Deschampsia antarctica]
Length=147

 Score =   262 bits (669),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  490  QIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYS  311
            QIF+GLMVNPPKPGDISY ++  E K ILESLR+RA+IMTDGFNSCRNVVCNFTEGAMYS
Sbjct  1    QIFMGLMVNPPKPGDISYLKYATESKSILESLRRRAQIMTDGFNSCRNVVCNFTEGAMYS  60

Query  310  FPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  131
            FPQIRLP RA++TA+  GKAPDV+YCL LLEATGISTVPGSGFGQKEGVFHLRTTILPAE
Sbjct  61   FPQIRLPQRAMDTAKSAGKAPDVFYCLMLLEATGISTVPGSGFGQKEGVFHLRTTILPAE  120

Query  130  EDMPAIMESFKKFNDEFMDQYEDH  59
            EDMPAIM SFKKFND FM+QY+D+
Sbjct  121  EDMPAIMSSFKKFNDSFMEQYQDY  144



>ref|XP_010230121.1| PREDICTED: glutamate--glyoxylate aminotransferase 2-like, partial 
[Brachypodium distachyon]
Length=164

 Score =   263 bits (671),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  550  RSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMT  371
            ++V+EIYKVASI+LSPNVPGQIF+GLM+N PKPGDISY +F  E K IL+SLR+RA+IMT
Sbjct  4    QTVDEIYKVASIALSPNVPGQIFMGLMMNHPKPGDISYLKFATESKSILDSLRRRAQIMT  63

Query  370  DGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPG  191
            DGFNSC+NVVCNFTEGAMYS+ QI LP RAI+TA+  GK PDV+YCLKLLEAT ISTVPG
Sbjct  64   DGFNSCQNVVCNFTEGAMYSYFQICLPKRAIDTAKSAGKEPDVFYCLKLLEATRISTVPG  123

Query  190  SGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFN  89
            SGFGQKEGVFHLRTTILPAEEDMPAIM SFKKFN
Sbjct  124  SGFGQKEGVFHLRTTILPAEEDMPAIMLSFKKFN  157



>gb|KJB31174.1| hypothetical protein B456_005G179600 [Gossypium raimondii]
Length=395

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLLGDEVYQQNIYQDERPF+SSRKVL+DMGPPISK++QLVSFHTVSKGYWGECGQR
Sbjct  241  QENLVLLGDEVYQQNIYQDERPFISSRKVLMDMGPPISKDVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTNIPP++V+EIYK+ASISLSPNVP QIF+GLMVNP KPGD+SYDQFVRE KGIL
Sbjct  301  GGYFEMTNIPPKTVDEIYKIASISLSPNVPAQIFMGLMVNPLKPGDVSYDQFVRESKGIL  360

Query  403  ESLRKRARIMTDGFNSCRNVV  341
            ESLR+RARIMTDGFNSC+NVV
Sbjct  361  ESLRRRARIMTDGFNSCKNVV  381



>ref|XP_003291733.1| alanine transaminase [Dictyostelium purpureum]
 gb|EGC31753.1| alanine transaminase [Dictyostelium purpureum]
Length=530

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 171/230 (74%), Gaps = 2/230 (1%)
 Frame = -3

Query  751  VLLGDEVYQQNIY-QDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGY  575
            VLL DEVYQ+N+Y ++++PF+S +KV+ DMG   + +L++VSFH+VSKG+ GECG+RGGY
Sbjct  302  VLLADEVYQENVYVKEDKPFISFKKVVKDMGGEYA-DLEMVSFHSVSKGFVGECGKRGGY  360

Query  574  FEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESL  395
             E+  I      EIYK+ASI L PNV GQ+ + LMV PP PGD SY+ +++E  GI +SL
Sbjct  361  MELNGITSDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPTPGDSSYELYIKERDGIYDSL  420

Query  394  RKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEA  215
            +KRA ++    NS   V CN +EGAMY+FPQIRLP +A+E AQ +GKAPD YYC++LLE 
Sbjct  421  KKRANLLNKALNSLEGVTCNPSEGAMYAFPQIRLPKKAVEYAQSIGKAPDAYYCIQLLEH  480

Query  214  TGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            TGI  VPGSGFGQK+G +H RTT LP+EE +  + E    F+ +FM++Y+
Sbjct  481  TGICVVPGSGFGQKDGTYHFRTTFLPSEEAIEGVCERIADFHKQFMNKYK  530



>ref|XP_011398130.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25238.1| putative alanine aminotransferase, mitochondrial [Auxenochlorella 
protothecoides]
Length=487

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 162/233 (70%), Gaps = 0/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ NIYQDE+PF+S+++VL +MG P +  ++L SFHTVSKG  GECG RG
Sbjct  255  EGLVLLADEVYQPNIYQDEKPFVSAKRVLREMGEPWASSVELASFHTVSKGMLGECGLRG  314

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E  NI P +  E+YKVAS++L PN  GQ  + LMV PP     +  Q+ ++ +  L 
Sbjct  315  GYVEWVNIHPGAQAELYKVASVNLCPNTVGQATVSLMVAPPTGDSEAARQYAKQYEDSLA  374

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SLR+RA +MTD FN      CNFTEGAMYSFP++ LP +AI+ A+  GK PD +YCL LL
Sbjct  375  SLRRRAHVMTDAFNGLEGASCNFTEGAMYSFPRLHLPAKAIQAAKEAGKDPDTFYCLALL  434

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
              TGI TVPGSGFGQ EG FHLRTTILP E+ M   ++  + F+  FM +Y+D
Sbjct  435  ADTGIVTVPGSGFGQVEGTFHLRTTILPQEDVMHEFVDKLRTFHKSFMAKYKD  487



>gb|KIZ07569.1| alanine transaminase [Monoraphidium neglectum]
Length=621

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 177/260 (68%), Gaps = 29/260 (11%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRK-----------------------------VLLD  668
            E  +L+ DEVYQ+ +Y++E+PF+S+RK                              L D
Sbjct  361  EKLLLMADEVYQELVYEEEKPFVSARKDARPACALLGLHMTASGLLDGQPPATMAAALKD  420

Query  667  MGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQ  488
            MG P +  ++L+S+HTVSKG  GECG RGGY+EM NI P +V++ YK++SI+LSPN  GQ
Sbjct  421  MGEPYASGVELISYHTVSKGTSGECGLRGGYYEMVNIHPATVDQFYKISSINLSPNSIGQ  480

Query  487  IFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSF  308
            I L  MVNPP  GD S++ +++E +G L SL +RA+++ DGFNS + V CN TEGAMY+F
Sbjct  481  IALSCMVNPPAAGDPSHELWIQEQQGELASLNRRAKMVVDGFNSLQGVSCNATEGAMYAF  540

Query  307  PQIRLPPRAIETAQGLGKAPDVYYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEE  128
            P++ LPPRA+E A+  G+APD +YCL+LLEATGI  VPGSGFGQ EG FHLRTTILP EE
Sbjct  541  PRLSLPPRALEAARKAGRAPDAFYCLRLLEATGIVAVPGSGFGQAEGSFHLRTTILPREE  600

Query  127  DMPAIMESFKKFNDEFMDQY  68
             M   ++ F+ F+  FM ++
Sbjct  601  RMAEFVQKFRTFHQSFMAEF  620



>ref|XP_004955316.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like isoform 
X1 [Setaria italica]
Length=539

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
             EN VLL DEVYQQN+YQDERPF+S++KVL DMGPP+S+E+QLVSFHTVSKGYWGECGQR
Sbjct  241  HENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREVQLVSFHTVSKGYWGECGQR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFEMTN+PP++V+EIYKVASI+LSPNVPGQIF+G+MVNPPKPGDISY +F  E K IL
Sbjct  301  GGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIL  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEG  323
            +SLR+RAR+MTDGFNSCRNVVCNFTEG
Sbjct  361  DSLRRRARMMTDGFNSCRNVVCNFTEG  387



>tpg|DAA63613.1| TPA: hypothetical protein ZEAMMB73_743428 [Zea mays]
Length=329

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++PF S +K+   +G     +L LVSF +VSKGY+GECG+RG
Sbjct  98   EGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDLPLVSFQSVSKGYYGECGKRG  156

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK GD S++ F+ E  GIL 
Sbjct  157  GYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILS  216

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LL
Sbjct  217  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLL  276

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  277  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  329



>ref|XP_004992298.1| alanine aminotransferase [Salpingoeca rosetta]
 gb|EGD75245.1| alanine aminotransferase [Salpingoeca rosetta]
Length=481

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 170/228 (75%), Gaps = 2/228 (1%)
 Frame = -3

Query  751  VLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYF  572
            VLL DEVYQ N+Y   RPF+S +KV+ +MG    K ++L+SFHTVSKG +GECG+RGGY 
Sbjct  250  VLLADEVYQTNVY-GSRPFISFKKVVTEMGDE-GKNVELISFHTVSKGVFGECGRRGGYL  307

Query  571  EMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLR  392
            E TNI P +++++YKV SI LS NV GQ+ +GLM NPPKPGD SY+Q+ +E   I +SL+
Sbjct  308  EATNIHPGALDQLYKVFSIGLSSNVDGQLMMGLMCNPPKPGDASYEQYEQECDAIFQSLK  367

Query  391  KRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEAT  212
            +RA ++++ FN+   V C   EGA+Y+FP++RLP  A++ A+     PD++YCL+LL AT
Sbjct  368  RRAEMISNAFNALPGVSCQNVEGALYAFPRVRLPEAAVKEAEKKDMGPDLFYCLELLHAT  427

Query  211  GISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            GI  VPGSGFGQ+EG FH RTTILPAEE MP +++ F  F+ +F+ ++
Sbjct  428  GICAVPGSGFGQEEGTFHFRTTILPAEEQMPRVIDLFTSFHKDFLQRF  475



>ref|NP_001060284.1| Os07g0617800 [Oryza sativa Japonica Group]
 dbj|BAF22198.1| Os07g0617800 [Oryza sativa Japonica Group]
Length=329

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  98   EGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  156

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  157  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  216

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G APD YY  +LL
Sbjct  217  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLL  276

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  277  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  329



>gb|EEE58449.1| hypothetical protein OsJ_09677 [Oryza sativa Japonica Group]
Length=254

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY   +   S +K+   MG     +LQLVS H+VSKGY+GECG+RG
Sbjct  23   EELVLLADEVYQENIYVTNKKINSFKKIARSMGYN-GDDLQLVSLHSVSKGYYGECGKRG  81

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E++YK+AS++L  N+ GQI   L+++PPK GD SYD +  E   IL+
Sbjct  82   GYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKAGDASYDLYEEEKDNILK  141

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE A+ + KAPDV+Y L+LL
Sbjct  142  SLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNKAPDVFYALRLL  201

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            + TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  202  DTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMSQYRD  254



>ref|XP_004345426.2| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=489

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 170/234 (73%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE+ VLL DEVYQ N+YQD+RPF+S RKVL  MGP  S  ++L+SFH+VSKG+ GECG+R
Sbjct  257  REHLVLLADEVYQTNVYQDQRPFVSFRKVLKSMGPEFSN-VELISFHSVSKGFIGECGKR  315

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY EM  I     E+IYKVASISL PNV GQ+ + LMVNPPK G+ SY+ + RE   IL
Sbjct  316  GGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNPPKEGEPSYELYARERDQIL  375

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A+E A+  GKAPD +YC+ L
Sbjct  376  GSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKAVEAAKAAGKAPDSFYCMAL  435

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++  +F++EFM +Y+D
Sbjct  436  LEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAIVRFHNEFMAKYKD  489



>emb|CBJ25743.1| nicotinanamine aminotransferase A [Ectocarpus siliculosus]
Length=490

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 169/228 (74%), Gaps = 0/228 (0%)
 Frame = -3

Query  751  VLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYF  572
            VL+ DEVYQ+NIYQ + PF S +KVL +MG P S  ++LVSFHTVSKG +GECG RGGY 
Sbjct  248  VLMADEVYQENIYQSKTPFTSCKKVLAEMGYPYSSSVELVSFHTVSKGVYGECGLRGGYM  307

Query  571  EMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLR  392
            E+TNI  R  +E+YK+ SI+LSPNV GQ+ +G+M NPPKPG  SY   +RE + +L+SL 
Sbjct  308  ELTNIDQRVSDEMYKLCSINLSPNVTGQVAMGIMCNPPKPGSESYALHMREKEVLLQSLI  367

Query  391  KRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEAT  212
            +RAR + D FN    V C  TEGA+Y+FP+I LP  AI+ A+  GKAPDV+YCL+LL+ T
Sbjct  368  RRARSIVDAFNGLDGVTCEETEGALYAFPKIDLPRAAIDAAKAAGKAPDVFYCLELLKET  427

Query  211  GISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            G+S VPGSGFGQ EG +H RTTILPAE+   ++++ F  F+  FM +Y
Sbjct  428  GLSCVPGSGFGQAEGTYHFRTTILPAEDTFQSVVDGFTSFHRGFMAKY  475



>gb|EFA80185.1| alanine transaminase [Polysphondylium pallidum PN500]
Length=599

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 165/234 (71%), Gaps = 2/234 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQ  587
            R+  VLL DEVYQ+N+Y  E +PF+S +KV++DMG  + + L+LVSFH+VSKG+ GECG+
Sbjct  367  RKRIVLLADEVYQENVYVKETKPFVSFKKVVMDMGKEV-EGLELVSFHSVSKGFVGECGK  425

Query  586  RGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGI  407
            RGGY E+  I      EIYK+ASI L PNV GQI + LMV PP  G+ SYD +V+E   I
Sbjct  426  RGGYMELHGITNEVKAEIYKLASIGLCPNVTGQIVVDLMVRPPVAGEQSYDTYVKERDTI  485

Query  406  LESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLK  227
             +SL++RA ++    N    V CN  EGAMY+FPQIRLP RAIE A+  GKAPD YYC++
Sbjct  486  FDSLKRRANLLAAALNGLEGVTCNQPEGAMYAFPQIRLPARAIEEAKANGKAPDAYYCIQ  545

Query  226  LLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LLEATGI  VPGSGFGQK+G +H RTT LP+E+ +  +      F+  FM +Y+
Sbjct  546  LLEATGICVVPGSGFGQKDGTYHFRTTFLPSEQAIQGVCTRIADFHKNFMAKYK  599



>gb|KJE95383.1| alanine aminotransferase [Capsaspora owczarzaki ATCC 30864]
Length=553

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 170/234 (73%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE+ VLL DEVYQ N+YQD+RPF+S RKVL  MGP  S  ++L+SFH+VSKG+ GECG+R
Sbjct  321  REHLVLLADEVYQTNVYQDQRPFVSFRKVLKSMGPEFSN-VELISFHSVSKGFIGECGKR  379

