BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012J20

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI17647.3|  unnamed protein product                                197   7e-58   Vitis vinifera
gb|KDO47608.1|  hypothetical protein CISIN_1g0472482mg                  189   3e-56   Citrus sinensis [apfelsine]
gb|KHN29278.1|  Zinc finger CCCH domain-containing protein ZFN-like     187   1e-54   Glycine soja [wild soybean]
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    189   2e-54   Nicotiana tomentosiformis
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    189   5e-54   
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    191   6e-54   Vitis vinifera
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    189   8e-54   
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    189   1e-53   Nicotiana tomentosiformis
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    186   3e-53   Nicotiana sylvestris
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    187   5e-53   Populus euphratica
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    187   6e-53   
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    188   7e-53   Populus euphratica
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    186   7e-53   Nicotiana sylvestris
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    186   1e-52   Nicotiana sylvestris
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    186   1e-52   Nicotiana sylvestris
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             186   2e-52   
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    185   2e-52   
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    186   2e-52   Nicotiana sylvestris
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             186   2e-52   
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    186   3e-52   
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             186   3e-52   Prunus persica
ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    186   4e-52   Nicotiana tomentosiformis
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             186   4e-52   Phaseolus vulgaris [French bean]
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    185   4e-52   Glycine max [soybeans]
gb|KHN40466.1|  Zinc finger CCCH domain-containing protein ZFN-like     183   4e-52   Glycine soja [wild soybean]
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    185   5e-52   Nicotiana tomentosiformis
ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-52   Nicotiana tomentosiformis
ref|XP_002512627.1|  nucleic acid binding protein, putative             186   5e-52   Ricinus communis
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    186   5e-52   Nicotiana tomentosiformis
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    185   6e-52   Glycine max [soybeans]
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    184   1e-51   
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    184   1e-51   Elaeis guineensis
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-51   Elaeis guineensis
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-51   Populus euphratica
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         184   2e-51   Jatropha curcas
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    184   2e-51   Prunus mume [ume]
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    183   4e-51   Fragaria vesca subsp. vesca
ref|XP_002325901.2|  zinc finger family protein                         182   6e-51   
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    182   8e-51   Solanum lycopersicum
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    181   1e-50   
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    181   2e-50   Solanum tuberosum [potatoes]
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    179   2e-50   Glycine max [soybeans]
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             180   2e-50   Phaseolus vulgaris [French bean]
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             181   3e-50   Phaseolus vulgaris [French bean]
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    181   3e-50   
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     179   8e-50   Glycine soja [wild soybean]
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    179   1e-49   
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    180   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    179   1e-49   Glycine max [soybeans]
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    177   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB82176.1|  hypothetical protein B456_013G179800                    178   1e-49   Gossypium raimondii
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    177   1e-49   
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    179   2e-49   Theobroma cacao [chocolate]
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    179   2e-49   Phoenix dactylifera
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    177   3e-49   
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    176   4e-49   
gb|KJB82177.1|  hypothetical protein B456_013G179800                    178   4e-49   Gossypium raimondii
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         177   6e-49   Medicago truncatula
gb|KEH23393.1|  zinc finger CCCH domain protein                         176   7e-49   Medicago truncatula
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    176   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...    176   7e-49   
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    176   9e-49   Medicago truncatula
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-48   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-48   
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               175   2e-48   Erythranthe guttata [common monkey flower]
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     175   2e-48   Glycine soja [wild soybean]
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    175   3e-48   Glycine max [soybeans]
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    175   4e-48   Pisum sativum [garden pea]
gb|KJB26822.1|  hypothetical protein B456_004G261700                    172   8e-48   Gossypium raimondii
gb|ACC85690.1|  zinc finger protein                                     174   8e-48   Medicago sativa [alfalfa]
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     173   1e-47   Eucalyptus grandis [rose gum]
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    174   1e-47   Eucalyptus grandis [rose gum]
gb|KJB75170.1|  hypothetical protein B456_012G028600                    172   2e-47   Gossypium raimondii
gb|KJB26823.1|  hypothetical protein B456_004G261700                    173   2e-47   Gossypium raimondii
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    171   2e-47   Gossypium arboreum [tree cotton]
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    173   3e-47   
gb|KJB75168.1|  hypothetical protein B456_012G028600                    173   3e-47   Gossypium raimondii
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          171   2e-46   Sorghum bicolor [broomcorn]
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    170   2e-46   Malus domestica [apple tree]
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    170   3e-46   Malus domestica [apple tree]
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    170   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    170   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    170   4e-46   
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    169   5e-46   Oryza brachyantha
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    170   7e-46   
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    168   8e-46   Sesamum indicum [beniseed]
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    168   8e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    168   9e-46   Sesamum indicum [beniseed]
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    168   1e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001067878.1|  Os11g0472000                                       168   1e-45   
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    168   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    168   2e-45   
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         167   2e-45   Zea mays [maize]
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         167   2e-45   Zea mays [maize]
ref|NP_001141157.1|  hypothetical protein                               167   3e-45   Zea mays [maize]
gb|EEE52080.1|  hypothetical protein OsJ_33853                          169   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004157161.1|  PREDICTED: zinc finger CCCH domain-containin...    161   5e-45   
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    166   6e-45   Gossypium arboreum [tree cotton]
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    166   8e-45   Setaria italica
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    166   9e-45   
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    166   9e-45   
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    166   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    166   1e-44   Brachypodium distachyon [annual false brome]
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    166   1e-44   
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    165   2e-44   
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    164   4e-44   
emb|CDP04213.1|  unnamed protein product                                161   3e-43   Coffea canephora [robusta coffee]
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    162   4e-43   Brachypodium distachyon [annual false brome]
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    161   7e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    160   8e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC69137.1|  hypothetical protein OsI_38063                          159   1e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    160   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    160   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          160   2e-42   Amborella trichopoda
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    159   3e-42   Oryza brachyantha
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    159   3e-42   Oryza brachyantha
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    157   4e-42   
gb|ADN33845.1|  nucleic acid binding protein                            157   4e-42   Cucumis melo subsp. melo
dbj|BAG99488.1|  unnamed protein product                                154   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|NP_974790.1|  zinc finger nuclease 3                                157   5e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851041.1|  zinc finger nuclease 3                                157   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066624.1|  Os12g0405100                                       158   1e-41   
ref|NP_001130819.1|  uncharacterized protein LOC100191923               157   3e-41   Zea mays [maize]
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             154   8e-41   
ref|XP_008389043.1|  PREDICTED: zinc finger CCCH domain-containin...    149   1e-40   
dbj|BAD87736.1|  putative zinc finger protein                           152   1e-40   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86320.1|  predicted protein                                      154   3e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           153   3e-40   Triticum urartu
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                    152   5e-40   
gb|EEE55890.1|  hypothetical protein OsJ_04549                          152   6e-40   Oryza sativa Japonica Group [Japonica rice]
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    152   6e-40   Arabis alpina [alpine rockcress]
gb|ACN33948.1|  unknown                                                 152   7e-40   Zea mays [maize]
gb|EAY76977.1|  hypothetical protein OsI_04935                          153   8e-40   Oryza sativa Indica Group [Indian rice]
ref|NP_001045201.2|  Os01g0917400                                       153   8e-40   
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            150   9e-40   
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 151   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566183.1|  zinc finger protein 1                                 152   1e-39   Arabidopsis thaliana [mouse-ear cress]
gb|ACF82040.1|  unknown                                                 152   1e-39   Zea mays [maize]
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         152   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    152   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             150   3e-39   Arabidopsis lyrata subsp. lyrata
gb|ACU21592.1|  Zinc finger protein                                     151   3e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    151   3e-39   Brachypodium distachyon [annual false brome]
dbj|BAJ99149.1|  predicted protein                                      150   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    150   5e-39   Arabis alpina [alpine rockcress]
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    150   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    150   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    149   1e-38   
ref|NP_568332.2|  zinc finger nuclease 3                                149   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    149   1e-38   
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             149   1e-38   
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             149   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             149   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             148   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    149   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             146   2e-37   Capsella rubella
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    145   5e-37   Setaria italica
emb|CDY51531.1|  BnaA05g33310D                                          144   1e-36   Brassica napus [oilseed rape]
emb|CDX74233.1|  BnaA03g28140D                                          142   3e-36   
emb|CDY28712.1|  BnaCnng05980D                                          142   4e-36   Brassica napus [oilseed rape]
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    142   4e-36   Cicer arietinum [garbanzo]
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    142   5e-36   Tarenaya hassleriana [spider flower]
emb|CDX92015.1|  BnaC03g33170D                                          141   7e-36   
gb|ACF80171.1|  unknown                                                 140   9e-36   Zea mays [maize]
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    140   1e-35   Brassica rapa
ref|NP_001132883.1|  uncharacterized protein LOC100194377               140   2e-35   Zea mays [maize]
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              139   5e-35   
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    138   7e-35   Brassica rapa
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    138   7e-35   Brassica rapa
emb|CDY53749.1|  BnaAnng12770D                                          136   5e-34   Brassica napus [oilseed rape]
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    136   6e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    135   6e-34   Brassica rapa
emb|CDY67901.1|  BnaCnng56860D                                          135   6e-34   Brassica napus [oilseed rape]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    135   8e-34   Brassica rapa
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    134   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    129   2e-31   Zea mays [maize]
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    123   6e-29   Sesamum indicum [beniseed]
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg                122   8e-29   Erythranthe guttata [common monkey flower]
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             121   2e-28   Prunus persica
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    121   2e-28   Prunus mume [ume]
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             120   8e-28   
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    119   9e-28   Sesamum indicum [beniseed]
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-27   Vitis vinifera
emb|CAN78551.1|  hypothetical protein VITISV_003243                     119   2e-27   Vitis vinifera
ref|NP_001078077.1|  zinc finger CCCH domain-containing protein 32      119   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880326.1|  zinc finger (CCCH-type) family protein             118   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             118   2e-27   Populus trichocarpa [western balsam poplar]
ref|NP_182306.2|  zinc finger CCCH domain-containing protein 32         118   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAC63639.1|  unknown protein                                         119   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294140.1|  hypothetical protein CARUB_v10023134mg             117   3e-27   Capsella rubella
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-27   Populus euphratica
emb|CDO98891.1|  unnamed protein product                                118   4e-27   Coffea canephora [robusta coffee]
gb|ACN40302.1|  unknown                                                 117   4e-27   Picea sitchensis
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    118   4e-27   Nicotiana sylvestris
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    117   4e-27   Nicotiana sylvestris
ref|XP_006829498.1|  hypothetical protein AMTR_s00074p00109750          114   5e-27   
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    117   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_006294141.1|  hypothetical protein CARUB_v10023134mg             117   5e-27   Capsella rubella
ref|XP_001768387.1|  predicted protein                                  115   8e-27   
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    116   9e-27   Pyrus x bretschneideri [bai li]
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    116   1e-26   Nicotiana tomentosiformis
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    116   1e-26   
ref|XP_009142498.1|  PREDICTED: zinc finger CCCH domain-containin...    115   2e-26   Brassica rapa
emb|CDX80137.1|  BnaA05g00190D                                          115   2e-26   
ref|XP_009142499.1|  PREDICTED: zinc finger CCCH domain-containin...    115   2e-26   Brassica rapa
gb|EEE54266.1|  hypothetical protein OsJ_01160                          111   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    115   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_008796232.1|  PREDICTED: zinc finger CCCH domain-containin...    114   3e-26   Phoenix dactylifera
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    115   4e-26   Phoenix dactylifera
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             114   5e-26   Citrus clementina [clementine]
ref|XP_010507789.1|  PREDICTED: zinc finger CCCH domain-containin...    114   5e-26   
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    114   6e-26   Populus euphratica
ref|XP_010545038.1|  PREDICTED: zinc finger CCCH domain-containin...    114   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             114   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010545037.1|  PREDICTED: zinc finger CCCH domain-containin...    114   6e-26   Tarenaya hassleriana [spider flower]
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    114   6e-26   Elaeis guineensis
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    114   7e-26   Phoenix dactylifera
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    114   9e-26   Elaeis guineensis
ref|XP_010507842.1|  PREDICTED: zinc finger CCCH domain-containin...    113   2e-25   
emb|CDY53022.1|  BnaC04g00080D                                          113   2e-25   Brassica napus [oilseed rape]
tpg|DAA53995.1|  TPA: hypothetical protein ZEAMMB73_505725              110   2e-25   
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          112   2e-25   Amborella trichopoda
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    113   2e-25   Nicotiana tomentosiformis
ref|XP_010507840.1|  PREDICTED: zinc finger CCCH domain-containin...    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010518502.1|  PREDICTED: zinc finger CCCH domain-containin...    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006644012.1|  PREDICTED: zinc finger CCCH domain-containin...    112   3e-25   Oryza brachyantha
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    112   4e-25   
gb|AGT16102.1|  hypothetical protein SHCRBa_134_J05_F_10                111   5e-25   Saccharum hybrid cultivar R570
ref|XP_001752915.1|  predicted protein                                  104   6e-25   
gb|AGT16494.1|  zinc finger CCCH type domain-containing protein         111   6e-25   Saccharum hybrid cultivar R570
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    111   8e-25   Nicotiana sylvestris
ref|XP_010270054.1|  PREDICTED: zinc finger CCCH domain-containin...    110   8e-25   Nelumbo nucifera [Indian lotus]
ref|XP_001752815.1|  predicted protein                                  104   9e-25   
ref|NP_001042632.2|  Os01g0257400                                       110   1e-24   
ref|XP_010270055.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   Nelumbo nucifera [Indian lotus]
ref|XP_004987433.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-24   
ref|XP_009408337.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408338.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    110   2e-24   Nelumbo nucifera [Indian lotus]
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     109   2e-24   Eucalyptus grandis [rose gum]
ref|XP_009408339.1|  PREDICTED: zinc finger CCCH domain-containin...    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    110   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    110   2e-24   
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         110   2e-24   Jatropha curcas
ref|XP_002457592.1|  hypothetical protein SORBIDRAFT_03g009920          109   3e-24   Sorghum bicolor [broomcorn]
gb|AAT28673.1|  zinc finger protein                                     106   3e-24   Oryza sativa Japonica Group [Japonica rice]
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     108   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    109   4e-24   Eucalyptus grandis [rose gum]
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    109   4e-24   Fragaria vesca subsp. vesca
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    109   4e-24   Theobroma cacao [chocolate]
gb|ACN28458.1|  unknown                                                 108   5e-24   Zea mays [maize]
ref|NP_001147888.1|  zinc finger CCCH type domain-containing prot...    108   5e-24   
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    110   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_002520668.1|  nucleic acid binding protein, putative             108   6e-24   Ricinus communis
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    108   6e-24   
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             108   6e-24   Citrus clementina [clementine]
ref|XP_004169150.1|  PREDICTED: zinc finger CCCH domain-containin...    108   7e-24   
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    108   8e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006645727.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-23   
gb|KHG22563.1|  hypothetical protein F383_29382                         108   1e-23   Gossypium arboreum [tree cotton]
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-23   Vitis vinifera
gb|KHF99697.1|  hypothetical protein F383_18975                         107   1e-23   Gossypium arboreum [tree cotton]
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Cucumis melo [Oriental melon]
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Prunus mume [ume]
gb|EAY73369.1|  hypothetical protein OsI_01247                          106   2e-23   Oryza sativa Indica Group [Indian rice]
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       107   2e-23   Cucumis sativus [cucumbers]
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             107   2e-23   Prunus persica
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Cucumis sativus [cucumbers]
gb|AFW79659.1|  hypothetical protein ZEAMMB73_788382                    106   2e-23   
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Pyrus x bretschneideri [bai li]
emb|CAN74119.1|  hypothetical protein VITISV_002050                     110   2e-23   Vitis vinifera
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-23   Nelumbo nucifera [Indian lotus]
gb|KHG21967.1|  hypothetical protein F383_08187                         106   2e-23   Gossypium arboreum [tree cotton]
gb|ABR16930.1|  unknown                                                 108   2e-23   
gb|KJB12614.1|  hypothetical protein B456_002G027000                    107   3e-23   
ref|XP_010558473.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-23   
gb|KJB47069.1|  hypothetical protein B456_008G009500                    107   3e-23   
gb|EAZ11305.1|  hypothetical protein OsJ_01167                          105   3e-23   
dbj|BAK02824.1|  predicted protein                                      106   4e-23   
emb|CDM82679.1|  unnamed protein product                                106   4e-23   
gb|AFW79656.1|  zinc finger CCCH type domain-containing protein Z...    106   4e-23   
ref|XP_006366678.1|  PREDICTED: zinc finger CCCH domain-containin...    105   4e-23   
ref|NP_001150792.1|  zinc finger CCCH type domain-containing prot...    106   4e-23   
gb|EMT01168.1|  Zinc finger CCCH domain-containing protein 6            106   4e-23   
gb|KJB75169.1|  hypothetical protein B456_012G028600                    105   5e-23   
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    105   5e-23   
ref|XP_009776617.1|  PREDICTED: zinc finger CCCH domain-containin...    105   5e-23   
dbj|BAD81402.1|  putative floral homeotic protein HUA1                  105   5e-23   
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    105   6e-23   
dbj|BAG99345.1|  unnamed protein product                                105   6e-23   
ref|XP_008389190.1|  PREDICTED: zinc finger CCCH domain-containin...    105   6e-23   
ref|XP_002516892.1|  nucleic acid binding protein, putative             106   6e-23   
gb|KJB72632.1|  hypothetical protein B456_011G188400                    105   7e-23   
ref|NP_001042637.1|  Os01g0258700                                       105   7e-23   
ref|XP_003566542.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-23   
ref|XP_004967812.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
ref|XP_004967813.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
gb|KHG22135.1|  hypothetical protein F383_09601                         105   1e-22   
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-22   
gb|KJB23208.1|  hypothetical protein B456_004G086700                    103   1e-22   
gb|EMT21637.1|  Zinc finger CCCH domain-containing protein 5            104   1e-22   
gb|EEC80695.1|  hypothetical protein OsI_23121                          102   2e-22   
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    104   2e-22   
gb|EMS67785.1|  Zinc finger CCCH domain-containing protein 5            104   2e-22   
emb|CDM82689.1|  unnamed protein product                                104   2e-22   