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY EM  I     E+IYKVASISL PNV GQ+ + LMVNPPK G+ SY+ + RE   IL
Sbjct  380  GGYMEMIGIDAYVREQIYKVASISLCPNVQGQVIVDLMVNPPKEGEPSYELYARERDQIL  439

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL+ R+  + D FN    V C   +GAMY+FPQIRLP +A+E A+  GKAPD +YC+ L
Sbjct  440  GSLKDRSLFLVDTFNKMEGVTCQPAQGAMYTFPQIRLPKKAVEAAKAAGKAPDSFYCMAL  499

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATG+S VPG+GF Q+EG +H R T LP ++  PA  ++  +F++EFM +Y+D
Sbjct  500  LEATGVSVVPGTGFKQREGTYHFRCTFLPPQDTFPAFTDAIVRFHNEFMAKYKD  553



>ref|XP_006657961.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Oryza 
brachyantha]
Length=453

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  222  EGLVLLADEVYQENIYVEDKQFHSFKKIARSMGYT-DDDLPLVSFQSVSKGYYGECGKRG  280

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  281  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  340

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G  PD YY  +LL
Sbjct  341  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGAAQAAGTVPDAYYARRLL  400

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y D
Sbjct  401  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEYRD  453



>gb|AAV64199.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++PF S +K+   +G     +L LVSF +VSKGY+GECG+RG
Sbjct  285  EGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDLPLVSFQSVSKGYYGECGKRG  343

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK GD S++ F+ E  GIL 
Sbjct  344  GYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILS  403

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LL
Sbjct  404  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLL  463

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  464  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  516



>gb|ESA18192.1| hypothetical protein GLOINDRAFT_334935 [Rhizophagus irregularis 
DAOM 181602]
Length=496

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            E+ VLL DEVYQ NIYQ DERPF S +KV+  MG    +  +L SFH+VSKG  GECG+R
Sbjct  264  EHIVLLADEVYQTNIYQPDERPFHSFKKVIRSMGKKYER-FELFSFHSVSKGMIGECGRR  322

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV PPK GD SY  + +E   I 
Sbjct  323  GGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQPPKRGDKSYTSYQKELNEIY  382

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +AIE A   GK PD +YCL +
Sbjct  383  ESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQKAIEAAHQAGKKPDEFYCLAM  442

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATG+  VPGSGFGQK G +H R+T LP EE +       +KF++EF+++Y D
Sbjct  443  LDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIKLQKFHNEFLEKYCD  496



>ref|XP_006649511.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=482

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY   +   S +K+   MG    ++LQLVSFH+VSKGY+GECG+RG
Sbjct  251  EGLVLLADEVYQENIYVTNKKINSFKKIARSMGYN-EEDLQLVSFHSVSKGYYGECGKRG  309

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E++YK+AS++L  N+ GQI   L++NPPK GD SYD ++ E  GIL+
Sbjct  310  GYMEVTGFSAPVREQLYKIASVNLCSNITGQILSSLIMNPPKAGDGSYDLYMEEKDGILK  369

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ M   FNS   + CN TEGAMY FPQI LP +AIE A+ + KAPD +Y L+LL
Sbjct  370  SLARRAKAMESAFNSIDGITCNKTEGAMYLFPQIYLPHKAIEAARAVNKAPDAFYALRLL  429

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            + TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  430  DTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMIARFREFHEEFMAQYRD  482



>ref|XP_006657960.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Oryza 
brachyantha]
Length=491

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  260  EGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  318

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  319  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  378

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G  PD YY  +LL
Sbjct  379  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIHLPQKAIGAAQAAGTVPDAYYARRLL  438

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y D
Sbjct  439  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEYRD  491



>ref|XP_008653343.1| PREDICTED: alanine aminotransferase 2 [Zea mays]
Length=541

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++PF S +K+   +G     +L LVSF +VSKGY+GECG+RG
Sbjct  310  EGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDLPLVSFQSVSKGYYGECGKRG  368

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK GD S++ F+ E  GIL 
Sbjct  369  GYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSEKDGILS  428

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LL
Sbjct  429  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLL  488

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  489  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  541



>gb|AAV64237.1| putative alanine aminotransferase [Zea mays]
Length=516

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 164/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++PF S +K+   +G     +L LVSF +VSKGY+GECG+RG
Sbjct  285  EGLVLLADEVYQENIYVEDKPFHSFKKIARSLGY-TDDDLPLVSFQSVSKGYYGECGKRG  343

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK GD S++ F+ E  GIL 
Sbjct  344  GYMEITGFSPDVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMSERDGILS  403

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ +G APD YY  +LL
Sbjct  404  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAVGTAPDAYYAKRLL  463

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K+F+++FMD++ D
Sbjct  464  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLKEFHEKFMDEFRD  516



>gb|EXX69945.1| alanine transaminase ALT1 [Rhizophagus irregularis DAOM 197198w]
Length=528

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/234 (54%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            E+ VLL DEVYQ NIYQ DERPF S +KV+  MG    +  +L SFH+VSKG  GECG+R
Sbjct  296  EHIVLLADEVYQTNIYQPDERPFHSFKKVIRSMGKKYER-FELFSFHSVSKGMIGECGRR  354

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY+E TNI  R +EE+YK+AS+SL PNV GQI + LMV PPK GD SY  + +E   I 
Sbjct  355  GGYYECTNIDSRIIEELYKMASVSLCPNVQGQIMVDLMVQPPKRGDKSYTSYQKELNEIY  414

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESLR+R+  +++ FN    V CN  +G+MY FPQ+RLP +AIE A   GK PD +YCL +
Sbjct  415  ESLRRRSMKLSECFNQLEGVTCNNAQGSMYLFPQLRLPQKAIEAAHQAGKKPDEFYCLAM  474

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATG+  VPGSGFGQK G +H R+T LP EE +       +KF++EF+++Y D
Sbjct  475  LDATGVCVVPGSGFGQKNGTWHFRSTFLPPEELLDGFCIKLQKFHNEFLEKYCD  528



>dbj|GAM23260.1| hypothetical protein SAMD00019534_064350 [Acytostelium subglobosum 
LB1]
Length=531

 Score =   261 bits (667),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 167/233 (72%), Gaps = 1/233 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            ++  VLL DEVYQ+N+Y + +PF+S +KV+ D+G  + + L++VSFH+VSKG+ GECG+R
Sbjct  300  QKRLVLLADEVYQENVYSENKPFVSFKKVVKDLGTKV-EGLEMVSFHSVSKGFVGECGKR  358

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+  I P    EIYK++SI L PNV GQ+ + LMVNPP+ G+ S+ Q++ E   I 
Sbjct  359  GGYMELFGISPEVKSEIYKLSSIGLCPNVIGQLVVDLMVNPPQEGEASHKQYIEERDAIY  418

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA ++    NS   V CN  EGAMY+FPQIRLPP+A+E A+  GK PD +YC++L
Sbjct  419  NSLKRRANLLATALNSLEGVTCNAPEGAMYAFPQIRLPPKAVEEAKQNGKQPDAHYCIQL  478

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LEATGI  VPGSGFGQ++G +H RTT LP+E+ +  + +    F+  FM +Y+
Sbjct  479  LEATGICVVPGSGFGQRDGTYHFRTTFLPSEQAIEGVCKKVADFHKAFMAKYK  531



>dbj|BAC79866.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC79995.1| putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=486

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  255  EGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  313

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  314  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  373

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G APD YY  +LL
Sbjct  374  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLL  433

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  434  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  486



>tpg|DAA41461.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
 tpg|DAA41462.1| TPA: hypothetical protein ZEAMMB73_764403 [Zea mays]
Length=330

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   +G     +L LVSF ++SKGY+GECG+RG
Sbjct  98   ERLVLLADEVYQENIYVEDKQFHSFKKIARSLGY-TDDDLPLVSFQSISKGYYGECGKRG  156

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P+  ++IYK+ASI+L  N+ GQI   L++NPPK GD S++ F  E  GIL 
Sbjct  157  GYMEITGFSPQVRDQIYKMASINLCSNITGQILASLVMNPPKAGDESFESFRLERDGILS  216

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY  +LL
Sbjct  217  SLGRRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPRKAIGAAQAAGTAPDAYYAKRLL  276

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            EATGI  VPGSGFGQ  G +H+R+TILP E+ +P I+  FK+F+D+FMD++ D+
Sbjct  277  EATGIVFVPGSGFGQVPGTWHIRSTILPQEDKIPGIVSRFKEFHDKFMDEFRDY  330



>gb|ETP13560.1| hypothetical protein F441_11279 [Phytophthora parasitica CJ01A1]
Length=499

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 165/232 (71%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+R
Sbjct  268  KENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRR  326

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY+++  +  G L
Sbjct  327  GGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTL  386

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++
Sbjct  387  GSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQM  446

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  447  LDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>gb|ETP41623.1| hypothetical protein F442_11247 [Phytophthora parasitica P10297]
Length=499

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 165/232 (71%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+R
Sbjct  268  KENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRR  326

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY+++  +  G L
Sbjct  327  GGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTL  386

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++
Sbjct  387  GSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQM  446

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  447  LDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>ref|XP_006661735.1| PREDICTED: alanine aminotransferase 2-like [Oryza brachyantha]
Length=483

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  252  EGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDLPLVSFQSVSKGYYGECGKRG  310

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY  +  E  GIL+
Sbjct  311  GYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQ  370

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN+   + CN TEGAMY FPQ+ LP +AIE A+   KAPD +Y L+LL
Sbjct  371  SLARRAKALEDAFNNLEGITCNKTEGAMYLFPQLLLPRKAIEAAKAANKAPDAFYALRLL  430

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            E+TGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  431  ESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRFKTFHESFMAAYRD  483



>ref|NP_001064504.1| Os10g0390500 [Oryza sativa Japonica Group]
 dbj|BAA77260.1| alanine aminotransferase [Oryza sativa]
 dbj|BAA77261.1| alanine aminotransferase [Oryza sativa]
 gb|ABB47494.1| Alanine aminotransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26418.1| Os10g0390500 [Oryza sativa Japonica Group]
 gb|ACA50484.1| alanine aminotransferase [Oryza sativa Japonica Group]
 gb|EEC66876.1| hypothetical protein OsI_33417 [Oryza sativa Indica Group]
 gb|EEE50893.1| hypothetical protein OsJ_31385 [Oryza sativa Japonica Group]
Length=483

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  252  EGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDLPLVSFQSVSKGYYGECGKRG  310

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY  +  E  GIL+
Sbjct  311  GYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQ  370

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ A+   KAPD +Y L+LL
Sbjct  371  SLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLL  430

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  431  EATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  483



>gb|AAK52114.1|AC079936_10 Putative alanine aminotransferase [Oryza sativa Japonica Group]
Length=484

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  253  EGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYN-EDDLPLVSFQSVSKGYYGECGKRG  311

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY  +  E  GIL+
Sbjct  312  GYMEITGFSAPVREQIYKVASVNLCSNITGQILASLVMNPPKAGDASYASYKAEKDGILQ  371

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN TEGAMY FPQ+ LP +AI+ A+   KAPD +Y L+LL
Sbjct  372  SLARRAKALENAFNSLEGITCNKTEGAMYLFPQLSLPQKAIDAAKAANKAPDAFYALRLL  431

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H+R TILP EE +PAI+  FK F++ FM  Y D
Sbjct  432  EATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIISRFKAFHEGFMAAYRD  484



>gb|EEE67593.1| hypothetical protein OsJ_25140 [Oryza sativa Japonica Group]
Length=546

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  315  EGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  373

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  374  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  433

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G APD YY  +LL
Sbjct  434  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLL  493

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  494  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  546



>gb|EEC82447.1| hypothetical protein OsI_26881 [Oryza sativa Indica Group]
Length=546

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/233 (54%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  315  EGLVLLADEVYQENIYVEDKKFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  373

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  NV GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  374  GYMEVTGFSADVREQIYKVASVNLCSNVSGQILASLIMNPPKAGDESYESFMVEKDGILS  433

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP+I LP +AI  AQ  G APD YY  +LL
Sbjct  434  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRIYLPQKAIGAAQAAGTAPDAYYARRLL  493

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  494  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISKFKEFHEKFMDEFRD  546



>ref|XP_008907369.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETN06993.1| hypothetical protein PPTG_13440 [Phytophthora parasitica INRA-310]
 gb|ETO72425.1| hypothetical protein F444_11432 [Phytophthora parasitica P1976]
Length=499

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 165/232 (71%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E+ ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+R
Sbjct  268  KEDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRR  326

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY+++  +  G L
Sbjct  327  GGYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTL  386

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++
Sbjct  387  GSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQM  446

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  447  LDETGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>gb|KDE04574.1| hypothetical protein MVLG_05042 [Microbotryum violaceum p1A1 
Lamole]
Length=582

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 163/233 (70%), Gaps = 2/233 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ NIY  +RPF+S +K L D+G P S  ++LVSFH++SKG  GECG+RG
Sbjct  352  EKLVLMADEVYQDNIYHKDRPFVSFKKALKDLGAPYSNNVELVSFHSISKGQTGECGRRG  411

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFE+ N  P + EEIYK+ASI L P++ GQI + ++V PPK G+ SY Q++ E +GI +
Sbjct  412  GYFELCNFAPEAEEEIYKLASIQLCPSLGGQIGVDVLVCPPKEGEASYAQWIEEREGIAK  471

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L++R+ I+   FN    V CN  EGA+Y FP + LPP+AIE A+    APD +YCL+LL
Sbjct  472  TLKERSEILHKAFNELEGVECNEAEGALYLFPTVHLPPKAIEAAKKANLAPDAFYCLELL  531

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQKEG FH RTT L    D  A  +  ++F++ FM QY D
Sbjct  532  QATGICVVPGSGFGQKEGTFHFRTTFLAPGTDKFA--KRLQQFHEGFMKQYRD  582



>gb|KDD76740.1| aminotransferase [Helicosporidium sp. ATCC 50920]
Length=485

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 161/231 (70%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ NIY D RPF+S +KVL +MG P +  ++L SFHTVSKG  GECG RG
Sbjct  255  EGLVLMADEVYQPNIYVD-RPFVSCKKVLREMGEPYAHGVELASFHTVSKGVTGECGLRG  313

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E  N  P ++ ++YK+ASI+L PN  GQ  +GL VNPP  G  +  +   E + I E
Sbjct  314  GYVEWVNFHPDTIAQLYKIASINLCPNTVGQACVGLAVNPPSQGTKAGKEHATETRAIHE  373

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            S+++RA  +T  FN+   V CN TEGAMY+FP++ LPP+A+E A+  GKAPD +YCL LL
Sbjct  374  SMQRRAAKVTAAFNALPGVTCNPTEGAMYAFPRLHLPPKAVEAARAAGKAPDTFYCLALL  433

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            + TGI TVPG+GFGQ +G +H+RTTILP E+ +      F +F+ +FMD+Y
Sbjct  434  DYTGIVTVPGTGFGQVDGTWHMRTTILPQEDVLDDFCNRFAEFHQQFMDKY  484



>ref|XP_002463187.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
 gb|EER99708.1| hypothetical protein SORBIDRAFT_02g039340 [Sorghum bicolor]
Length=541

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 163/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y +++ F S +K+   +G     +L LVSF +VSKG++GECG+RG
Sbjct  310  EGLVLLADEVYQENVYVEDKKFHSFKKIARSLGY-TDDDLPLVSFQSVSKGFYGECGKRG  368

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYKVAS++L  NV GQI   L++NPPK GD S++ F+ E  GIL 
Sbjct  369  GYMEITGFSPEVREQIYKVASVNLCSNVSGQILASLVMNPPKAGDESFESFMLERDGILS  428

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G APD YY  +LL
Sbjct  429  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGTAPDAYYAKRLL  488

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD++ D
Sbjct  489  EATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRFKEFHEKFMDEFRD  541



>ref|XP_008797360.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 122/233 (52%), Positives = 162/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  299  EGLVLLADEVYQENIYADNKKFNSFKKISRSMGYS-GDDLSLVSFQSVSKGYYGECGKRG  357

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T + P   E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ ++ E   IL 
Sbjct  358  GYMEVTGLSPDVKEQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESYIAERDEILS  417

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ A+ +  APD YY  +LL
Sbjct  418  SLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIKAAEAVKTAPDAYYAHRLL  477

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H+R+TILP E+ +PAI+   K F++ FMD++ D
Sbjct  478  DATGIVVVPGSGFGQVPGTWHIRSTILPQEDKIPAILSRLKAFHEAFMDEFRD  530



>ref|XP_002906656.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
 gb|EEY66057.1| alanine aminotransferase 2 [Phytophthora infestans T30-4]
Length=499

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 164/232 (71%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E+ ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+R
Sbjct  268  KEDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRR  326

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY+++  +  G L
Sbjct  327  GGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLVVGMMTNPPQPGDASYERYAEQRDGTL  386

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC ++
Sbjct  387  GSLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCTQM  446

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQKEG +H RTTILP E+ +  ++E   KF+ +FMD Y
Sbjct  447  LDDTGIVVVPGSGFGQKEGTWHFRTTILPPEDAVDDVIEMTSKFHAKFMDTY  498



>gb|ETI43749.1| hypothetical protein F443_11362 [Phytophthora parasitica P1569]
Length=499

 Score =   255 bits (651),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 163/231 (71%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+ ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+RG
Sbjct  269  EDILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRRG  327

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY+++  +  G L 
Sbjct  328  GYMELVNIDEDAKDQFYKLMSVNLCSNIDGQLVVGMMTNPPQPGDASYERYAEQRDGTLG  387

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL++RA  +   FN    V CN TEGAMY+FP + LPP+A+E A+  G APD +YC+++L
Sbjct  388  SLKRRAEKLVKAFNELEGVTCNETEGAMYTFPNLTLPPKAVEAAKEAGMAPDAFYCMQML  447

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            + TGI  VPGSGFGQK G +H RTTILP E+ +  ++E   KF+  FMD+Y
Sbjct  448  DETGIVVVPGSGFGQKAGTWHFRTTILPPEDAVDDVIEKTSKFHARFMDKY  498



>ref|XP_008783332.1| PREDICTED: alanine aminotransferase 2 [Phoenix dactylifera]
Length=526

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 160/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY D + F S +K+   MG    K++ LVSF +VSKGY GECG+R
Sbjct  294  KEGLVLLADEVYQENIYVDNKKFNSFKKIARSMGYG-EKDISLVSFQSVSKGYHGECGKR  352

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ F+ E  GIL
Sbjct  353  GGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESFIAEKNGIL  412

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A+ +  APD +Y  +L
Sbjct  413  SSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAAKAVNVAPDAFYARRL  472

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  473  LDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISHLKAFHESFMEEFHD  526



>gb|EEC74641.1| hypothetical protein OsI_10280 [Oryza sativa Indica Group]
Length=494

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY   +   S +K+   MG     +LQLVS H+VSKGY+GECG+RG
Sbjct  263  EELVLLADEVYQENIYVTNKKINSFKKIARSMGYN-GDDLQLVSLHSVSKGYYGECGKRG  321

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E++YK+AS++L  N+ GQI   L+++PPK GD SYD +  E   IL+
Sbjct  322  GYMEVTGFSTPVREQLYKIASVNLCSNITGQILASLIMDPPKAGDASYDLYEEERDNILK  381

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ M   FNS   + CN TEGAMY FP+I LP +AIE A+ + KAPDV+Y L+LL
Sbjct  382  SLSRRAKAMESAFNSIDGITCNKTEGAMYLFPRIYLPQKAIEAARAVNKAPDVFYALRLL  441

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            + TGI   PGSGFGQ  G +H+R TILP EE +P+++  F++F++EFM QY D
Sbjct  442  DTTGIVVTPGSGFGQVAGTWHVRCTILPQEEKIPSMISRFREFHEEFMSQYRD  494



>ref|XP_010939850.1| PREDICTED: alanine aminotransferase 2 isoform X3 [Elaeis guineensis]
Length=329

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY + + F S +K+   MG    K+L LVSF +VSKGY+GECG+R
Sbjct  97   KEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDLSLVSFQSVSKGYYGECGKR  155

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L++N PK GD SY+ F  E  GIL
Sbjct  156  GGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGIL  215

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +L
Sbjct  216  SSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRL  275

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  276  LDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  329



>ref|XP_005833147.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
 gb|EKX46167.1| hypothetical protein GUITHDRAFT_157749 [Guillardia theta CCMP2712]
Length=473

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 159/232 (69%), Gaps = 5/232 (2%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            R N V+L DEVYQ N+Y D  PF S RKV+  M       ++L+S+H+VSKG  GECG+R
Sbjct  246  RNNLVILADEVYQANVYGDV-PFTSFRKVVTHM----KSNVELISYHSVSKGMIGECGRR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI P  VE+IYK+ SISL  N+ GQI + LMVNPP  GD S+DQ+ RE K + 
Sbjct  301  GGYMELINIDPVVVEQIYKLFSISLCSNIAGQIIVDLMVNPPAKGDPSHDQYEREMKDLF  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL++R++ +    NS +N+ C    GAMY+FP I LPP A++ A+  G  PD +Y ++L
Sbjct  361  ESLKRRSQKLHAALNSMKNITCTEIGGAMYAFPSIHLPPSAVQAAKEAGMTPDTFYAVEL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ATGI  VPGSGF QK+G FH RTT LP+E  M  +++  +KFN  FMD+Y
Sbjct  421  LDATGICVVPGSGFRQKQGSFHFRTTFLPSESKMDDVIDKLRKFNQSFMDKY  472



>ref|XP_005443445.1| PREDICTED: alanine aminotransferase 2-like [Falco cherrug]
Length=422

 Score =   251 bits (641),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 158/231 (68%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ NIY +   F S +KVL +MGPP S+ ++L SFH+VSKG+ GECG R 
Sbjct  191  EKLFLMADEVYQDNIYAEGSAFHSFKKVLFEMGPPYSEVVELASFHSVSKGFMGECGFRS  250

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+PP+PGD SY+ F+ E K +L 
Sbjct  251  GYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQPGDPSYELFIAEKKAVLS  310

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C+KLL
Sbjct  311  ALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQAPDMFFCMKLL  370

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  +F+ +Y
Sbjct  371  EETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFVKEY  421



>emb|CCI42079.1| unnamed protein product [Albugo candida]
Length=479

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/232 (48%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + N ++L DEVYQ+N+Y  ++ FLS +KVL D+G   +  ++L+SFH+ SKG+ GECG+R
Sbjct  248  KHNLLILADEVYQENVYAADKKFLSFKKVLRDLGAAYNN-VELISFHSTSKGFTGECGRR  306

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNPPK GD SY ++  +   IL
Sbjct  307  GGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNPPKKGDASYQRYCHQRDSIL  366

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGA+Y+FP+IRL  +A++ A G   APD YYC+++
Sbjct  367  ASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSEKAVQAASGCNMAPDTYYCIQM  426

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LE TGI  VPGSGFGQK+G FH R+TILP E+++  ++     F+  FM+ +
Sbjct  427  LEKTGIVVVPGSGFGQKDGTFHFRSTILPPEDEVNEVITKMSDFHLNFMNAH  478



>ref|NP_001086104.1| alanine aminotransferase 2 [Xenopus laevis]
 sp|Q6GM82.1|ALAT2_XENLA RecName: Full=Alanine aminotransferase 2; Short=ALT2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT 2; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Xenopus laevis]
 gb|AAH74194.1| Gpt2 protein [Xenopus laevis]
Length=540

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 161/231 (70%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN  L+ DEVYQ N+Y     F S +KVL +MGP  S+ L+L SFH+ SKGY GECG RG
Sbjct  309  ENLFLMADEVYQDNVYAKGCAFHSFKKVLFEMGPKYSETLELASFHSTSKGYMGECGFRG  368

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQ+ L ++VNPPKPG+ SY QF+ E + +L 
Sbjct  369  GYMEVINMDPAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKPGEPSYKQFISEKQAVLN  428

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L ++AR+  +  N    + CN  +GAMYSFP+I +P +AI+ AQ  G+APD+++C+KLL
Sbjct  429  NLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLL  488

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ+EG  H R TILP  + + +++E  K F+ +FMD+Y
Sbjct  489  EETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFMDEY  539



>ref|XP_005230442.1| PREDICTED: alanine aminotransferase 2-like [Falco peregrinus]
Length=436

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 158/231 (68%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ NIY +   F S +KVL +MGPP S+ ++L SFH+VSKG+ GECG R 
Sbjct  205  EKLFLMADEVYQDNIYAEGSAFHSFKKVLFEMGPPYSEVVELASFHSVSKGFMGECGFRS  264

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQI L  +V+PP+PGD SY+ F+ E K +L 
Sbjct  265  GYVEVVNMDPDVQQQLAKLVSVRLCPPVPGQILLDTVVDPPQPGDPSYELFIAEKKAVLS  324

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +AR+  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C+KLL
Sbjct  325  ALAHKARLTQEIFNQVPGIRCNPVQGAMYSFPRIELPPRALAAAKAQGQAPDMFFCMKLL  384

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  +F+ +Y
Sbjct  385  EETGICVVPGSGFGQREGTFHFRMTILPPTEKLQVLLEKLSSFYTKFIKEY  435



>gb|KFH70378.1| alanine transaminase [Mortierella verticillata NRRL 6337]
Length=493

 Score =   252 bits (644),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + N +LL DEVYQ NIYQ+ERPF S +KVL  MGP   +  +++S+H++SKG  GECG+R
Sbjct  261  KNNVILLADEVYQTNIYQNERPFHSFKKVLKSMGPKY-EGFEMISYHSISKGMIGECGRR  319

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFE   +    +E+IYK++SISL PNV GQI + LMVNPPK G+ SY+Q+  E  GI 
Sbjct  320  GGYFECEGLDNSVLEQIYKISSISLCPNVQGQIMVDLMVNPPKQGEPSYEQYKAEFDGIY  379

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL KRA I+   FN+     CN  +GAMY FPQIRLP +AI+ AQ  GK PD +YC+ +
Sbjct  380  YSLIKRASILEKTFNALEGCTCNPADGAMYLFPQIRLPKKAIQAAQDAGKEPDQFYCMAM  439

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATG+  V GSGFGQ EG  H R+T LP  E         + F+ +FM++Y D
Sbjct  440  LEATGVCMVAGSGFGQVEGTAHFRSTFLPQPELFEGFCTGIRNFHADFMNKYRD  493



>ref|XP_002887430.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63689.1| ALAAT2 [Arabidopsis lyrata subsp. lyrata]
Length=535

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 160/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   +G    K++ LVSF +VSKGY+GECG+R
Sbjct  303  QEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDISLVSFQSVSKGYYGECGKR  361

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  362  GGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGIL  421

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + DG NS   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  422  SSMAKRAKTLEDGLNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRL  481

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD++ D
Sbjct  482  LNATGVVVVPGSGFGQAPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRD  535



>ref|XP_008800517.1| PREDICTED: alanine aminotransferase 2-like [Phoenix dactylifera]
Length=530

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY + + F S +K+   MG    K+L LVSF +VSKGY+GECG+R
Sbjct  298  KEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDLSLVSFQSVSKGYYGECGKR  356

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ F  E  GIL
Sbjct  357  GGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESFAAEKNGIL  416

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE A+ +  APD +Y  +L
Sbjct  417  SSLARRAKALEDAFNGLVGVTCNKAEGAMYLFPRLHLPQKAIEAAKAVNAAPDAFYARRL  476

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM ++ D
Sbjct  477  LDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIIARLKAFHESFMGEFRD  530



>ref|XP_637993.1| alanine transaminase [Dictyostelium discoideum AX4]
 sp|Q54MJ7.1|ALAM_DICDI RecName: Full=Probable alanine aminotransferase, mitochondrial; 
Short=ALT; AltName: Full=Glutamate pyruvate transaminase; 
Short=GPT; AltName: Full=Glutamic--alanine transaminase; AltName: 
Full=Glutamic--pyruvic transaminase; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL64484.1| alanine transaminase [Dictyostelium discoideum AX4]
Length=534

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 171/233 (73%), Gaps = 2/233 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIY-QDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +N VLL DEVYQ+N+Y ++ +PF+S +KV+ DMG   + +L++VSFH+VSKG+ GECG+R
Sbjct  303  KNVVLLADEVYQENVYVKESKPFISFKKVVKDMGGDYA-DLEMVSFHSVSKGFVGECGKR  361

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+  +      EIYK+ASI L PNV GQ+ + LMV PP  G+ S+D +++E   I 
Sbjct  362  GGYMELNGVTQDVKAEIYKLASIGLCPNVIGQLVVDLMVRPPVAGEQSHDLYLKERDNIY  421

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            ESL+KRA ++T+  N+   V CN +EGAMY+FPQIRLP +A+E A  +GKAPD YYC++L
Sbjct  422  ESLKKRANLLTNALNNLEGVTCNPSEGAMYAFPQIRLPAKAVEYANSIGKAPDAYYCIQL  481