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    103   2e-22   
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-22   
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-22   
ref|XP_003566545.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-22   
ref|XP_002511264.1|  nucleic acid binding protein, putative             104   3e-22   
dbj|BAJ86598.1|  predicted protein                                      103   3e-22   
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-22   
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      103   4e-22   
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    104   4e-22   
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    103   4e-22   
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    103   5e-22   
emb|CDP03533.1|  unnamed protein product                                103   5e-22   
ref|XP_011007757.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-22   
gb|KDP30984.1|  hypothetical protein JCGZ_11360                         103   6e-22   
gb|KDO69368.1|  hypothetical protein CISIN_1g033320mg                 98.2    6e-22   
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-22   
gb|KDP28101.1|  hypothetical protein JCGZ_13872                         103   7e-22   
gb|KHG04581.1|  hypothetical protein F383_30084                         102   7e-22   
gb|KJB22540.1|  hypothetical protein B456_004G053200                    102   7e-22   
gb|KJB23207.1|  hypothetical protein B456_004G086700                    103   8e-22   
gb|KDO59559.1|  hypothetical protein CISIN_1g013033mg                   101   8e-22   
ref|XP_002320490.1|  ZINC FINGER protein 2                              102   9e-22   
ref|XP_008799415.1|  PREDICTED: zinc finger CCCH domain-containin...    101   9e-22   
ref|XP_010026837.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-22   
gb|KJB08671.1|  hypothetical protein B456_001G096900                    102   9e-22   
gb|KJB08672.1|  hypothetical protein B456_001G096900                    102   1e-21   
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_002277300.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
gb|KHG01635.1|  hypothetical protein F383_21492                         102   1e-21   
ref|XP_004152505.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
gb|KJB28621.1|  hypothetical protein B456_005G058800                    102   1e-21   
gb|KJB08673.1|  hypothetical protein B456_001G096900                    102   1e-21   
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_004157770.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
ref|XP_003638527.1|  Zinc finger CCCH domain-containing protein         102   1e-21   
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-21   
gb|ABR16973.1|  unknown                                                 102   1e-21   
ref|XP_006440013.1|  hypothetical protein CICLE_v10019979mg           99.8    2e-21   
gb|KJB08677.1|  hypothetical protein B456_001G097100                    101   2e-21   
ref|XP_003525622.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   
ref|XP_010026830.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   
ref|XP_003608905.1|  Zinc finger CCCH domain-containing protein         100   2e-21   
gb|KJB08674.1|  hypothetical protein B456_001G096900                    101   2e-21   
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-21   
gb|KHG06790.1|  hypothetical protein F383_05075                         101   2e-21   
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    100   2e-21   
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-21   
ref|XP_006476951.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    2e-21   
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    100   2e-21   
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
gb|KDO59558.1|  hypothetical protein CISIN_1g013033mg                   100   3e-21   
ref|XP_004967811.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-21   
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-21   
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   100   3e-21   
ref|XP_003608904.1|  Zinc finger CCCH domain-containing protein         102   3e-21   
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             100   4e-21   
ref|XP_011040430.1|  PREDICTED: zinc finger CCCH domain-containin...    101   4e-21   
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...    101   4e-21   
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-21   
gb|KHN34381.1|  Zinc finger CCCH domain-containing protein 43           101   4e-21   
gb|EYU45569.1|  hypothetical protein MIMGU_mgv1a006413mg                100   5e-21   
ref|XP_004501830.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   
ref|XP_007155512.1|  hypothetical protein PHAVU_003G207900g             100   5e-21   
ref|XP_004515843.1|  PREDICTED: zinc finger CCCH domain-containin...    101   5e-21   
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    100   5e-21   
ref|XP_002318105.1|  hypothetical protein POPTR_0012s09400g             100   5e-21   
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    100   5e-21   
gb|KJB41978.1|  hypothetical protein B456_007G130500                    100   5e-21   
ref|XP_006440011.1|  hypothetical protein CICLE_v10019979mg             100   5e-21   
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_010667394.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-21   
ref|XP_004495984.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    7e-21   
gb|ACF86739.1|  unknown                                               97.8    8e-21   
ref|XP_009133833.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    8e-21   
ref|XP_011085491.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    8e-21   
ref|XP_006440008.1|  hypothetical protein CICLE_v10019979mg           99.0    9e-21   
gb|KJB08070.1|  hypothetical protein B456_001G061800                  99.8    1e-20   
gb|EPS71438.1|  hypothetical protein M569_03319                       99.8    1e-20   
ref|XP_010319044.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
emb|CDX95738.1|  BnaC03g26190D                                        99.4    1e-20   
ref|XP_004236314.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
gb|KHG29012.1|  hypothetical protein F383_11348                       99.4    1e-20   
ref|XP_006476949.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-20   
ref|XP_004299182.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-20   
gb|KJB10315.1|  hypothetical protein B456_001G195600                  98.2    1e-20   
ref|XP_006440009.1|  hypothetical protein CICLE_v10019979mg           99.8    1e-20   
ref|XP_007137964.1|  hypothetical protein PHAVU_009G169600g           99.8    1e-20   
ref|XP_008239614.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-20   
ref|XP_007209937.1|  hypothetical protein PRUPE_ppa004690mg           99.8    1e-20   
ref|XP_010943247.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    1e-20   
ref|XP_002528968.1|  zinc finger protein, putative                    99.4    1e-20   
gb|KHG07834.1|  hypothetical protein F383_35307                       99.4    1e-20   
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_010098340.1|  Zinc finger CCCH domain-containing protein 58    99.4    2e-20   
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-20   
ref|XP_009791089.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_009791086.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    2e-20   
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-20   
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32         99.0    2e-20   
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    2e-20   
ref|XP_009791087.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_009791088.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-20   
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg           99.0    2e-20   
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667            97.1    2e-20   
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658            97.1    2e-20   
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    3e-20   
gb|EYU40387.1|  hypothetical protein MIMGU_mgv1a022029mg              97.4    3e-20   
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    3e-20   
emb|CDX74105.1|  BnaA03g29420D                                        98.2    3e-20   
gb|KHG05173.1|  hypothetical protein F383_31227                       97.8    4e-20   
ref|XP_010929994.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    4e-20   
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...  97.8    4e-20   
ref|XP_003549835.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    4e-20   
gb|KHN14074.1|  Zinc finger CCCH domain-containing protein 43         98.6    4e-20   
gb|KJB10316.1|  hypothetical protein B456_001G195600                  97.8    4e-20   
ref|XP_010929993.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    4e-20   
gb|KJB10313.1|  hypothetical protein B456_001G195600                  97.8    4e-20   
ref|XP_006394295.1|  hypothetical protein EUTSA_v10004204mg           97.8    4e-20   
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g           98.2    4e-20   
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  97.8    5e-20   
gb|KJB40000.1|  hypothetical protein B456_007G041600                  97.8    5e-20   
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-20   
gb|KHN05794.1|  Zinc finger CCCH domain-containing protein 43         98.6    6e-20   
ref|XP_003522417.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    6e-20   
ref|XP_009385235.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    6e-20   
emb|CDX84393.1|  BnaC03g51070D                                        97.1    6e-20   
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    7e-20   
ref|XP_006282213.1|  hypothetical protein CARUB_v10028484mg           97.1    8e-20   
ref|XP_006407950.1|  hypothetical protein EUTSA_v10020686mg           95.9    8e-20   
ref|XP_010519530.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    8e-20   
ref|XP_006581890.1|  PREDICTED: zinc finger CCCH domain-containin...  98.2    9e-20   
gb|KJB39998.1|  hypothetical protein B456_007G041600                  97.4    9e-20   
gb|KJB39999.1|  hypothetical protein B456_007G041600                  97.4    9e-20   
gb|KHN31930.1|  Zinc finger CCCH domain-containing protein 43         98.2    9e-20   
ref|NP_001150919.1|  zinc finger CCCH type domain-containing prot...  97.1    9e-20   
gb|KHG13153.1|  hypothetical protein F383_04055                       97.4    1e-19   
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-19   
ref|XP_008796043.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    1e-19   
gb|ACN33323.1|  unknown                                               97.1    1e-19   
ref|NP_001150480.1|  LOC100284111                                     97.1    1e-19   
ref|XP_002302855.1|  ZINC FINGER protein 2                            96.7    1e-19   
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43       96.7    1e-19   
emb|CDX70825.1|  BnaC03g09090D                                        95.9    1e-19   
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930        97.1    1e-19   
ref|XP_002864843.1|  zinc finger (CCCH-type) family protein           96.3    1e-19   
ref|XP_007037859.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  97.1    1e-19   
gb|KHG04838.1|  hypothetical protein F383_29515                       96.7    1e-19   
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3     96.3    2e-19   
gb|KJB51160.1|  hypothetical protein B456_008G204400                  96.3    2e-19   
gb|KHN03741.1|  Zinc finger CCCH domain-containing protein 32         95.9    2e-19   
ref|XP_009150386.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    2e-19   
ref|XP_008367485.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    2e-19   
gb|KJB82178.1|  hypothetical protein B456_013G179800                  94.4    2e-19   
ref|NP_001288815.1|  CCCH type zinc finger protein                    96.3    2e-19   
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    2e-19   
ref|XP_010322522.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
ref|XP_006347415.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
ref|XP_010322521.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
ref|XP_006347414.1|  PREDICTED: zinc finger CCCH domain-containin...  97.1    2e-19   
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein       95.9    3e-19   
ref|XP_006852277.1|  hypothetical protein AMTR_s00049p00179390        94.7    3e-19   
ref|XP_009150385.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    3e-19   
ref|XP_006376057.1|  hypothetical protein POPTR_0013s08500g           83.6    3e-19   
emb|CDY41511.1|  BnaA06g22640D                                        95.1    3e-19   
gb|AAV66094.1|  At5g63260                                             95.1    3e-19   
ref|NP_201131.1|  zinc finger CCCH domain-containing protein 67       95.1    3e-19   
ref|NP_001190604.1|  zinc finger CCCH domain-containing protein 67    95.5    3e-19   
ref|XP_010484051.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-19   
ref|XP_010460041.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-19   
emb|CAN76191.1|  hypothetical protein VITISV_020358                   95.1    4e-19   
ref|XP_009613173.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    4e-19   
ref|XP_010444209.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-19   
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg           95.1    4e-19   
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein           95.1    4e-19   
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    5e-19   
ref|XP_009613170.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    5e-19   