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LEATGI  VPGSGFGQK+G +H RTT LP+EE +  + +    F+  FM++Y+
Sbjct  482  LEATGICVVPGSGFGQKDGTWHFRTTFLPSEEAIEGVCKRIADFHQSFMNKYK  534



>gb|KJB68682.1| hypothetical protein B456_011G0552001 [Gossypium raimondii]
Length=329

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKGY+GECG+RG
Sbjct  98   EGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDIHLVSFQSVSKGYYGECGKRG  156

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E IYK+AS++L  N+ GQI   L+++PPK GD SY+ ++ E  GIL 
Sbjct  157  GYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILS  216

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL
Sbjct  217  SLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLL  276

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
              TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  277  NETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  329



>ref|XP_005514471.1| PREDICTED: alanine aminotransferase 2-like, partial [Columba 
livia]
Length=416

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 154/226 (68%), Gaps = 0/226 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN  L+ DEVYQ NIY     F S +KVL +MGPP SK ++L SFH++SKG+ GECG RG
Sbjct  191  ENLFLMADEVYQDNIYAKGSAFYSFKKVLSEMGPPYSKTVELASFHSISKGFMGECGFRG  250

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   E++ K+ S+ L P V GQI LG +V+PP+PG+ SY+ F+ E K +L 
Sbjct  251  GYMEVINMDPEVKEQLVKLVSVRLCPPVSGQILLGALVDPPQPGEPSYETFMAEKKAVLS  310

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +A++  + FN    + CN  +GAMYSFP+I LPPRAI  A+  G+APD ++C++LL
Sbjct  311  TLAHKAQLTQEIFNKTPGIHCNPVQGAMYSFPRIDLPPRAITAAKEKGQAPDTFFCMRLL  370

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDE  83
            E TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  E
Sbjct  371  EETGICVVPGSGFGQREGTFHFRMTILPPTEKLKVLLEKLSSFYTE  416



>gb|EIE85592.1| hypothetical protein RO3G_10302 [Rhizopus delemar RA 99-880]
Length=475

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 2/234 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDE-RPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            E  VLL DEVYQ NIYQ E RPF S +KVL  MGP   +E +L SFH++SKG  GECG+R
Sbjct  243  ERIVLLADEVYQTNIYQPEHRPFHSFKKVLKSMGPEY-QEQELFSFHSISKGMIGECGRR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFE  +I P  ++++YK++S+SL PN+ GQI + LM NPP  GD SY Q+  E   I 
Sbjct  302  GGYFECVHIDPEIMDQLYKISSVSLCPNIHGQIMVDLMTNPPVEGDASYPQYKEEIDAIY  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SLR+RA  +   FN+   V CN  EGAMY FPQIRLP +AI+ A+  G A D YY + +
Sbjct  362  QSLRRRAIKLATCFNNLEGVTCNSAEGAMYLFPQIRLPQKAIKEAEKAGMAADTYYSMAM  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATG+  VPGSGFGQ++G +H R+T LP E        S + F+ EF+++Y D
Sbjct  422  LEATGVCVVPGSGFGQQQGTYHFRSTFLPEEHLFDTFCSSLEAFHKEFLNKYRD  475



>gb|KJB68683.1| hypothetical protein B456_011G0552001, partial [Gossypium raimondii]
Length=331

 Score =   245 bits (625),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKGY+GECG+RG
Sbjct  100  EGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDIHLVSFQSVSKGYYGECGKRG  158

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E IYK+AS++L  N+ GQI   L+++PPK GD SY+ ++ E  GIL 
Sbjct  159  GYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILS  218

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL
Sbjct  219  SLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLL  278

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
              TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  279  NETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  331



>ref|XP_009380146.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=523

 Score =   251 bits (640),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D++ F S +K+   MG    ++L LVSF +VSKGY+GECG+RG
Sbjct  292  ERLVLLADEVYQENIYVDDKKFNSFKKIARSMGYG-DEDLPLVSFQSVSKGYYGECGKRG  350

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ F  E  GIL 
Sbjct  351  GYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESFDAEKTGILS  410

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN    V CN  EGAMY FP++ LP +AIE A+ +  APD +Y  +LL
Sbjct  411  SLARRAKALEDAFNGLEEVTCNKAEGAMYLFPRLHLPKKAIEAAKAVKAAPDAFYARRLL  470

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  471  DATGIVVVPGSGFGQVPGTWHVRCTILPHEDKIPAIISRLKAFHEAFMEEFRD  523



>gb|EMC77259.1| Alanine aminotransferase 2, partial [Columba livia]
Length=451

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 154/226 (68%), Gaps = 0/226 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN  L+ DEVYQ NIY     F S +KVL +MGPP SK ++L SFH++SKG+ GECG RG
Sbjct  226  ENLFLMADEVYQDNIYAKGSAFYSFKKVLSEMGPPYSKTVELASFHSISKGFMGECGFRG  285

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   E++ K+ S+ L P V GQI LG +V+PP+PG+ SY+ F+ E K +L 
Sbjct  286  GYMEVINMDPEVKEQLVKLVSVRLCPPVSGQILLGALVDPPQPGEPSYETFMAEKKAVLS  345

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +A++  + FN    + CN  +GAMYSFP+I LPPRAI  A+  G+APD ++C++LL
Sbjct  346  TLAHKAQLTQEIFNKTPGIHCNPVQGAMYSFPRIDLPPRAITAAKEKGQAPDTFFCMRLL  405

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDE  83
            E TGI  VPGSGFGQ+EG FH R TILP  E +  ++E    F  E
Sbjct  406  EETGICVVPGSGFGQREGTFHFRMTILPPTEKLKVLLEKLSSFYTE  451



>ref|XP_010937250.1| PREDICTED: alanine aminotransferase 2 [Elaeis guineensis]
Length=526

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 160/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY + + F S +K+   MG    +++ LVSF +VSKGY+GECG+R
Sbjct  294  KEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EQDISLVSFQSVSKGYYGECGKR  352

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L++N PK GD SY+ F+ E  GIL
Sbjct  353  GGYMEVTGFSADVREQIYKVASVNLCSNISGQILASLVMNTPKVGDESYESFIAEKNGIL  412

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A+ +  APD +Y  +L
Sbjct  413  SSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAAKVVNAAPDAFYARRL  472

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+   K F++ FM+++ D
Sbjct  473  LDATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIISRLKAFHESFMEEFHD  526



>gb|ETK88933.1| hypothetical protein L915_06890 [Phytophthora parasitica]
Length=266

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/234 (47%), Positives = 165/234 (71%), Gaps = 1/234 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+RG
Sbjct  29   ENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRRG  87

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+ GD SY +++ +  G L 
Sbjct  88   GYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQSGDASYQRYIEQRDGTLH  147

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL++RA  +   FN+   V CN TEGA+Y+FP I LP +A+E A+  G APD +YC+++L
Sbjct  148  SLKRRAIKLVKAFNNLEGVTCNETEGALYTFPSISLPAKAVEAAKEAGMAPDAFYCMQML  207

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            + TGI  VPGSGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  208  DETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  261



>ref|XP_002969652.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
 gb|EFJ29740.1| hypothetical protein SELMODRAFT_91640 [Selaginella moellendorffii]
Length=503

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  +LL DEVYQ+NIY + + F S +KV   MG     +L +VSFH+VSKGY+GECG+RG
Sbjct  272  ERLLLLADEVYQENIYAEGKKFQSFKKVARSMGLG-ENDLSIVSFHSVSKGYYGECGRRG  330

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T +     E+IYK+AS++L  N+ GQI + L+ NPPK GD SY+ +VRE  GIL 
Sbjct  331  GYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNPPKAGDESYEDYVRERDGILA  390

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ A  +  A D +Y  +LL
Sbjct  391  SLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKAAAAVSMAADTFYARRLL  450

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F+  FMD++ D
Sbjct  451  DATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSFHQRFMDEFRD  503



>ref|XP_002970914.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
 gb|EFJ28240.1| hypothetical protein SELMODRAFT_94316 [Selaginella moellendorffii]
Length=503

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 161/233 (69%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  +LL DEVYQ+NIY + + F S +KV   MG     +L +VSFH+VSKGY+GECG+RG
Sbjct  272  ERLLLLADEVYQENIYAEGKKFQSFKKVARSMGLG-ENDLSIVSFHSVSKGYYGECGRRG  330

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T +     E+IYK+AS++L  N+ GQI + L+ NPPK GD SY+ +VRE  GIL 
Sbjct  331  GYMEVTGVDKDVKEQIYKIASVNLCSNISGQILMSLVSNPPKAGDESYEDYVRERDGILA  390

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+++ +GFN    V CN  EGAMY FP++ LP RA++ A  +  A D +Y  +LL
Sbjct  391  SLARRAKLLAEGFNKLEGVSCNQAEGAMYLFPRLHLPERALKAAAAVSMAADTFYARRLL  450

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H+R TILPAEE MPA++     F+  FMD++ D
Sbjct  451  DATGIVVVPGSGFGQVPGTWHIRCTILPAEEKMPALITRLTSFHQRFMDEFRD  503



>ref|XP_008620886.1| alanine transaminase [Saprolegnia diclina VS20]
 gb|EQC25667.1| alanine transaminase [Saprolegnia diclina VS20]
Length=489

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 160/231 (69%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ+N+Y +++ F+S +KVL DMGP     ++L SFH+ SKG+ GECG+RG
Sbjct  259  EKLVLMADEVYQENVYAEDKHFVSFKKVLKDMGPDYDC-VELASFHSTSKGFTGECGRRG  317

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NPP  GD SY+ ++ +  GIL 
Sbjct  318  GYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNPPVEGDESYELYIAQRDGILS  377

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+E A   G APD +Y + LL
Sbjct  378  SLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVEEATKRGVAPDAFYAMALL  437

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            +ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF+ EFMD Y
Sbjct  438  DATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKFHAEFMDLY  488



>ref|XP_008869166.1| hypothetical protein H310_06043 [Aphanomyces invadans]
 gb|ETW02561.1| hypothetical protein H310_06043 [Aphanomyces invadans]
Length=486

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 160/231 (69%), Gaps = 4/231 (2%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ+N+Y  ++ F+S +KVL DM    + +++L SFH+ SKG+ GECG+RG
Sbjct  259  EKLVLMADEVYQENVYASDKHFVSFKKVLRDM----NSDVELASFHSTSKGFTGECGRRG  314

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N     +EE+YK+ SI+L  N+ GQ+ + LM NPPKPGD SYD +V +   I+ 
Sbjct  315  GYMELVNFDHDVMEELYKLVSINLCSNIEGQLMVALMTNPPKPGDASYDLYVSQRDEIVN  374

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL++RA  +   FN    V CN TEGAMY+FP+I +P +A+  A+ +G+APD +Y   LL
Sbjct  375  SLKRRALKLVASFNELEGVTCNATEGAMYTFPRITVPAKAVAEAKKVGQAPDAFYAFALL  434

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
             ATGI  VPGSGFGQ++G FH R+TILP EE +  ++    KF+ +FM++Y
Sbjct  435  NATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIAKTAKFHADFMNKY  485



>ref|XP_007441690.1| PREDICTED: alanine aminotransferase 2-like isoform X3 [Python 
bivittatus]
 ref|XP_007441691.1| PREDICTED: alanine aminotransferase 2-like isoform X4 [Python 
bivittatus]
 ref|XP_007441692.1| PREDICTED: alanine aminotransferase 2-like isoform X5 [Python 
bivittatus]
Length=492

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 161/235 (69%), Gaps = 0/235 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+  L+ DEVYQ N+Y +   F S +KVL +MGP  S+ ++L SFH++SKG+ GECG RG
Sbjct  257  EHLFLMADEVYQDNVYAEGSKFHSFKKVLFEMGPKYSRSVELASFHSISKGFMGECGFRG  316

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+PGD SY QF +E   +L 
Sbjct  317  GYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLG  376

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLL
Sbjct  377  ALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLL  436

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            E TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  437  EETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  491



>ref|XP_010939849.1| PREDICTED: alanine aminotransferase 2 isoform X2 [Elaeis guineensis]
Length=475

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY + + F S +K+   MG    K+L LVSF +VSKGY+GECG+R
Sbjct  243  KEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDLSLVSFQSVSKGYYGECGKR  301

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L++N PK GD SY+ F  E  GIL
Sbjct  302  GGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGIL  361

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +L
Sbjct  362  SSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRL  421

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  422  LDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  475



>ref|XP_007441689.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Python 
bivittatus]
Length=507

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 161/235 (69%), Gaps = 0/235 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+  L+ DEVYQ N+Y +   F S +KVL +MGP  S+ ++L SFH++SKG+ GECG RG
Sbjct  272  EHLFLMADEVYQDNVYAEGSKFHSFKKVLFEMGPKYSRSVELASFHSISKGFMGECGFRG  331

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+PGD SY QF +E   +L 
Sbjct  332  GYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLG  391

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLL
Sbjct  392  ALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLL  451

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            E TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  452  EETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  506



>ref|XP_009515714.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
 gb|EGZ28439.1| hypothetical protein PHYSODRAFT_476244 [Phytophthora sojae]
Length=492

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 168/233 (72%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN ++L DEVYQ+N+Y + + F+S +KVL DMG     +++L+SFH+ SKG+ GECG+RG
Sbjct  255  ENILILADEVYQENVYAEGKKFVSFKKVLRDMGKAYD-DVELISFHSTSKGFTGECGRRG  313

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ NI   + ++ YK+ S++L  NV GQ+ +G+M NPP+PGD SY++++ +  G LE
Sbjct  314  GYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLMVGMMTNPPQPGDASYERYIEQRDGTLE  373

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L++RA  +   FN    V CN TEGAMY+FP+I +P +A+E A+  G APD +YC+++L
Sbjct  374  ALKRRAVKLVKAFNELEGVTCNETEGAMYTFPKITIPAKAVEAAKAAGMAPDAFYCMQML  433

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            + TGI  VPGSGFGQKEG +H R+TILP EE +  ++E   KF+  FMD+Y +
Sbjct  434  DETGIVVVPGSGFGQKEGTWHFRSTILPPEEAVDEVIEKTVKFHANFMDKYRE  486



>sp|P52894.1|ALA2_HORVU RecName: Full=Alanine aminotransferase 2; Short=ALAAT-2; AltName: 
Full=Glutamate pyruvate transaminase 2; Short=GPT; AltName: 
Full=Glutamic--alanine transaminase 2; AltName: Full=Glutamic--pyruvic 
transaminase 2 [Hordeum vulgare]
 emb|CAA81231.1| alanine aminotransferase [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 157/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K++  +G    ++L LVS+ +VSKGY+GECG+RG
Sbjct  251  EGLVLLADEVYQENIYVDNKKFHSFKKIVRSLGYG-EEDLPLVSYQSVSKGYYGECGKRG  309