>emb|CBI17647.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 124/169 (73%), Gaps = 21/169 (12%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  157  SEQPNTGSQGTFSPYRSGSVPIGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  216

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+F YN+S SS
Sbjct  217  HPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFAYNLSASS  276

Query  347  TTNAPTVRHFlgsssgtgtltlsSEGAC*GKFHGAQVTVILKSETDAIW  201
            + +AP VR                        H AQ T   + +TDA W
Sbjct  277  SADAPVVRRL---------------------LHKAQATFTARDKTDASW  304


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query  581  QFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  402
             +Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y R G CKFG +
Sbjct  13   HYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGST  72

Query  401  CKFDHPMGVFTYNISPSSTTNAPTVR  324
            CKF HP    +  +S    TN P  R
Sbjct  73   CKFHHPQPS-SMMVSLRGITNWPLSR  97



>gb|KDO47608.1| hypothetical protein CISIN_1g0472482mg, partial [Citrus sinensis]
Length=201

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E +N GSQG   S+R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  28   TEPSNSGSQGTMSSFRSGSVPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  87

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S SS
Sbjct  88   HPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASS  147

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + +AP VR FLGSSS TG L LSSEG
Sbjct  148  SADAP-VRRFLGSSSATGALNLSSEG  172



>gb|KHN29278.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=267

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  92   SEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFH  151

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S 
Sbjct  152  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASP  211

Query  347  TTNAPTVRHF  318
            + +AP  R  
Sbjct  212  SADAPGRRML  221



>ref|XP_009626545.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=350

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  174  SDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFH  233

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  234  HPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  293

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  294  STDDPSVRRLLGSSSGTGALTLTSEG  319


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  431  RYGICKFGPSCKFDHP  384
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>ref|XP_009626544.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=381

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  205  SDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFH  264

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  265  HPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  324

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  325  STDDPSVRRLLGSSSGTGALTLTSEG  350


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  431  RYGICKFGPSCKFDHP  384
            R   CKFG +CKF HP
Sbjct  96   RTAQCKFGSTCKFHHP  111



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  265  SEQPNTGSQGTFSPYRSGSVPIGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  324

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+F YN+S SS
Sbjct  325  HPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFAYNLSASS  384

Query  347  TTNAPTVRHF  318
            + +AP VR  
Sbjct  385  SADAPVVRRL  394


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  90   FPERMGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYL  149

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  150  RTGQCKFGSTCKFHHP  165


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C+F++P  R      +       P R G+P C +Y 
Sbjct  45   YPERPGEPDCSYYIRTGLCRFGITCRFNHPPNR-KLAIATARMKGEFPERMGQPECQYYL  103

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  104  KTGTCKFGATCKFHHP  119



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  230  SDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFH  289

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  290  HPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  349

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  350  STDDPSVRRLLGSSSGTGALTLTSEG  375


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 27/129 (21%)
 Frame = -2

Query  689  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQ--------------------  579
            G   ++PS R  +L  M   +++      +P R G+P+C                     
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPP  67

Query  578  ----FYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  411
                +Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C +Y R   CKF
Sbjct  68   NRKLYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKF  127

Query  410  GPSCKFDHP  384
            G +CKF HP
Sbjct  128  GSTCKFHHP  136



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYRA +LP+GYYAL+ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  251  SDKATMGSEGMNSSYRASSLPVGYYALEGENVFPERLGQPECQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  311  HPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  370

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  371  STDDPSVRRLLGSSSGTGALTLTSEG  396


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A      +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  71   LALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPL  130

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  C +Y R   CKFG +CKF HP
Sbjct  131  RPNENECTYYMRTAQCKFGSTCKFHHP  157


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 4/105 (4%)
 Frame = -2

Query  689  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            G   ++PS R  +L  M   +++      +P R G+P+C +Y++TG C+FG+ C+F++P 
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPP  67

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             R      +       P R G+  C +Y + G CKFG +CKF HP
Sbjct  68   NR-KLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHP  111



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  174  SDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFH  233

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  234  HPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  293

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  294  STDDPSVRRLLGSSSGTGALTLTSEG  319


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C +Y 
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  64

Query  431  RYGICKFGPSCKFDHP  384
            R   CKFG +CKF HP
Sbjct  65   RTAQCKFGSTCKFHHP  80



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   187 bits (476),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+G+ P+GYYALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  237  SESVNAGSQGTFSPYRSGSAPLGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  296

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++ SS
Sbjct  297  HPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLTASS  356

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  357  SADAPVRR  364


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPL  110

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            +P E  CA+Y R G CKFG +CKF HP
Sbjct  111  QPNEIECAYYLRTGQCKFGSTCKFHHP  137


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  17   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   187 bits (476),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  247  TEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  306

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S SS
Sbjct  307  HPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASS  366

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + +AP VR FLGSSS TG L LSSEG
Sbjct  367  SADAP-VRRFLGSSSATGALNLSSEG  391


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  72   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  131

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGSTCKFHHP  147



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+G+ P+GYYALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  272  SESVNAGSQGTFSPYRSGSAPLGYYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  331

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++ SS
Sbjct  332  HPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLTASS  391

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  392  SADAPVRR  399


 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  86   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPL  145