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFE+T       E+IYK+AS++L  N+ GQI   L++NPPK  D SY  +  E  GIL 
Sbjct  310  GYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILA  369

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y L+LL
Sbjct  370  SLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLL  429

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            E+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  430  ESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  482



>ref|XP_003429759.1| PREDICTED: LOW QUALITY PROTEIN: alanine aminotransferase 1 [Ornithorhynchus 
anatinus]
Length=491

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 161/231 (70%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ N+Y +   F S +KVL++MGPP S++L+L SFH+ SKG+ GECG RG
Sbjct  260  ERLFLMADEVYQDNVYAEGSQFHSFKKVLMEMGPPYSQQLELASFHSTSKGFMGECGFRG  319

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQ  L ++V+PP+PGD SY QF  E + +L+
Sbjct  320  GYMEVVNLDPDVKQQLSKLVSVRLCPPVPGQALLDVVVSPPQPGDPSYRQFQGEKQAVLK  379

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L ++AR+    FN    + CN  +GAMYSFP+I LP RA+E AQ LG+APD+++C++LL
Sbjct  380  ALAEKARLTESVFNQAPGIRCNPVQGAMYSFPRISLPARALERAQELGQAPDMFFCMRLL  439

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQKEG +H R TILP  + +  ++E   +F+  F  ++
Sbjct  440  EETGICVVPGSGFGQKEGTYHFRMTILPPLDKLRTVLEKLTQFHARFTKEF  490



>ref|XP_002499950.1| alanine aminotransferase [Micromonas sp. RCC299]
 gb|ACO61208.1| alanine aminotransferase [Micromonas sp. RCC299]
Length=463

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/232 (50%), Positives = 159/232 (69%), Gaps = 5/232 (2%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  +L+ DEVYQ+N+Y + R F S +KV+ DMG     ++ LVS  + SKG++GECG+RG
Sbjct  235  EGVLLIADEVYQENVYAEGRSFTSFKKVVRDMG----LDIPLVSMQSTSKGFYGECGRRG  290

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+  + P    E+YK+AS+ L PN+ GQ+ +GL+++PPKPGD SY+ +  E   IL 
Sbjct  291  GYMEVCGLDPDVKAELYKLASVGLCPNLSGQVLMGLVMSPPKPGDPSYELYAAERDAILS  350

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGK-APDVYYCLKL  224
            SL++RA  +  G N+   V CN  +GAMY+FP++ LP + +  A   GK APD  YC+KL
Sbjct  351  SLKRRALKLVSGLNALEGVTCNEAQGAMYAFPKVSLPEKFVAEATASGKMAPDALYCMKL  410

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            LEATGI  VPGSGFGQ EG +H RTT LP+EED+  ++E   KF+ EFMD Y
Sbjct  411  LEATGIVVVPGSGFGQVEGTWHFRTTFLPSEEDIGGVVEKLAKFHAEFMDTY  462



>gb|AET06148.1| PLP-dependent aminotransferase [Papaver somniferum]
Length=484

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN VLL DEVYQ+N+Y +++ F S +KV   MG    K++ LVSF +VSKGY GECG+R
Sbjct  252  KENLVLLADEVYQENVYVEDKSFHSFKKVARSMGYG-EKDISLVSFQSVSKGYHGECGKR  310

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  311  GGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKNGIL  370

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FN+   V CN  EGAMY FP+I L  +AI+ A+    APD +Y  +L
Sbjct  371  SSLARRAKALEDAFNNLEGVTCNKAEGAMYLFPRIHLSQKAIKAAETAKTAPDAFYAKRL  430

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATGI  VPGSGFGQ  G +H+R TILP EE +PAI+     F+  FM ++ D
Sbjct  431  LEATGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAIITRLTDFHQAFMAEFRD  484



>emb|CCA27196.1| unnamed protein product [Albugo laibachii Nc14]
Length=504

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            + + ++L DEVYQ+N+Y DE+ F+S +KVL D+G   +  ++L+SFH+ SKG+ GECG+R
Sbjct  273  KHDILILADEVYQENVYADEKRFVSFKKVLRDLGSAYNN-VELISFHSTSKGFTGECGRR  331

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + E++YK+ SI+L  N+ GQ+ +GLMVNPPK GD SY ++  +   IL
Sbjct  332  GGYMELVNISECAREQLYKLMSINLCSNIEGQLMVGLMVNPPKTGDASYQKYCHQRDSIL  391

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN    V CN TEGA+Y+FP+IRL   A++ A     APD YYC+++
Sbjct  392  ASLKRRALKLVAAFNKLEGVTCNATEGALYTFPRIRLSENAVQAAAKSSMAPDTYYCIQM  451

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQ++G FH R+TILP E+++  ++     F+ EFM+ +
Sbjct  452  LDKTGIVVVPGSGFGQRDGTFHFRSTILPPEDEVNEVIAKMSTFHLEFMNSH  503



>ref|XP_009389580.1| PREDICTED: alanine aminotransferase 2-like [Musa acuminata subsp. 
malaccensis]
Length=487

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 157/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y D + F S +K+   MG    ++L LVSF ++SKGY GECG+RG
Sbjct  256  EGLVLLADEVYQENVYVDNKKFNSFKKIARSMGYG-EEDLYLVSFQSISKGYHGECGKRG  314

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+ YKVAS++L  N+ GQI   L++NPPK GD SY  F+ E  GIL 
Sbjct  315  GYMEVTGFSAEVREQFYKVASVNLCSNISGQIIASLVMNPPKVGDESYKSFIAEKNGILS  374

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AI+ A+ +  APD  Y  +LL
Sbjct  375  SLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIDAAKAVIAAPDTLYARRLL  434

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H+R TILP E+ +PAI+   K F++ FMD++ D
Sbjct  435  DATGIVVVPGSGFGQVPGTWHVRCTILPQEDKIPAIISRLKAFHEAFMDEFRD  487



>ref|XP_007441688.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Python 
bivittatus]
Length=518

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 161/235 (69%), Gaps = 0/235 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+  L+ DEVYQ N+Y +   F S +KVL +MGP  S+ ++L SFH++SKG+ GECG RG
Sbjct  283  EHLFLMADEVYQDNVYAEGSKFHSFKKVLFEMGPKYSRSVELASFHSISKGFMGECGFRG  342

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P V GQI L  MVN P+PGD SY QF +E   +L 
Sbjct  343  GYMEVINMDPAVQQQLTKLVSVRLCPPVTGQILLDAMVNQPQPGDPSYQQFSQEKAAVLG  402

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L ++A++  + FN    + CN  +GAMY+FP+I LPPRA++ A+  G+APD+++CLKLL
Sbjct  403  ALARKAQLTEEIFNRAPGIHCNSVQGAMYAFPRIELPPRAVQDAEAQGQAPDMFFCLKLL  462

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDHR  56
            E TGI  VPGSGFGQKEG FH R TILP +E +  +++   +F+ +F  +Y   +
Sbjct  463  EETGICVVPGSGFGQKEGTFHFRMTILPPQEKLEILLQKLSQFHAKFTQEYSQRQ  517



>emb|CEG73189.1| Putative Alanine transaminase [Rhizopus microsporus]
 emb|CEI95194.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMG-PPISKELQLVSFHTVSKGYWGECG  590
            ++  VLL DEVYQ NIYQ +ERPF+S +K L+D   P + + L+LVSFH++SKG  GECG
Sbjct  256  QQRIVLLADEVYQTNIYQPEERPFVSFKKALMDHPIPEVRESLELVSFHSISKGMIGECG  315

Query  589  QRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKG  410
            +RGGYFE  N+  + +E+IYK+AS+SL PNV GQI + LM NPPKPGD SY+ + +E + 
Sbjct  316  RRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQILVDLMCNPPKPGDPSYESYKQEIES  375

Query  409  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  230
            I ESLR+R++ +   FN    V C   +G+MY FPQI LP +A+E A+ L  A D YY L
Sbjct  376  IYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQITLPSKAVEKAKELDMAADAYYSL  435

Query  229  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
             +LEATG+  +PGSGFGQKEG +H R+T LP E        + +KF+ +F++++
Sbjct  436  AMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLFDEFCGALEKFHKDFIEKH  489



>emb|CEI91975.1| Putative Alanine transaminase [Rhizopus microsporus]
Length=490

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 164/234 (70%), Gaps = 2/234 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQ-DERPFLSSRKVLLDMG-PPISKELQLVSFHTVSKGYWGECG  590
            ++  VLL DEVYQ NIY+ +ERPF+S +K L+D   P + + L+LVSFH++SKG  GECG
Sbjct  256  QQRIVLLADEVYQTNIYEPEERPFVSFKKALMDHPIPEVRESLELVSFHSISKGMIGECG  315

Query  589  QRGGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKG  410
            +RGGYFE  N+  + +E+IYK+AS+SL PNV GQI + LM NPPKPGD SY+ + +E + 
Sbjct  316  RRGGYFECVNLDSQVLEQIYKMASVSLCPNVHGQILVDLMCNPPKPGDPSYESYKQEIES  375

Query  409  ILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCL  230
            I ESLR+R++ +   FN    V C   +G+MY FPQI LP +A+E A+ L  A D YY L
Sbjct  376  IYESLRRRSKKLEQVFNRMEGVTCQPAQGSMYLFPQITLPSKAVEKAKELDMAADAYYSL  435

Query  229  KLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
             +LEATG+  +PGSGFGQKEG +H R+T LP E        + +KF+ +F++++
Sbjct  436  AMLEATGVCVIPGSGFGQKEGTWHFRSTFLPEEHLFDEFCSALEKFHKDFIEKH  489



>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
 pdb|3TCM|B Chain B, Crystal Structure Of Alanine Aminotransferase From Hordeum 
Vulgare
Length=500

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 157/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K++  +G    ++L LVS+ +VSKGY+GECG+RG
Sbjct  269  EGLVLLADEVYQENIYVDNKKFHSFKKIVRSLGYG-EEDLPLVSYQSVSKGYYGECGKRG  327

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GYFE+T       E+IYK+AS++L  N+ GQI   L++NPPK  D SY  +  E  GIL 
Sbjct  328  GYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILA  387

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ +   FN    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y L+LL
Sbjct  388  SLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEAAKAANKAPDAFYALRLL  447

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            E+TGI  VPGSGFGQ  G +H R TILP E+ +PA++  F  F++ FM +Y D
Sbjct  448  ESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSEYRD  500



>ref|XP_004235528.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Solanum lycopersicum]
Length=484

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +K+   MG    K++ LVSFH+ SKGY+GECG+R
Sbjct  252  KEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDISLVSFHSASKGYYGECGKR  310

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E T   P   E+IYK+AS++L  N+ GQI   L+++PPK GD SY+ F  E   IL
Sbjct  311  GGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSPPKVGDESYESFSAEKDAIL  370

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ A+    APD +Y  +L
Sbjct  371  SSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKAAEEAKTAPDAFYAWRL  430

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F+ +FMD++
Sbjct  431  LNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQFHKQFMDEF  482



>ref|XP_003573850.1| PREDICTED: alanine aminotransferase 2 [Brachypodium distachyon]
Length=481

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 159/233 (68%), Gaps = 2/233 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D++ F S +K++  +G    ++L LVS+ +VSKGY+GECG+RG
Sbjct  251  EGLVLLADEVYQENIYVDDKKFHSFKKIVRSLG--YGEDLPLVSYQSVSKGYYGECGKRG  308

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYK++S++L  N+ GQI   L++NPPK GD SY  +  E   IL 
Sbjct  309  GYMEITGFSAPVREQIYKISSVNLCSNITGQILASLVMNPPKAGDESYASYQAEKDRILT  368

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN+   + CN  EGAMY FP+I LP +AI+ A    KAPD +Y L+LL
Sbjct  369  SLARRAKALEDAFNNLEGITCNKAEGAMYLFPRINLPQKAIDAANAANKAPDAFYALRLL  428

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            E+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  FK F++ FM ++ D
Sbjct  429  ESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFKVFHEAFMAEHRD  481



>ref|XP_010318452.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X1 [Solanum lycopersicum]
Length=487

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +K+   MG    K++ LVSFH+ SKGY+GECG+R
Sbjct  255  KEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDISLVSFHSASKGYYGECGKR  313

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E T   P   E+IYK+AS++L  N+ GQI   L+++PPK GD SY+ F  E   IL
Sbjct  314  GGYMEFTGFSPEIREQIYKLASVNLCSNISGQILASLIMSPPKVGDESYESFSAEKDAIL  373

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ A+    APD +Y  +L
Sbjct  374  SSLARRAKILEDAFNSLEGVTCYKAEGALYSFPRINLPDKAIKAAEEAKTAPDAFYAWRL  433

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F+ +FMD++
Sbjct  434  LNATGIVVVSGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQFHKQFMDEF  485



>gb|AAK59591.2| putative alanine aminotransferase [Arabidopsis thaliana]
Length=532

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 159/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   +G    K++ LVSF +VSKGY+GECG+R
Sbjct  300  QEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDISLVSFQSVSKGYYGECGKR  358

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  359  GGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGIL  418

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  419  SSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRL  478

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  479  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  532



>ref|NP_001185380.1| alanine aminotransferase 2 [Arabidopsis thaliana]
 gb|AEE35307.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=553

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 159/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   +G    K++ LVSF +VSKGY+GECG+R
Sbjct  321  QEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDISLVSFQSVSKGYYGECGKR  379

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  380  GGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGIL  439

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  440  SSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRL  499

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  500  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  553



>ref|NP_565040.2| alanine aminotransferase 2 [Arabidopsis thaliana]
 sp|Q9LDV4.1|ALAT2_ARATH RecName: Full=Alanine aminotransferase 2, mitochondrial; Short=AtAlaAT2; 
Short=AtAlaATm; AltName: Full=Alanine-2-oxoglutarate 
aminotransferase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF82781.1|AF275371_1 alanine aminotransferase [Arabidopsis thaliana]
 gb|AAG52580.1|AC016529_11 putative alanine aminotransferase; 79592-76658 [Arabidopsis thaliana]
 gb|AEE35305.1| alanine aminotransferase 2 [Arabidopsis thaliana]
Length=540

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 159/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   +G    K++ LVSF +VSKGY+GECG+R
Sbjct  308  QEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDISLVSFQSVSKGYYGECGKR  366

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  367  GGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMAERDGIL  426

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + D  NS   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  427  SSMAKRAKTLEDALNSLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRL  486

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD++ +
Sbjct  487  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVNRLTEFHKSFMDEFRN  540



>ref|XP_010235387.1| PREDICTED: alanine aminotransferase 2-like isoform X2 [Brachypodium 
distachyon]
Length=514

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 163/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  222  EGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  280

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  281  GYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNPPKAGDESYESFMVEKDGILS  340

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G +PD YY L+LL
Sbjct  341  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGASPDAYYALRLL  400

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y +
Sbjct  401  QATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEFHEKFMDEYRE  453



>ref|XP_010939848.1| PREDICTED: alanine aminotransferase 2 isoform X1 [Elaeis guineensis]
Length=518

 Score =   248 bits (632),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY + + F S +K+   MG    K+L LVSF +VSKGY+GECG+R
Sbjct  286  KEGLVLLADEVYQENIYVENKKFNSFKKIARSMGYG-EKDLSLVSFQSVSKGYYGECGKR  344

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L++N PK GD SY+ F  E  GIL
Sbjct  345  GGYMEITGFSADVREQIYKLASVNLCSNISGQILASLVMNTPKVGDESYESFTAEKNGIL  404

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   V CN  EGAMY FP++ LP +AIE A  +  APD +Y  +L
Sbjct  405  SSLARRAKALEDAFNSLEGVTCNKAEGAMYLFPRLHLPQKAIEAANAVNAAPDAFYARRL  464

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H R TILP E  +PAI+   K F++ F+ ++ D
Sbjct  465  LDATGIVVVPGSGFGQVPGTWHFRCTILPQENKIPAIIARLKAFHESFLGEFRD  518



>ref|XP_006342898.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=487

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 158/232 (68%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +K+   MG    K++ LVSFH+ SKGY+GECG+R
Sbjct  255  KEGLVLLADEVYQENVYAPDKQFHSFKKISRSMGFG-EKDISLVSFHSASKGYYGECGKR  313

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E T   P   E+IYKVAS++L  N+ GQI   L++ PPK GD SY+ F  E + IL
Sbjct  314  GGYMEFTGFSPEIREQIYKVASVNLCSNISGQILASLIMIPPKVGDESYESFSAEKEAIL  373

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+I+ D FNS   V C   EGA+YSFP+I LP +AI+ A+    APD +Y  +L
Sbjct  374  SSLARRAKILEDAFNSLEGVTCYNAEGALYSFPRINLPDKAIKAAEEAKTAPDAFYAWRL  433

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L ATGI  V GSGFGQ+ G +H R TILP EE +PAI+  F +F+ +FMD++
Sbjct  434  LNATGIVIVLGSGFGQRPGTWHFRCTILPQEEKIPAIVSRFTQFHKQFMDEF  485



>ref|XP_008157904.1| PREDICTED: alanine aminotransferase 1 [Eptesicus fuscus]
Length=496

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 159/231 (69%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ N+Y +   F S +KVL++MGPP S + +L SFH+VSKGY GECG RG
Sbjct  265  ERLFLMADEVYQDNVYAEGSQFHSFKKVLMEMGPPYSTQQELASFHSVSKGYMGECGLRG  324

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P +PGQ+ L ++V+PP+P D S+ QF  E + +L 
Sbjct  325  GYVEVVNMDPAVQQQMQKLMSVRLCPPLPGQVVLDMVVSPPEPSDPSFTQFQAEKQAVLA  384

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
             L  +A++    FN    + CN  +GAMYSFP+I+LPPRAI  A+ LG APD+++CL+LL
Sbjct  385  QLAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRIQLPPRAIRRAKELGLAPDMFFCLRLL  444

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ+EG +H R TILPA E +  ++E   +F+ +F  +Y
Sbjct  445  EETGICVVPGSGFGQREGTYHFRMTILPAMEKLRPLLEKLSQFHAKFTREY  495



>ref|XP_006746371.1| PREDICTED: alanine aminotransferase 1 [Leptonychotes weddellii]
Length=295

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 156/231 (68%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ N+Y +   F S +KVL +MGPP + + +L SFH+VSKGY GECG RG
Sbjct  64   ERLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRG  123

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQ+ L ++V+PP P D S+ QF  E + +L 
Sbjct  124  GYVEVVNMDPAVQQQMQKLMSVRLCPPVPGQVLLSMVVSPPAPSDPSFAQFQAERQVVLA  183

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
             L  +A++    FN    + CN  +GAMYSFP+++LPPRA++ AQ LG APD+++C+ LL
Sbjct  184  ELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQLPPRAVQRAQELGLAPDMFFCMSLL  243

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ+EG +H R TILP  E +  ++E   +F+ +F  +Y
Sbjct  244  EETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREY  294



>ref|XP_007217248.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
 gb|EMJ18447.1| hypothetical protein PRUPE_ppa003850mg [Prunus persica]
Length=544

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  312  QEGLVLLADEVYQENVYVPDKEFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYYGECGKR  370

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T I P   E+IYKVAS++L  N+ GQI   L+++PPK GD SY+ +  E  GIL
Sbjct  371  GGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYELYCAEKDGIL  430

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ A+    APD +YC +L
Sbjct  431  SSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKAAEAANTAPDAFYCRRL  490

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD++ D
Sbjct  491  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMDEFRD  544



>ref|XP_001745052.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90285.1| predicted protein [Monosiga brevicollis MX1]
Length=480

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 163/232 (70%), Gaps = 2/232 (1%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            ++  VL  DEVYQ NIY D RPF+S RKV+ ++G   ++ ++  SFHTVSKG +GECG+R
Sbjct  243  KQRVVLFADEVYQTNIYGD-RPFISFRKVIKELGAD-AQGIECFSFHTVSKGVFGECGRR  300

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+  I P + E++YK+ SI+LS NV GQ+ +GLM +PP+PGD SY  F  E   I 
Sbjct  301  GGYVELLGIHPSAREQLYKLFSINLSSNVDGQLMVGLMCSPPRPGDASYPTFTTECDAIF  360

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SL++RA ++T+ FN    + C   EGA+Y+FPQI+L  RA   A+  G A DV YC++L
Sbjct  361  QSLKRRAAMVTEAFNRLPFISCRNVEGALYAFPQIQLSKRACAEAEKRGVAADVLYCMEL  420

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L+ TGI  VPGSGFGQ++G FH RTTILP EE   +I++ F  F+ +FMD+Y
Sbjct  421  LDETGICAVPGSGFGQRDGTFHFRTTILPPEEQFESILQLFADFHLKFMDRY  472



>ref|XP_002681562.1| alanine aminotransferase [Naegleria gruberi]
 gb|EFC48818.1| alanine aminotransferase [Naegleria gruberi]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 164/231 (71%), Gaps = 4/231 (2%)
 Frame = -3

Query  751  VLLGDEVYQQNIYQD-ERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGY  575
            VLL DEVYQ+N Y + ++PF S  K+  +MG  + KEL++VSFH+VSKG+ GECG+RGGY
Sbjct  264  VLLADEVYQENNYTNGKKPFYSFNKIAYEMG--LQKELEMVSFHSVSKGFIGECGRRGGY  321

Query  574  FEMTN-IPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILES  398
            F+++  I P   EE+YK++S++L PN  GQI + LMV PP  G+ SY ++V E   IL S
Sbjct  322  FQLSEAIDPAVKEELYKISSVNLCPNADGQIMVDLMVRPPSQGEASYQEYVAERDNILNS  381

Query  397  LRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLE  218
            L++RA  +    NS   V C   EGAMY+FPQI LP +AI+ A+ +G APD+ Y L+LLE
Sbjct  382  LKRRAEKLVKMLNSLEGVSCQPVEGAMYAFPQITLPEKAIQKAKEMGVAPDLMYVLELLE  441

Query  217  ATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
             TGI  VPGSGF QK G +H RTTILP+EE +  ++++  KF+D+FM QY+
Sbjct  442  ETGICVVPGSGFQQKPGTYHFRTTILPSEEQIEGVVQTLAKFHDKFMKQYK  492



>ref|XP_009557985.1| PREDICTED: alanine aminotransferase 2-like [Cuculus canorus]
Length=422

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 157/231 (68%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ N+Y     F S +KVL +MGPP S+ ++L SFH+VSKG+ GECG RG
Sbjct  191  EKLFLMADEVYQDNVYAKGSAFHSFKKVLFEMGPPYSEVVELASFHSVSKGFMGECGFRG  250

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQI L  ++NPP+PG+ SY+ F++E + +L 
Sbjct  251  GYVEVVNMDPEVKQQLAKLVSVRLCPPVPGQILLDTVINPPQPGEPSYELFMKEKQEVLS  310

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +A +  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C++LL
Sbjct  311  TLAHKAHLTQEIFNRTPGIRCNPVQGAMYSFPRIELPPRAVAAAEAQGQAPDMFFCIRLL  370

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ++G FH R TILP  E +  ++E    F  +F+  Y
Sbjct  371  EETGICVVPGSGFGQRQGTFHFRMTILPPTEKLQILLEKLSTFYTKFIKDY  421



>ref|XP_008228107.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Prunus 
mume]
Length=544

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  312  QEGLVLLADEVYQENVYVPDKEFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYYGECGKR  370

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T I P   E+IYKVAS++L  N+ GQI   L+++PPK GD SY+ +  E  GIL
Sbjct  371  GGYMEVTGISPDVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYELYCAEKDGIL  430

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  N+   V CN  EGAMY FP+I LP +AI+ A+    APD +YC +L
Sbjct  431  SSLARRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPQKAIKAAEAANTAPDAFYCRRL  490

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD++ D
Sbjct  491  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMDEFRD  544



>gb|ADE77246.1| unknown [Picea sitchensis]
Length=329

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y D + F S +K+   MG    K++ LVSF +VSKGY+GECG+RG
Sbjct  98   EGLVLLADEVYQENVYVDNKKFHSFKKIARSMGYG-EKDICLVSFQSVSKGYYGECGRRG  156

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       +++YKVAS++L  N+ GQI   L++NPPK GD S++ F  E  GIL 
Sbjct  157  GYMEVTGFDNNIKDQLYKVASVNLCSNISGQILASLVMNPPKSGDESFEMFFAERDGILS  216

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D  N    V CN  EGAMY FP+I LP +AI+ A+ +   PD +Y  +LL
Sbjct  217  SLARRAKTLVDALNQLEGVTCNEAEGAMYVFPRIHLPQQAIKAAEAVNMVPDAFYSQRLL  276

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            EATGI TVPGSGFGQ  G +H R+TILP E+ +P I+     F+ +FM+++ D
Sbjct  277  EATGIVTVPGSGFGQVPGTWHFRSTILPPEDKIPTIVSRMTTFHQKFMEEFHD  329



>ref|XP_004166923.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like, partial 
[Cucumis sativus]
Length=493

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG   ++++ LVSF +VSKGY+GECG+R
Sbjct  261  QEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYG-NEDIALVSFQSVSKGYYGECGKR  319

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  320  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGIL  379

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC +L
Sbjct  380  SSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRL  439

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  440  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  493



>ref|XP_010415979.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 159/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +K    +G    K++ LVSF +VSKGY+GECG+R
Sbjct  316  QEGLVLLADEVYQENLYVPDKKFHSFKKFARSLGYG-EKDMSLVSFQSVSKGYYGECGKR  374

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  375  GGYMEVTGFTPDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGIL  434

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  435  SSMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRISLPQKAIEAAEAEKTAPDAFYCKRL  494

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI++    F+  FMD++ D
Sbjct  495  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVDRLTAFHKSFMDEFRD  548



>ref|XP_008462239.1| PREDICTED: alanine aminotransferase 1, mitochondrial [Cucumis 
melo]
Length=488

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  256  QEGLVLLADEVYQENIYVPDKKFHSFKKISRTMGYG-EKDISLVSFQSVSKGYYGECGKR  314

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD+ Y  +  E  GIL
Sbjct  315  GGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKDGDLIYKSYCAERDGIL  374

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ A+    APD +YC +L
Sbjct  375  SSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKAAEAANTAPDTFYCRQL  434

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F+  FM++Y D
Sbjct  435  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDFHKAFMNEYRD  488



>ref|XP_011072689.1| PREDICTED: alanine aminotransferase 2 [Sesamum indicum]
Length=547

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +KV   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  315  KEGLVLLADEVYQENIYVPDKQFHSFKKVARSMGYG-EKDISLVSFQSVSKGYYGECGKR  373

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ +  E   IL
Sbjct  374  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESYESYSAEKDAIL  433

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + + FN    V CN  EGAMY FP+I+LP +AIE A+ +  APD +Y  +L
Sbjct  434  SSLARRAKKLEEAFNGLEGVTCNRAEGAMYLFPRIQLPKKAIEAAKAVNTAPDAFYARRL  493

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+  FMD++ D
Sbjct  494  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDRIPAIISRLTEFHKGFMDEFRD  547



>ref|XP_006342897.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Solanum 
tuberosum]
Length=545

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 160/232 (69%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKG++GECG+R
Sbjct  313  KEGLVLLADEVYQENVYVPEKQFHSFKKVARSMGFG-EKDISLVSFQSVSKGFYGECGKR  371

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK GD SY+ F  E +GIL
Sbjct  372  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESFAAEKEGIL  431

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D F++   V CN  EGAMY FP+I LP +AI+ A+    APD +Y  +L
Sbjct  432  SSLARRAKTLEDAFSNLEGVTCNKAEGAMYLFPRINLPNKAIKAAEEAKTAPDAFYARRL  491

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L ATGI  VPGSGFGQ+ G +H R TILP EE +PAI+    +F+ +FMD++
Sbjct  492  LNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSRLTEFHKQFMDEF  543



>ref|XP_004303756.1| PREDICTED: alanine aminotransferase 2 [Fragaria vesca subsp. 
vesca]
Length=541

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 160/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   MG     ++ LVSF +VSKGY+GECG+R
Sbjct  309  QEGLVLLADEVYQENVYVPDKEFHSFKKVTRSMGYG-ENDIALVSFQSVSKGYYGECGKR  367

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYK+AS++L  N+ GQI   L+++PPK GD SY+ ++ E  GIL
Sbjct  368  GGYMEVTGFSPEVREQIYKMASVNLCSNISGQILSSLVMSPPKVGDESYELYLSEKDGIL  427

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA+ + D  NS   V CN  EGAMY FP+I LP +AI  A+    APD +YC +L
Sbjct  428  SSLKRRAKTLEDALNSLEGVTCNRAEGAMYLFPRIELPQKAIHAAEAAKTAPDAFYCKRL  487

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PA+++   +F+ +FMD++ D
Sbjct  488  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVVDRLTEFHKKFMDEFRD  541



>ref|XP_006828623.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
 gb|ERM96039.1| hypothetical protein AMTR_s00129p00080070 [Amborella trichopoda]
Length=405