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            +P E  CA+Y R G CKFG +CKF HP
Sbjct  146  QPNEIECAYYLRTGQCKFGSTCKFHHP  172


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  52   YPERSGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  110

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   186 bits (472),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  205  SDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFH  264

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  265  HPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  324

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  325  STDDPSVRRLLGSSSGTGALTLTSEG  350


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C +Y 
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYM  95

Query  431  RYGICKFGPSCKFDHP  384
            R   CKFG +CKF HP
Sbjct  96   RTAQCKFGSTCKFHHP  111



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  230  SDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFH  289

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  290  HPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  349

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  350  STDDPSVRRLLGSSSGTGALTLTSEG  375


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 62/129 (48%), Gaps = 27/129 (21%)
 Frame = -2

Query  689  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTG--------------  561
            G   ++PS R  +L  M   +++      +P R G+ +C +Y++TG              
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPP  67

Query  560  ----------DCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKF  411
                       CKFGA CKFH+PR++        L+ +G PLRP E  C +Y R   CKF
Sbjct  68   NRKLYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKF  127

Query  410  GPSCKFDHP  384
            G +CKF HP
Sbjct  128  GSTCKFHHP  136



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 130/146 (89%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GS+GMN SYR  +LP+GYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH
Sbjct  251  SDKATMGSEGMNSSYRVSSLPVGYYALQGENVFPERVGQPECQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+PPPD LLSPIGLPLR GEP+C FYSRYGICKFGPSCKFDHPM VFTYNIS SS
Sbjct  311  HPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPSCKFDHPMRVFTYNISASS  370

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            +T+ P+VR  LGSSSGTG LTL+SEG
Sbjct  371  STDDPSVRRLLGSSSGTGALTLTSEG  396


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A      +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  71   LALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPL  130

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  C +Y R   CKFG +CKF HP
Sbjct  131  RPNENECTYYMRTAQCKFGSTCKFHHP  157


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 4/105 (4%)
 Frame = -2

Query  689  GSQGMNPSYRAGTL-PMGYYALQ--RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            G   ++PS R  +L  M   +++      +P R G+ +C +Y++TG C+FG+ C+F++P 
Sbjct  8    GPPSLSPSLRQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPP  67

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             R      +       P R G+  C +Y + G CKFG +CKF HP
Sbjct  68   NR-KLALAAASMNGEYPERIGQLECQYYLKTGTCKFGATCKFHHP  111



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  234  TEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  293

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S SS
Sbjct  294  HPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASS  353

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + +AP VR FLGSSS TG L LSSEG
Sbjct  354  SADAP-VRRFLGSSSATGALNLSSEG  378


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  59   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  118

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGSTCKFHHP  134


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
             PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  14   LPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARIKGDYPERLGQPECQYYL  72

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  73   KTGTCKFGATCKFHHP  88



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            + G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PRE
Sbjct  191  SAGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRE  250

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY IS SST + 
Sbjct  251  RLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTADV  310

Query  335  PTVRHF  318
            PTVR  
Sbjct  311  PTVRRL  316


 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  1    MAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  60

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHPM  381
            RP E  CA+Y R G CKFG +CKF HP 
Sbjct  61   RPNEKECAYYIRTGQCKFGNTCKFHHPQ  88



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            +  N+GSQG+   YR  ++PMGYYALQ ENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  258  DAVNMGSQGVTSPYRPASVPMGYYALQGENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  317

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS 
Sbjct  318  PRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSP  377

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
            T+AP V+  LGSSSGT  LTL+SEG
Sbjct  378  TDAPAVQRLLGSSSGTSALTLTSEG  402


 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 63/99 (64%), Gaps = 9/99 (9%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  431  RYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  342
            R G CKFG +CKF HP          G  TY   PS+TT
Sbjct  148  RTGQCKFGSTCKFHHPQPSNMMVSLRGSPTYPPVPSATT  186


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHYP  522
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F++P
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  521  RERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
              R      +       P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  117



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E +N GSQG    +R+G++P+G+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  266  TEPSNSGSQGTMSPFRSGSIPVGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  325

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S SS
Sbjct  326  HPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSASS  385

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + +AP VR FLGSSS TG L LSSEG
Sbjct  386  SADAP-VRRFLGSSSATGALNLSSEG  410


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  91   YPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYL  150

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  151  RTGQCKFGSTCKFHHP  166


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
             PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  46   LPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARIKGDYPERLGQPECQYYL  104

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  105  KTGTCKFGATCKFHHP  120



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ AN GSQG    YR+G++P+G+YALQRENVFPER GQPECQFYMKTGDCKFGAVCKFH
Sbjct  243  SDPANTGSQGTLSPYRSGSIPVGFYALQRENVFPERTGQPECQFYMKTGDCKFGAVCKFH  302

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD LLSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FT N+S +S
Sbjct  303  HPRERLIPAPDCLLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTINLSATS  362

Query  347  TTNAPTVR  324
            +T+ P  R
Sbjct  363  STDTPVRR  370


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 55/101 (54%), Gaps = 24/101 (24%)
 Frame = -2

Query  614  VFPERPGQPECQ------------------------FYMKTGDCKFGAVCKFHYPRERli  507
             +PERPG+P+C                         +Y+KTG CKFGA CKFH+PR++  
Sbjct  44   TYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLYYLKTGTCKFGATCKFHHPRDKAG  103

Query  506  pppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
                  L+ +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  104  IAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTCKFHHP  144



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG   SYR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  268  EPENSGSQGTFSSYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN + SS+
Sbjct  328  PRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSS  387

Query  344  TNAPTVR  324
             +AP  R
Sbjct  388  ADAPARR  394


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERIGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH+
Sbjct  258  DAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHH  317

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+
Sbjct  318  PRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSS  377

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
            T+AP V+  LGSSSGT  LTL+SEG
Sbjct  378  TDAPAVQRLLGSSSGTSALTLTSEG  402


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 58/106 (55%), Gaps = 6/106 (6%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHYP  522
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F++P
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  521  RERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
              R      +       P R G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  117



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E+AN G+ G    +R+GT+P+G+YALQREN+FPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  270  ELANTGTHGAYSQFRSGTVPVGFYALQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHH  329

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            P ERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYNIS S +
Sbjct  330  PHERLIPAPDCVLSPMGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNISASPS  389

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
             +AP+ +H L SSSGT  L+LSSEG
Sbjct  390  ADAPS-KHLLRSSSGTAALSLSSEG  413


 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  94   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPECTYYL  153

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGNTCKFHHP  169


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y
Sbjct  48   AYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMIGEFPERIGQPECQYY  106

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  107  LKTGTCKFGATCKFHHP  123


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  140  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  170



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  251  SEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S 
Sbjct  311  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASP  370

Query  347  TTNAPTVRHF  318
            + +AP  R  
Sbjct  371  SADAPGRRML  380


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FH+PR++        ++ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPL  128

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  129  RPNEPECAYYLRTGQCKFGNTCKFHHP  155



>gb|KHN40466.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=347

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  172  SEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFH  231

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYN+S S 
Sbjct  232  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNMSASP  291

Query  347  TTNAPTVRHF  318
              +AP  R  
Sbjct  292  LADAPGRRML  301


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 16/76 (21%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R                +  EP C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR----------------KLNEPECGYYL  60

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  61   RTGQCKFGNTCKFHHP  76



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH+
Sbjct  262  DAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHH  321

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+
Sbjct  322  PRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSS  381

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
            T+AP V+  LGSSSGT  LTL+SEG
Sbjct  382  TDAPAVQRLLGSSSGTSALTLTSEG  406


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  92   YPERMGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYM  151

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGSTCKFHHP  167


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 60/109 (55%), Gaps = 8/109 (7%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHYP  522
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F++P
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  521  RERlipppdsllspiglpLRP---GEPLCAFYSRYGICKFGPSCKFDHP  384
              R +    ++ +       P   G+P C +Y + G CKFG +CKF HP
Sbjct  73   PNRKLYLMQAIATARMKGEYPERMGQPECQYYLKTGTCKFGATCKFHHP  121



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH+
Sbjct  275  DAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHH  334

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+
Sbjct  335  PRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSS  394

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
            T+AP V+  LGSSSGT  LTL+SEG
Sbjct  395  TDAPAVQRLLGSSSGTSALTLTSEG  419


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = -2

Query  611  FPERPGQPECQ-----------------FYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            +PER GQPECQ                 +Y+KTG CKFGA CKFH+P+++        L+
Sbjct  88   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLN  147

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  148  VLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  180