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 159/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY D++ F S +K+   MG    +++ LVSF +VSKGY+GECG+R
Sbjct  173  KEGLVLLADEVYQENIYVDDKKFDSFKKISRSMGYG-EEDIALVSFQSVSKGYYGECGKR  231

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L+++PPKPGD S++ F  E  GIL
Sbjct  232  GGYMEVTGFSRDVKEQIYKVASVNLCSNISGQILASLVMSPPKPGDESFESFTAERDGIL  291

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ +   FNS   V CN  EGAMY FP++ LP +AI+ A+ L  APD YY  +L
Sbjct  292  SSLARRAKALEKAFNSLEGVTCNRAEGAMYLFPRLHLPAKAIKAAEALNVAPDAYYTHRL  351

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L+ATGI  VPGSGFGQ  G +H+R TILP E+ + A++  F  F++  + ++ D
Sbjct  352  LDATGIVAVPGSGFGQVPGTWHVRYTILPQEDKIAAVVSKFTAFHEALIAEFRD  405



>ref|XP_004144444.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
Length=528

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG   ++++ LVSF +VSKGY+GECG+R
Sbjct  296  QEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYG-NEDIALVSFQSVSKGYYGECGKR  354

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  355  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGIL  414

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC +L
Sbjct  415  SSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRL  474

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  475  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  528



>ref|XP_008460348.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like isoform 
X2 [Cucumis melo]
Length=513

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG   ++++ LVSF +VSKGY+GECG+R
Sbjct  281  QEGLVLLADEVYQENIYVPDKKFHSFKKISRSMGYG-NEDIALVSFQSVSKGYYGECGKR  339

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  340  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGIL  399

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC +L
Sbjct  400  SSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRL  459

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  460  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  513



>ref|XP_006426798.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40038.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=533

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 157/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKGY GECG+R
Sbjct  301  KEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYHGECGKR  359

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK GD SY+ +  E  GIL
Sbjct  360  GGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGIL  419

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ A+     PD +YC +L
Sbjct  420  SSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKAAEAEKTVPDAFYCRRL  479

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD++ +
Sbjct  480  LNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMDKFRN  533



>ref|XP_006426797.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
 gb|ESR40037.1| hypothetical protein CICLE_v10025334mg [Citrus clementina]
Length=529

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 157/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKGY GECG+R
Sbjct  297  KEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-EKDISLVSFQSVSKGYHGECGKR  355

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L+++PPK GD SY+ +  E  GIL
Sbjct  356  GGYMEVTGFSPEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGIL  415

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FNS   + CN  EGAMY FP+I+LP +AI+ A+     PD +YC +L
Sbjct  416  SSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPEKAIKAAEAEKTVPDAFYCRRL  475

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+     F+  FMD++ +
Sbjct  476  LNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKSFMDKFRN  529



>gb|KHG30536.1| Alanine aminotransferase 2, mitochondrial -like protein [Gossypium 
arboreum]
Length=482

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y  E+ F S +KV   MG    K++ LVSF +VSKGY+GECG+RG
Sbjct  251  EGLVLLADEVYQENVYVPEKKFHSFKKVARSMGYG-EKDIHLVSFQSVSKGYYGECGKRG  309

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E IYK+AS++L  N+ GQI   L+++PPK GD SY+ ++ E  GIL 
Sbjct  310  GYMEVTGFGADVREHIYKLASVNLCSNITGQILASLVMSPPKVGDKSYESYIAERDGILS  369

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FN    + CN  EGAMY FP+I LP +AI+ A+ +  APD++YC +LL
Sbjct  370  SLARRAKTLEDAFNKLEGITCNKAEGAMYLFPRINLPKKAIKAAEEVKTAPDLFYCRRLL  429

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
              TGI  VPGSGFGQ  G +H R TILP EE +PAI+     F+  FMD++ D
Sbjct  430  NETGIVFVPGSGFGQVPGTWHFRCTILPQEEKIPAIVTRLTDFHKRFMDEFRD  482



>gb|KFO75258.1| Alanine aminotransferase 2, partial [Cuculus canorus]
Length=442

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 157/231 (68%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E   L+ DEVYQ N+Y     F S +KVL +MGPP S+ ++L SFH+VSKG+ GECG RG
Sbjct  211  EKLFLMADEVYQDNVYAKGSAFHSFKKVLFEMGPPYSEVVELASFHSVSKGFMGECGFRG  270

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQI L  ++NPP+PG+ SY+ F++E + +L 
Sbjct  271  GYVEVVNMDPEVKQQLAKLVSVRLCPPVPGQILLDTVINPPQPGEPSYELFMKEKQEVLS  330

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L  +A +  + FN    + CN  +GAMYSFP+I LPPRA+  A+  G+APD+++C++LL
Sbjct  331  TLAHKAHLTQEIFNRTPGIRCNPVQGAMYSFPRIELPPRAVAAAEAQGQAPDMFFCIRLL  390

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQ++G FH R TILP  E +  ++E    F  +F+  Y
Sbjct  391  EETGICVVPGSGFGQRQGTFHFRMTILPPTEKLQILLEKLSTFYTKFIKDY  441



>gb|KGN58474.1| hypothetical protein Csa_3G646610 [Cucumis sativus]
Length=535

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG   ++++ LVSF +VSKGY+GECG+R
Sbjct  303  QEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYG-NEDIALVSFQSVSKGYYGECGKR  361

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  362  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGIL  421

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC +L
Sbjct  422  SSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRL  481

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  482  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  535



>ref|XP_010428116.1| PREDICTED: alanine aminotransferase 2, mitochondrial [Camelina 
sativa]
Length=549

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 158/233 (68%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+N+Y  ++ F S +KV   +G    +++ LVSF +VSKGY+GECG+RG
Sbjct  318  EGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EQDMSLVSFQSVSKGYYGECGKRG  376

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL 
Sbjct  377  GYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGILS  436

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            S+ KRA+ + +  N+   V CN  EGAMY FP+I LP +AIE A+    APD +YC +LL
Sbjct  437  SMAKRAKTLEEALNNLEGVTCNRAEGAMYLFPRINLPQKAIEAAEAEKTAPDAFYCKRLL  496

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
             ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+E    F+  FMD++ D
Sbjct  497  NATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVERLTAFHKSFMDEFRD  549



>ref|XP_005775483.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
 gb|EOD23054.1| alanine aminotransferase [Emiliania huxleyi CCMP1516]
Length=541

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 156/237 (66%), Gaps = 7/237 (3%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +   VL+ DEVYQ+NI+   RPF S +KVL++M P     LQLVSFH+ SKG+ GECG R
Sbjct  306  KHGLVLMADEVYQENIWDGGRPFHSFKKVLMEMSP--RPNLQLVSFHSTSKGFLGECGLR  363

Query  583  GGYFEMTNIPPRSVEEIYKVASI-----SLSPNVPGQIFLGLMVNPPKPGDISYDQFVRE  419
            GGYFE+    P    ++ K+ SI     +L P+  GQI  GLMV PP+PGD SY+ +  E
Sbjct  364  GGYFEIVGFDPEVKAQLLKLISIGLCSNTLGPDRSGQIATGLMVQPPRPGDASYEIYSGE  423

Query  418  GKGILESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVY  239
               IL S+++RA ++ DG N+   V CN  +GAMY+FP I LPP+AI  A+  GK PD +
Sbjct  424  RDAILASMKRRATMLVDGLNALEGVTCNQPQGAMYAFPSITLPPKAIAAAKDAGKVPDTF  483

Query  238  YCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            Y L LLEATGI  VPGSGFGQKEG +H RTT LP E +M  +++    F+ +FM +Y
Sbjct  484  YALALLEATGIVVVPGSGFGQKEGTWHFRTTFLPPESEMTDVVDRMTAFHADFMGKY  540



>emb|CDJ93113.1| Aminotransferase domain containing protein [Haemonchus contortus]
Length=505

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 1/233 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            R N  L+ DEVYQ NIY     F S +KV+ +MG P + +++L SFH+VSKGY GECG R
Sbjct  274  RHNLFLMADEVYQDNIYAPGSKFHSFKKVINEMGAPYN-QMELASFHSVSKGYMGECGMR  332

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E  N+ P       K+ S  L   + GQ+ +  +VNPPKPGD SYDQ+++E   +L
Sbjct  333  GGYVEFFNLDPEVYVLFKKMISAKLCSTILGQVMMDALVNPPKPGDPSYDQWLKEKNAVL  392

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA ++ + + S   + CN  +GAMY+FPQ+ LPPRA+E A+ L   PD +Y ++L
Sbjct  393  ASLKERATLVKEAYGSIEGIKCNEVQGAMYAFPQLMLPPRAVEKARSLNMEPDFFYAMQL  452

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYE  65
            LE+TG+  VPGSGFGQKEG +H RTTILP  E M  ++E FK F+ +FM++Y+
Sbjct  453  LESTGVCIVPGSGFGQKEGTYHFRTTILPQTEMMKDMLERFKSFHTKFMEEYK  505



>emb|CEP13768.1| hypothetical protein [Parasitella parasitica]
Length=510

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/234 (53%), Positives = 151/234 (65%), Gaps = 2/234 (1%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDER-PFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            E  VLL DEVYQ NIYQ ER PF S +KVL  MGP   +E +L SFH+ SKG  GECG+R
Sbjct  278  ERIVLLADEVYQTNIYQPERRPFHSFKKVLKSMGPEY-QEQELFSFHSTSKGMIGECGRR  336

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFE  NI P  +E++YK++SISL PNV GQI + LM NPP  GD+SY Q+  E   I 
Sbjct  337  GGYFECVNIDPAIMEQLYKISSISLCPNVHGQIMVDLMTNPPVEGDVSYPQYKAEIDAIF  396

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
            +SL +RA  +   FN    V CN  EGAMY FPQI LP +AIE A+  G  PD +Y + +
Sbjct  397  QSLGRRATKLAKCFNGLEGVTCNSAEGAMYLFPQITLPKKAIEAAEQKGMTPDSFYAMGM  456

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            LEATG+  +PGSGFGQ  G FH R+T LP E        S + F+  FM+ Y D
Sbjct  457  LEATGVCVIPGSGFGQAPGTFHFRSTFLPEENLFDKFCGSLEDFHKSFMNNYRD  510



>ref|XP_008460347.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Cucumis 
melo]
Length=530

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG   ++++ LVSF +VSKGY+GECG+R
Sbjct  298  QEGLVLLADEVYQENIYVPDKKFHSFKKISRSMGYG-NEDIALVSFQSVSKGYYGECGKR  356

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKVAS++L  N+ GQI   L++NPPK GD S++ +  E  GIL
Sbjct  357  GGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGIL  416

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D  NS   V CN  EGAMY FP+I LP +AI+ A+ +  +PD +YC +L
Sbjct  417  SSLARRAKALEDALNSLEGVKCNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRL  476

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+ +FM+++ D
Sbjct  477  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD  530



>ref|XP_010490704.1| PREDICTED: glutamate--glyoxylate aminotransferase 1-like [Camelina 
sativa]
Length=202

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 137/198 (69%), Gaps = 25/198 (13%)
 Frame = -3

Query  694  LSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGYFEMTNIPPRSVEEIYKVASI  515
            +SS+KVLLDMG P SKE+QLVSFHTVSKGYW    +RGGYFEMTNIPPR VEEIYKVASI
Sbjct  1    MSSKKVLLDMGSPFSKEVQLVSFHTVSKGYWT--ARRGGYFEMTNIPPRVVEEIYKVASI  58

Query  514  SLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESLRKRARIMTDGFNSCRNVVCN  335
            + SPNV  QIF+GLMV+PPKPGDI YDQF RE KGILESLR+RA+I+TDGFNSC+ VVC 
Sbjct  59   AFSPNVSAQIFMGLMVSPPKPGDILYDQFARESKGILESLRRRAKIVTDGFNSCKTVVCQ  118

Query  334  FTEG-----------------------AMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
              +                        AMYSFPQIRLP  A++ A+  GK PDV+YCL L
Sbjct  119  RNKAIKAVQFRDFDTVLDDSCVSQMLIAMYSFPQIRLPAGALQAAKQAGKVPDVFYCLWL  178

Query  223  LEATGISTVPGSGFGQKE  170
               T    VP     ++ 
Sbjct  179  CIWTERRCVPSEDTSRRR  196



>ref|XP_009515719.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
 gb|EGZ28444.1| hypothetical protein PHYSODRAFT_477603 [Phytophthora sojae]
Length=499

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 165/231 (71%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            EN ++L DEVYQ+N+Y + + F+S +KVL DMG     +++L+SFH+ SKG+ GECG+RG
Sbjct  269  ENILILADEVYQENVYAEGKKFVSFKKVLRDMGKAYD-DVELISFHSTSKGFTGECGRRG  327

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ NI   + ++ YK+ S++L  NV GQ+ +GLM NPP+PGD SY +++ +  G LE
Sbjct  328  GYMELVNIDDGAKDQFYKLMSVNLCSNVEGQLMVGLMTNPPQPGDASYKRYIEQRDGTLE  387

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            +L++RA  +    N    V CN TEGAMY+FP+I +P +A+E A+  G APD +YC+++L
Sbjct  388  ALKRRAVKLVKACNELEGVTCNETEGAMYTFPKITIPAKAVEAAKAAGMAPDAFYCMQML  447

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            + TGI  VPGSGFGQKEG +H R+TILP EE +  ++E   KF+  FMD+Y
Sbjct  448  DETGIVVVPGSGFGQKEGTWHFRSTILPPEEAVDEVIEKTVKFHANFMDKY  498



>ref|XP_005852218.1| hypothetical protein CHLNCDRAFT_29318 [Chlorella variabilis]
 gb|EFN60116.1| hypothetical protein CHLNCDRAFT_29318 [Chlorella variabilis]
Length=507

 Score =   245 bits (626),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 164/235 (70%), Gaps = 0/235 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VL+ DEVYQ NIY   + F S +KVL++MGP     + LVS +++SKG++GECG+R
Sbjct  270  QECLVLIADEVYQTNIYAAGKEFFSFKKVLMEMGPEYKDSVALVSMNSISKGFFGECGRR  329

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGYFE  N P    E++YK+ASISL PN+ GQI + L++NPPKPGD SY+   +E   IL
Sbjct  330  GGYFECVNFPTAVKEQLYKLASISLCPNLSGQICMALIMNPPKPGDPSYELHTQERDAIL  389

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA ++ + F+S   V CN  EG+MY+FP++ +P  A E A   GK  D  YC++L
Sbjct  390  SSLKRRAELVKNTFDSLEGVSCNPVEGSMYAFPRLTMPAGAKEAAAAEGKQADFLYCMEL  449

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            L+ TGI TVPGSGFGQ+ G FH+RTTILP E DM A+   F +F+  FM++Y+ +
Sbjct  450  LDHTGIVTVPGSGFGQEAGTFHVRTTILPPESDMAAVATKFSEFHQAFMNKYKKN  504



>ref|XP_010235383.1| PREDICTED: alanine aminotransferase 2-like isoform X1 [Brachypodium 
distachyon]
Length=599

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/233 (53%), Positives = 163/233 (70%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY +++ F S +K+   MG     +L LVSF +VSKGY+GECG+RG
Sbjct  307  EGLVLLADEVYQENIYVEDKQFHSFKKIARSMGY-TDDDLPLVSFQSVSKGYYGECGKRG  365

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD SY+ F+ E  GIL 
Sbjct  366  GYMEVTGFSADVREQIYKVASVNLCSNIGGQILSSLVMNPPKAGDESYESFMVEKDGILS  425

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + + FNS   + CN  EGAMY FP++ LP +AI  AQ  G +PD YY L+LL
Sbjct  426  SLARRAKALEEAFNSLEGITCNKAEGAMYLFPRLHLPQKAIGAAQAAGASPDAYYALRLL  485

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            +ATGI  VPGSGFGQ  G +H R TILP E+ +PAI+  FK+F+++FMD+Y +
Sbjct  486  QATGIVVVPGSGFGQAPGTYHFRCTILPQEDKIPAIISRFKEFHEKFMDEYRE  538



>ref|XP_004510570.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cicer 
arietinum]
Length=531

 Score =   246 bits (627),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 157/234 (67%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  E+ F S +KV   MG     ++ LVSF +VSKGY GECG+R
Sbjct  299  QEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYG-DDDISLVSFQSVSKGYHGECGKR  357

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYKV+S++L  N+ GQI   L+++PPK GD SY+ F+ E   IL
Sbjct  358  GGYMEVTGFSPDVREQIYKVSSVNLCSNITGQILASLVMSPPKVGDESYESFMAEKGSIL  417

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL  RA+ + +  N    V CN  EGAMY FPQIRLP +AIE A+    APD +YC +L
Sbjct  418  SSLATRAKSLEEALNKLEGVTCNKAEGAMYLFPQIRLPKKAIEAAEAENTAPDAFYCKRL  477

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ +PAI+    +F+++FMD++ D
Sbjct  478  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTEFHEKFMDEFRD  531



>ref|XP_004141733.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Cucumis 
sativus]
 gb|KGN45438.1| hypothetical protein Csa_7G448000 [Cucumis sativus]
Length=488

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 155/234 (66%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+NIY  ++ F S +K+   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  256  QEGLVLLADEVYQENIYVPDKKFHSFKKIARTMGYG-EKDISLVSFQSVSKGYYGECGKR  314

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYKVAS++L  N+ GQI   L++NPPK GD+ Y  +  E  GIL
Sbjct  315  GGYMEITGFSADVREQIYKVASVNLCSNITGQILASLVMNPPKDGDLIYKSYCAERDGIL  374

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+++    NS  NV CN  EGAMY FP I+LP +AI+ A+     PD +YC +L
Sbjct  375  SSLARRAKMLEAALNSLENVTCNKAEGAMYLFPCIKLPVKAIKAAEAANTVPDTFYCRQL  434

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATGI  VPGSGFGQ  G +H R TILP E+ +PA++     F+  FM++Y D
Sbjct  435  LNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRLTDFHKAFMNEYRD  488



>gb|KGB32667.1| Alanine aminotransferase 2 [Schistosoma haematobium]
Length=493

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 158/229 (69%), Gaps = 1/229 (0%)
 Frame = -3

Query  751  VLLGDEVYQQNIYQ-DERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRGGY  575
            +L+ DEVYQQN+YQ D+ P++S +KVL +MGP  S +L+L S  + SKGY GECG RGGY
Sbjct  264  ILIADEVYQQNVYQPDKYPWVSFKKVLFNMGPSYSGKLELASLMSCSKGYMGECGYRGGY  323

Query  574  FEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILESL  395
             E+ N  P    ++YK  S  L P + GQ+ L  +VNPPKPG+ SY  FV+E   +L +L
Sbjct  324  CELLNFDPAVQAQLYKALSARLCPPLMGQVALEAIVNPPKPGEASYSLFVKERDDVLSAL  383

Query  394  RKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLLEA  215
            + +A I     NS  N+ CN  +GAMY+FP+I LPP+AI+ A+  G+APD +YCL+LLE 
Sbjct  384  KDKADITYSALNSMPNMSCNPVQGAMYAFPRIHLPPKAIQEAKRRGEAPDFFYCLQLLEE  443

Query  214  TGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
             GI  VPGSGFGQ+EG +H RTTILP+ E M  +M+  ++F+  FM +Y
Sbjct  444  KGICVVPGSGFGQQEGTYHFRTTILPSVEKMKYVMKQVEEFHISFMKKY  492



>gb|ETI43741.1| hypothetical protein F443_11357 [Phytophthora parasitica P1569]
Length=491

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/235 (47%), Positives = 167/235 (71%), Gaps = 1/235 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +EN ++L DEVYQ+N+Y + + F S +KVL DMG     +++L+SFH+ SKG+ GECG+R
Sbjct  253  KENILILADEVYQENVYAEGKKFFSFKKVLRDMGKEYD-DVELISFHSTSKGFTGECGRR  311

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+ NI   + ++ YK+ S++L  N+ GQ+ +G+M NPP+PGD SY +++ +  G L
Sbjct  312  GGYMELVNIDEGAKDQFYKLMSVNLCSNIEGQLMVGMMTNPPQPGDASYQRYIEQRDGTL  371

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL++RA  +   FN+   + CN TEGA+Y+FP I LP +A+E A+  G APD +YC+++
Sbjct  372  HSLKRRAIKLVKAFNNLEGITCNETEGALYTFPSISLPAKAVEAAKEAGMAPDAFYCMQM  431

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYEDH  59
            L+ TGI  VPGSGFGQK G +H R+TILP EE +  ++E   KF+ +FMD+Y ++
Sbjct  432  LDETGIVVVPGSGFGQKAGTWHFRSTILPPEEAVDEVIEKTAKFHAKFMDKYREN  486



>ref|XP_001372290.1| PREDICTED: alanine aminotransferase 1 isoform X1 [Monodelphis 
domestica]
 ref|XP_007488863.1| PREDICTED: alanine aminotransferase 1 isoform X3 [Monodelphis 
domestica]
 ref|XP_007488864.1| PREDICTED: alanine aminotransferase 1 isoform X4 [Monodelphis 
domestica]
 ref|XP_007488865.1| PREDICTED: alanine aminotransferase 1 isoform X5 [Monodelphis 
domestica]
 ref|XP_007488866.1| PREDICTED: alanine aminotransferase 1 isoform X6 [Monodelphis 
domestica]
Length=487

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 159/231 (69%), Gaps = 0/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E+  LL DEVYQ N+Y +   F S +KVL++MG P S++L+L SFH+ SKGY GECG RG
Sbjct  256  EHLFLLADEVYQDNVYAEGSKFHSFKKVLMEMGSPYSEQLELASFHSCSKGYMGECGFRG  315

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N+ P   +++ K+ S+ L P VPGQ  + ++VNPP+PG+ SY QF +E K +L 
Sbjct  316  GYTEVVNMDPAVQQQMLKLMSVMLCPPVPGQALMNMVVNPPQPGEPSYQQFQKEKKTVLA  375

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
             L ++A +    FN    + CN  +GAMYSFPQI+LPP+A+E A+ LG+A D+++C++LL
Sbjct  376  DLMEKALLTEKIFNQQPGIRCNPVQGAMYSFPQIQLPPKALERAKELGQAADMFFCMQLL  435

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            E TGI  VPGSGFGQKEG +H R T+LP  E +  ++    +F  +F  QY
Sbjct  436  EETGICVVPGSGFGQKEGTYHFRMTLLPPMEKLKTLLNKLSQFYVKFTQQY  486



>gb|KDO24164.1| hypothetical protein SPRG_10592 [Saprolegnia parasitica CBS 223.65]
Length=489

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 157/231 (68%), Gaps = 1/231 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VL+ DEVYQ+N+Y + + F+S +KVL DMG      ++L SFH+ SKG+ GECG+RG
Sbjct  259  EKLVLMADEVYQENVYAENKHFVSFKKVLKDMGSDYDC-VELASFHSTSKGFTGECGRRG  317

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+ N    ++E++YK+ SI+L  N+ GQ+ + LM NPP  GD SY+ +V +  GIL 
Sbjct  318  GYMELVNFNADAMEQLYKLVSINLCSNIEGQLMVALMTNPPVEGDESYELYVAQRDGILS  377

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL++RA  +   FN    V CN  EGAMY+FP+I +P +A+  A   G APD +Y + LL
Sbjct  378  SLKRRAVKLVAAFNELEGVSCNAAEGAMYTFPRITVPEKAVAEATKRGVAPDAFYAMALL  437

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            +ATGI  VPGSGFGQ++G FH R+TILP EE +  ++E   KF+ EFMD Y
Sbjct  438  DATGIVVVPGSGFGQEDGTFHFRSTILPPEEAIDEVIEKTAKFHAEFMDLY  488



>ref|XP_011079322.1| PREDICTED: alanine aminotransferase 2-like [Sesamum indicum]
Length=542

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/233 (52%), Positives = 157/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY  ++ F S +KV   MG    K++ LVSF +VSKGY+GECG+RG
Sbjct  311  EGLVLLADEVYQENIYVPDKQFHSFKKVARSMGYG-EKDISLVSFQSVSKGYYGECGKRG  369

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T   P   E+IYK+AS++L  N+ GQI   L++NPPK GD SY+ ++ E   IL 
Sbjct  370  GYMEVTGFSPEIREQIYKLASVNLCSNISGQILASLVMNPPKVGDESYESYLAEKDAILS  429

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ + D FNS + V CN  EGAMY FP I LP +AIE A+ +  APD +Y  +LL
Sbjct  430  SLARRAKQLEDAFNSLKGVTCNRAEGAMYLFPCIDLPKKAIEAAKAVSTAPDAFYARRLL  489

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
             ATGI  VPGSGF Q  G +H R TILP E+ +PAI+    KF+  FMD++ D
Sbjct  490  NATGIVVVPGSGFRQVPGTWHFRCTILPQEDKIPAIVSRLTKFHKGFMDEFCD  542



>gb|EMT23015.1| Alanine aminotransferase 2 [Aegilops tauschii]
Length=508

 Score =   245 bits (625),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -3

Query  760  ENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQRG  581
            E  VLL DEVYQ+NIY D + F S +K++  +G    ++L LVS+ +VSKGY+GECG+RG
Sbjct  277  EGLVLLADEVYQENIYADNKKFHSFKKIVRSLGYG-EEDLPLVSYQSVSKGYYGECGKRG  335

Query  580  GYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGILE  401
            GY E+T       E+IYK+AS++L  N+ GQI   L++NPPK  D SY  +  E  GIL 
Sbjct  336  GYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASYKAEKDGILA  395

Query  400  SLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKLL  221
            SL +RA+ +   F+    + CN  EGAMY FPQI LP +AIE A+   KAPD +Y L+LL
Sbjct  396  SLARRAKALEVAFSKLEGITCNKAEGAMYLFPQICLPQKAIEAAKAANKAPDAFYALRLL  455

Query  220  EATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            E+TGI  VPGSGFGQ  G +H R TILP EE +PAI+  F  F++ FM +Y D
Sbjct  456  ESTGIVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIISRFTVFHETFMAEYRD  508



>gb|EYU45916.1| hypothetical protein MIMGU_mgv1a005454mg [Erythranthe guttata]
Length=483

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 157/232 (68%), Gaps = 1/232 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            RE  VLL DEVYQ+N+Y  ++ F S ++V   MG    K++ LVSF +VSKGY+GECG+R
Sbjct  251  REGLVLLADEVYQENVYVPDKQFHSFKEVARSMGYG-DKDIALVSFQSVSKGYYGECGKR  309

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T   P   E+IYK+AS++L  N+ GQI   L++NPPK GD SYD +  E   IL
Sbjct  310  GGYMEITGFSPEIREQIYKLASVNLCSNISGQILASLVMNPPKVGDESYDSYFAEKNAIL  369

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             SL +RA+ + D FN    V CN  EGAMY FP+I LP +A+E A+    APD +Y  +L
Sbjct  370  SSLARRAQKLEDAFNGLEGVSCNRAEGAMYLFPRIVLPNKALEAAKEAKTAPDAFYARRL  429

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQY  68
            L ATGI  VPGSGFGQ +G +H+R TILP E+ + AI+    KF+ EFMD++
Sbjct  430  LNATGIVVVPGSGFGQVDGTWHIRCTILPQEDRISAIITRLTKFHTEFMDEF  481



>ref|XP_010471259.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
 ref|XP_010471260.1| PREDICTED: alanine aminotransferase 2, mitochondrial-like [Camelina 
sativa]
Length=548

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -3

Query  763  RENXVLLGDEVYQQNIYQDERPFLSSRKVLLDMGPPISKELQLVSFHTVSKGYWGECGQR  584
            +E  VLL DEVYQ+N+Y  ++ F S +KV   +G    K++ LVSF +VSKGY+GECG+R
Sbjct  316  QEGLVLLADEVYQENVYVPDKKFHSFKKVARSLGYG-EKDMSLVSFQSVSKGYYGECGKR  374

Query  583  GGYFEMTNIPPRSVEEIYKVASISLSPNVPGQIFLGLMVNPPKPGDISYDQFVREGKGIL  404
            GGY E+T       E+IYK+AS++L  N+ GQI   L+++PPKPGD SYD ++ E  GIL
Sbjct  375  GGYMEVTGFTSDVREQIYKMASVNLCSNISGQILASLVMSPPKPGDDSYDSYMVERDGIL  434

Query  403  ESLRKRARIMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPRAIETAQGLGKAPDVYYCLKL  224
             S+ KRA+ + D  N+   V CN  EGAMY FP+I LP +AIE A+    APD +YC +L
Sbjct  435  SSMAKRAKTLEDALNNLEGVTCNRAEGAMYLFPRINLPHKAIEAAEAEKTAPDAFYCKRL  494

Query  223  LEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMESFKKFNDEFMDQYED  62
            L ATG+  VPGSGFGQ  G +H R TILP E+ + AI++    F+  FMD++ D
Sbjct  495  LNATGVVVVPGSGFGQVPGTWHFRCTILPQEDKILAIVDRLTAFHKSFMDEFRD  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890