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 58/123 (47%), Gaps = 23/123 (19%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHYP  522
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F++P
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  521  RERlipppdsllspiglpLRPGEPLC-----------------AFYSRYGICKFGPSCKF  393
              R      +       P R G+P C                  +Y + G CKFG +CKF
Sbjct  73   PNR-KLAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKF  131

Query  392  DHP  384
             HP
Sbjct  132  HHP  134


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP + EC +YM+TG CKFG+ CKFH+P+
Sbjct  151  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ  181



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG     RAG++P+G+YALQR+NVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  273  SESVNTGSQGTLSPLRAGSMPVGFYALQRDNVFPERPGQPECQFYMKTGDCKFGAVCRFH  332

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYG+CKFGPSCKFDHPMG+FTYN+S  S
Sbjct  333  HPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPSCKFDHPMGIFTYNLSAPS  392

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  393  SADAPVRR  400


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  88   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNILGYPL  147

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  148  RPNEIECAYYLRTGQCKFGSTCKFHHP  174


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  54   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  112

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            + AN+GSQG+   YR  ++PMGYYALQ ENVFPER GQPECQFYMKTGDCKFGAVC+FH+
Sbjct  279  DAANMGSQGVTSPYRPASVPMGYYALQGENVFPERHGQPECQFYMKTGDCKFGAVCRFHH  338

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+IS SS+
Sbjct  339  PRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSISASSS  398

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
            T+AP V+  LGSSSGT  LTL+SEG
Sbjct  399  TDAPAVQRLLGSSSGTSALTLTSEG  423


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 17/93 (18%)
 Frame = -2

Query  611  FPERPGQPECQ-----------------FYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            +PER GQPECQ                 +Y+KTG CKFGA CKFH+P+++        L+
Sbjct  92   YPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLN  151

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  152  VLGYPLRPNEAECAYYMRTGQCKFGSTCKFHHP  184


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (48%), Gaps = 25/126 (20%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENV----FPERPGQPECQFYMKTGDCKFGAVCKFHYP  522
            G   ++PS    TL        RE++    +P R G+P+C +Y++TG C+FG+ C+F++P
Sbjct  14   GPSSLSPSLDQDTL-WQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHP  72

Query  521  RERlipppdsllspiglpLRP---GEPLC-----------------AFYSRYGICKFGPS  402
              R +    ++ +       P   G+P C                  +Y + G CKFG +
Sbjct  73   PNRKLYLMQAIATARMKGEYPERMGQPECQTTKFMYVQRSSMSINDQYYLKTGTCKFGAT  132

Query  401  CKFDHP  384
            CKF HP
Sbjct  133  CKFHHP  138


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP + EC +YM+TG CKFG+ CKFH+P+
Sbjct  155  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQ  185



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   185 bits (470),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  262  SEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFH  321

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S 
Sbjct  322  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASP  381

Query  347  TTNAPTVRHF  318
            + +AP  R  
Sbjct  382  SADAPGRRML  391


 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A + +  FPER GQPECQ+Y+KTG CKFGA C+FH+PR++        ++ +G PLRP E
Sbjct  84   AARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNE  143

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
            P CA+Y R G CKFG +CKF HP
Sbjct  144  PECAYYLRTGQCKFGNTCKFHHP  166


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 10/86 (12%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERli----------pppdsllspiglpLR  462
            +PE PG+P+C +Y++TG C+FGA C+F++P  R +              +       P R
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLLPDSFFFENYQAIAAARMKGEFPER  94

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHP  384
             G+P C +Y + G CKFG +C+F HP
Sbjct  95   IGQPECQYYLKTGTCKFGATCRFHHP  120



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             + G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PR
Sbjct  249  TSAGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPR  308

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY IS SST +
Sbjct  309  ERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTAD  368

Query  338  APTVRHF  318
             PTVR  
Sbjct  369  VPTVRRL  375


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 54/100 (54%), Gaps = 24/100 (24%)
 Frame = -2

Query  611  FPERPGQPEC------------------------QFYMKTGDCKFGAVCKFHYPRERlip  504
            +PERPG+ +C                         +Y+KTG CKFGA CKFH+P+++   
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLYYLKTGTCKFGATCKFHHPKDKAGI  106

Query  503  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
                 L+ +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  107  AGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNTCKFHHP  146



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             + G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PR
Sbjct  240  TSAGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPR  299

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY IS SST +
Sbjct  300  ERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTAD  359

Query  338  APTVRHF  318
             PTVR  
Sbjct  360  VPTVRRL  366


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  51   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  110

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  111  RPNEKECAYYIRTGQCKFGNTCKFHHP  137


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+ +C +Y++TG C+FG  CKF++P  R      +     G P R G+P C +Y 
Sbjct  17   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNR-RLAIAAARIKGGYPERVGQPECQYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGATCKFHHP  91



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             + G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PR
Sbjct  270  TSAGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPR  329

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERL+P P+ LLSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY IS SST +
Sbjct  330  ERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGTFTYGISTSSTAD  389

Query  338  APTVRHF  318
             PTVR  
Sbjct  390  VPTVRRL  396


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  81   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEKECAYYIRTGQCKFGNTCKFHHP  167


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+ +C +Y++TG C+FG  CKF++P  R      +     G P R G+P C +Y 
Sbjct  47   YPERPGEADCGYYIRTGLCRFGMTCKFNHPPNR-RLAIAAARIKGGYPERVGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+ ++PMG+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  270  SESVNAGSQGTFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  329

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LS IGLPLRPGEPLC FYSRYGICKFGPSCKF HPMG+FTYN++ SS
Sbjct  330  HPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASS  389

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  390  SADAPVRR  397


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  84   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPL  143

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  144  RLNEMECAYYLRTGQCKFGSTCKFHHP  170


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C+F++P  R      +       P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  108

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    YR+G++P+G+YALQ EN FPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  267  SESLNTGSQGALSPYRSGSVPVGFYALQTENAFPERPGQPECQFYMKTGDCKFGAVCRFH  326

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYG+CKFGPSCK+DHPMG+FTYN+S SS
Sbjct  327  HPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPSCKYDHPMGIFTYNLSASS  386

Query  347  TTNAPTVR  324
            +T+ P  R
Sbjct  387  STDTPVRR  394


 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  82   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNIMGYPL  141

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  142  RPNEIECAYYLRTGQCKFGSTCKFHHP  168


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  48   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  106

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  107  KTGTCKFGATCKFHHP  122



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  268  EPENSGSQGTFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN + SS+
Sbjct  328  PRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNPNASSS  387

Query  344  TNAPTVR  324
             +AP  R
Sbjct  388  ADAPARR  394


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CK+ HP
Sbjct  152  RTGQCKFGSTCKYHHP  167


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERIGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N+GSQG    YR+G++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  268  EPENLGSQGAYSPYRSGSIPVGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++ SS+
Sbjct  328  PRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLAASSS  387

Query  344  TNAPTVR  324
              +P  R
Sbjct  388  AESPVRR  394


 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  92   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYL  151

Query  431  RYGICKFGPSCKFDHP  384
            R G CKF  +CK+ HP
Sbjct  152  RTGQCKFASTCKYHHP  167


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERVGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E  N GSQG    YR+ ++PMG+YALQRE+VFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  270  NESVNAGSQGTFSPYRSDSVPMGFYALQRESVFPERPGQPECQFYMKTGDCKFGAVCRFH  329

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LS IGLPLRPGEPLC FYSRYGICKFGPSCKF HPMG+FTYN++ SS
Sbjct  330  HPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPSCKFHHPMGIFTYNLTASS  389

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  390  SADAPVRR  397


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  84   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPL  143

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  144  RLNEMECAYYLRTGQCKFGSTCKFHHP  170


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C+F++P  R      +       P R G+P C +Y 
Sbjct  50   YPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  108

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  109  KTGTCKFGATCKFHHP  124



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+   +GSQ +   YR  + PMGYYALQ ENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  257  SDPVAMGSQAVTSPYRQASGPMGYYALQEENVFPERPGQPECQFYMKTGDCKFGAVCRFH  316

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIPPPD LLSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY+I+ SS
Sbjct  317  HPRERLIPPPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASS  376

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
             T+APTV+  LGSSSGT  L ++SEG
Sbjct  377  ATDAPTVQRLLGSSSGTSALNMTSEG  402


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+++KTG CKFGA CKFH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVMGYPLRPNESECAYYM  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P R G+P+C +Y++TG C+FG+ C+F++P  R      +       P R G+P C ++ 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQPECQYFL  101

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  102  KTGTCKFGATCKFHHP  117



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE AN GSQG    +R+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  251  SEPANSGSQGAYSQFRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P ER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYN+S S 
Sbjct  311  HPHERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNMSASP  370

Query  347  TTNAPTVR  324
              +AP  R
Sbjct  371  LADAPGRR  378


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FH+PR++        L+ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  128

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP EP C +Y R G CKFG +CKF HP
Sbjct  129  RPNEPECGYYLRTGQCKFGNTCKFHHP  155


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  35   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  93

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +C+F HP
Sbjct  94   KTGTCKFGATCRFHHP  109



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+ A +GSQG+   YR  + PMGYYALQ ENVFPERPGQ ECQFYMKTGDCKFGAVC+FH
Sbjct  257  SDPATMGSQGVTSPYRQASGPMGYYALQGENVFPERPGQAECQFYMKTGDCKFGAVCRFH  316

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIPPPD LLSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM VFTY+I+ SS
Sbjct  317  HPRERLIPPPDCLLSPIGLPLRTGEPLCIFYSRYGICKFGPSCKFDHPMTVFTYSIAASS  376

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            TT+APTV+  LGSSSGT  L ++SEG
Sbjct  377  TTDAPTVQRLLGSSSGTSALNMTSEG  402


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+++KTG CKFGA CKFH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERIGQPECQYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNESECAYYM  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  148  RTGQCKFGSTCKFHHP  163


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P R G+P+C +Y++TG C+FG+ C+F++P  R      +       P R G+P C ++ 
Sbjct  43   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQPECQYFL  101

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  102  KTGTCKFGATCKFHHP  117



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFGAVC+FH+
Sbjct  181  ELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHH  240

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+YNI+ S +
Sbjct  241  PRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTSPS  300

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
             +AP+ RH LGSSSGT  L LSSEG
Sbjct  301  ADAPS-RHLLGSSSGTAALNLSSEG  324


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  5    FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  64

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  65   RTGQCKFGNTCKFHHP  80


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  51   YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  81



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    +R+G++P+G+YAL REN+FPERP QP+CQFYMKTGDCKFGAVC+FH
Sbjct  233  SEPTNAGSQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDCQFYMKTGDCKFGAVCRFH  292

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S 
Sbjct  293  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASP  352

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  353  SADAPGRR  360


 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FH+PR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  110

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  111  RPNEPECAYYLRTGQCKFGNTCKFHHP  137


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  108  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  138



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N GSQG    +R+G++P+G+YAL REN+FPERP QP+CQFYMKTGDCKFGAVC+FH
Sbjct  251  SEPTNAGSQGAYSQFRSGSVPVGFYALPRENIFPERPDQPDCQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMGVFTYNIS S 
Sbjct  311  HPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYNISASP  370

Query  347  TTNAPTVR  324
            + +AP  R
Sbjct  371  SADAPGRR  378


 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA C+FH+PR++        L+ +G PL
Sbjct  69   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPL  128

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP EP CA+Y R G CKFG +CKF HP
Sbjct  129  RPNEPECAYYLRTGQCKFGNTCKFHHP  155


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQ  156



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+  +VG QG  PSYR+G++P+G YALQRE+VFPERP QPECQFYMKTGDCKFGAVC+FH
Sbjct  267  SDTTSVGVQGTFPSYRSGSVPVGLYALQRESVFPERPDQPECQFYMKTGDCKFGAVCRFH  326

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG FTY++S  S
Sbjct  327  HPRERLIPVPNCVLSPLGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGPFTYSLSAFS  386

Query  347  TTNAPTVR  324
            +T+ P +R
Sbjct  387  STDVPVIR  394


 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  79   LAVVAARMIGSYPERIGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVPLNILGYPL  138

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  139  RPNERECAYYLRTGQCKFGNTCKFHHP  165


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+ +C +Y++TG C+FG  C+F++P  R      +       P R G+P C +Y 
Sbjct  45   YPERPGELDCAYYVRTGLCRFGMTCRFNHPPNR-KLAVVAARMIGSYPERIGQPECQYYL  103

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  104  KTGTCKFGATCKFHHP  119



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFGAVC+FH+
Sbjct  253  ELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHH  312

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+YNI+ S +
Sbjct  313  PRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITASPS  372

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
             +AP+ RH LGSSSGT  L LSSEG
Sbjct  373  ADAPS-RHLLGSSSGTAALNLSSEG  396


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ   +T  CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQARTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  136

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  137  RTGQCKFGNTCKFHHP  152


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  123  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  153



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A  GSQ     +R+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFG VC+FH
Sbjct  236  NESATAGSQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFH  295

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS
Sbjct  296  HPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSS  355

Query  347  TTNAPTVR  324
             ++AP  R
Sbjct  356  PSDAPVHR  363


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  51   LAIAAARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  110

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  342
            RP EP CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  111  RPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  160



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE     SQG   SYR+G++P+GYYALQR+NVFPERPGQPECQ+YMKTGDCKFGAVC+FH
Sbjct  282  SESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFH  341

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD LLS +GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG+F YN+SP++
Sbjct  342  HPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGIFAYNVSPTA  401

Query  347  TTNAPTVRHF  318
            T  +   R+ 
Sbjct  402  TDASAMRRYL  411


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKF++P+++        L+ +G PLRP EP CA+Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+ +C FY++TG C+FG+ C+F++P  R      +       P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNR-KLALATARMKGEFPERTGQPECQYYL  126

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF+HP
Sbjct  127  KTGTCKFGATCKFNHP  142


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG+ CKFH+P+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQ  189



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE     SQG   SYR+G++P+GYYALQR+NVFPERPGQPECQ+YMKTGDCKFGAVC+FH
Sbjct  284  SESPVSASQGAYSSYRSGSVPVGYYALQRDNVFPERPGQPECQYYMKTGDCKFGAVCRFH  343

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD LLS +GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG+F YN+SP++
Sbjct  344  HPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGIFAYNVSPTA  403

Query  347  TTNAPTVRHF  318
            T  +   R+ 
Sbjct  404  TDASAMRRYL  413


 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKF++P+++        L+ +G PLRP EP CA+Y 
Sbjct  113  FPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYL  172

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  173  RTGQCKFGSTCKFHHP  188


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+ +C FY++TG C+FG+ C+F++P  R      +       P R G+P C +Y 
Sbjct  68   YPEREGEADCSFYLRTGLCRFGSTCRFNHPPNR-KLALATARMKGEFPERTGQPECQYYL  126

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF+HP
Sbjct  127  KTGTCKFGATCKFNHP  142


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG+ CKFH+P+
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQ  189



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E+AN GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFY+KTGDCKFGAVC+FH+
Sbjct  255  ELANAGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYVKTGDCKFGAVCQFHH  314

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM +F+YNI+ S +
Sbjct  315  PRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMEIFSYNITTSPS  374

Query  344  TNAPTVRHFlgsssgtgtltlsSEG  270
             +AP+ RH LGSSSGT  L LSSEG
Sbjct  375  ADAPS-RHLLGSSSGTAALNLSSEG  398


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  79   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  138

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  139  RTGQCKFGNTCKFHHP  154


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  34   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-RLAIATARMIGEFPERIGQPECQYYL  92

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  93   KTGTCKFGATCKFHHP  108


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  125  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  155



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  190  NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRE  249

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  + 
Sbjct  250  RLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADV  309

Query  335  PTVRHF  318
            PTV+H 
Sbjct  310  PTVQHL  315


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG+ CKFH+P+E+      + L+ +G PLRP E  CA+Y 
Sbjct  13   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  72

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CK+ HP 
Sbjct  73   RTGECKFGSTCKYHHPQ  89



>gb|KJB82176.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=407

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A  GSQ      R+ ++P+G YALQRENVFPERPG+PECQFYMKTGDCKFGAVCKFH
Sbjct  232  NESATAGSQASFSELRSSSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFH  291

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN SPSS
Sbjct  292  HPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSS  351

Query  347  TTNAPT  330
             ++AP 
Sbjct  352  PSDAPV  357


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 55/105 (52%), Gaps = 16/105 (15%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEP------  450
            +PERPG+P+C +Y++TG C+FGA C F++P  R      +       P R G+P      
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQNET  110

Query  449  LCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  342
             CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  111  ECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  155


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 6/48 (13%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQ------FYMKTGDCKFGAVCKFHYPR  519
            +   A + +  FPER GQPECQ      +Y++TG CKFG+ CKFH+P+
Sbjct  86   LAIAAARMKGEFPERVGQPECQNETECAYYLRTGQCKFGSTCKFHHPQ  133



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  199  NIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPRE  258

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  + 
Sbjct  259  RLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMADV  318

Query  335  PTVRHF  318
            PTV+H 
Sbjct  319  PTVQHL  324


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG+ CKFH+P+E+      + L+ +G PLRP E  CA+Y 
Sbjct  22   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  81

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CK+ HP 
Sbjct  82   RTGECKFGSTCKYHHPQ  98



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A  GSQ     +R+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFG VC+FH
Sbjct  276  NESATAGSQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFH  335

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS
Sbjct  336  HPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSTSS  395

Query  347  TTNAPTVR  324
             ++AP  R
Sbjct  396  PSDAPVHR  403


 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 66/110 (60%), Gaps = 9/110 (8%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  91   LAIAAARMKGEFPERAGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  150

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  342
            RP EP CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  151  RPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVRGSPIYQTVPSPTT  200



>ref|XP_009392483.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=359

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FH+PR
Sbjct  186  TNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPR  245

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  +
Sbjct  246  ERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMAD  305

Query  338  APTVRHF  318
             PTV+H 
Sbjct  306  VPTVQHL  312


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+RPG+P+C +Y++TG C+FG  CKF++P+ R +    +     G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNR-MLAIAAARIRGGYPERVGQPECQYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGSTCKFHHP  91


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            +PER GQPECQ+Y+KTG CKFG+ CKFH+P+E+
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEK  94



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
             G+QG   SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PRER
Sbjct  272  AGAQGTFSSYRPGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGAVCKFHHPRER  331

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  333
            L+P P+  LSP+GLPLRPGEPLC FY+RYGICKFGP+CKFDHPMG FTY IS SST +AP
Sbjct  332  LVPVPNCSLSPLGLPLRPGEPLCVFYARYGICKFGPNCKFDHPMGTFTYGISTSSTADAP  391


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PL
Sbjct  81   LAIAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPL  140

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEKECAYYLRTGQCKFGNTCKFHHP  167


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  CKF++P  R      +     G P R G+P C +Y 
Sbjct  47   YPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNR-KLAIAAARIKGGYPERVGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 5/130 (4%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E  + G+Q     + +G+LPMGYYA QR+NVFPERPGQPECQFYMKTGDCKFGAVCKFH
Sbjct  255  NETGDAGTQ-----FHSGSLPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGAVCKFH  309

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VF YN   SS
Sbjct  310  HPRERLIPVPDCILSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMTVFGYNAGASS  369

Query  347  TTNAPTVRHF  318
            +T++P +R F
Sbjct  370  STDSPAIRRF  379


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  86   YPERIGQSECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNEIECAYYM  145

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  146  RNGQCKFGSTCKFHHP  161


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P R G+P+C +Y++TG C+FG+ C+F++P  R      +       P R G+  C +Y 
Sbjct  41   YPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNR-KLAIATARMKGEYPERIGQSECQYYL  99

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  100  KTGTCKFGATCKFHHP  115



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFYMKTGDCKFGAVCKFH+P+E
Sbjct  195  SIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKE  254

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG F Y +S SS T  
Sbjct  255  RLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGV  314

Query  335  PTVRHF  318
            PT  H 
Sbjct  315  PTAWHL  320


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA+CKFH+P+E+        L+ +G PLR  E  CA+Y 
Sbjct  18   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  77

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF HP 
Sbjct  78   RTGECKFGGTCKFHHPQ  94



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A  GSQ      R+ ++P+G YALQRENVFPERPG+PECQFYMKTGDCKFGAVCKFH
Sbjct  272  NESATAGSQASFSELRSSSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFH  331

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN SPSS
Sbjct  332  HPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNYSPSS  391

Query  347  TTNAPT  330
             ++AP 
Sbjct  392  PSDAPV  397


 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  86   LAIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPL  145

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHPM---------GVFTYNISPSSTT  342
            RP E  CA+Y R G CKFG +CKF HP          G   Y   PS TT
Sbjct  146  RPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVSLRGSPIYQTVPSPTT  195


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C F++P  R      +       P R G+P C +Y 
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQYYL  110

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  247  NAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  306

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S    A
Sbjct  307  RTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA  366


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA C+FH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  237  NAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  296

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S    A
Sbjct  297  RTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA  356


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA C+FH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  62   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  121

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  122  RTGQCKFGNTCKFHHP  137


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  17   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +C+F HP
Sbjct  76   KTGTCKFGATCRFHHP  91



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             N+G+QG   SYR G++ MG YA+ REN+FPERPGQPECQFYMKTGDCKFGAVC+FH+PR
Sbjct  238  TNIGAQGKFSSYRPGSVSMGLYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPR  297

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERLIP P+ +L+P+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG  TY +S SS  +
Sbjct  298  ERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMGPVTYGLSESSMAD  357

Query  338  APTVRHF  318
             PTV+H 
Sbjct  358  VPTVQHL  364


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG+ CKFH+P+E+      + L+ +G PLRP E  CA+Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYI  121

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CK+ HP
Sbjct  122  RTGECKFGSTCKYHHP  137


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+RPG+P+C +Y++TG C+FG  CKF++P+ R +    +     G P R G+P C +Y 
Sbjct  17   YPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNR-MLAIAAARIRGGYPERVGQPECQYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGSTCKFHHP  91



>ref|XP_009416575.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=393

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFYMKTGDCKFGAVCKFH+P+E
Sbjct  220  SIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKE  279

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG F Y +S SS T  
Sbjct  280  RLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGV  339

Query  335  PTVRHF  318
            PT  H 
Sbjct  340  PTAWHL  345


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  537
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  536  KFHYPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            KF++P  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            +PER GQPECQ+Y+KTG CKFGA+CKFH+P+E+
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEK  126



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N G QG+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  257  NAGLQGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  316

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S    A
Sbjct  317  RTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA  376


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 55/86 (64%), Gaps = 10/86 (12%)
 Frame = -2

Query  611  FPERPGQPECQ----------FYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            FPER GQPECQ          +Y+KTG CKFGA C+FH+P+++        L+ +G PLR
Sbjct  72   FPERLGQPECQASVNECCIMHYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLR  131

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHP  384
            P E  CA+Y R G CKFG +CKF HP
Sbjct  132  PNESECAYYLRTGQCKFGNTCKFHHP  157


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 11/86 (13%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA---  441
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C    
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQASV  85

Query  440  -------FYSRYGICKFGPSCKFDHP  384
                   +Y + G CKFG +C+F HP
Sbjct  86   NECCIMHYYLKTGTCKFGATCRFHHP  111



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFYMKTGDCKFGAVCKFH+P+E
Sbjct  271  SIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKE  330

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG F Y +S SS T  
Sbjct  331  RLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGV  390

Query  335  PTVRHF  318
            PT  H 
Sbjct  391  PTAWHL  396


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA+CKFH+P+E+        L+ +G PLR  E  CA+Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF HP 
Sbjct  154  RTGECKFGGTCKFHHPQ  170


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  537
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  536  KFHYPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            KF++P  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G+QG  PSYR G+ PMG YA+  EN+FPERPGQPECQFYMKTGDCKFGAVCKFH+P+E
Sbjct  269  SIGAQGKFPSYRPGSTPMGLYAVPGENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPKE  328

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            RL+P P+ +LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG F Y +S SS T  
Sbjct  329  RLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPNCKFDHPMGTFAYGVSASSATGV  388

Query  335  PTVRHF  318
            PT  H 
Sbjct  389  PTAWHL  394


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA+CKFH+P+E+        L+ +G PLR  E  CA+Y 
Sbjct  94   YPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYI  153

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF HP 
Sbjct  154  RTGECKFGGTCKFHHPQ  170


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 63/112 (56%), Gaps = 7/112 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENV------FPERPGQPECQFYMKTGDCKFGAVC  537
            A   ++G + S + GT     +   RE+       +PERPG+P+C +Y++TG C+FG  C
Sbjct  12   ARTVTEGPSLSSQPGTDEEAMWKRMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTC  71

Query  536  KFHYPRERlipppdsllspigl-pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            KF++P  R++    +     G  P R G+P C +Y + G CKFG  CKF HP
Sbjct  72   KFNHPPNRMLAVAAAAARIRGGYPERVGQPECQYYLKTGTCKFGAICKFHHP  123



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  689  GSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERl  510
            GS+     + +G++PMGYYA QR+NVFPERPGQPECQFYMKTGDCKFG VCKFH+PRERL
Sbjct  229  GSRNTGSQFHSGSVPMGYYAFQRDNVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRERL  288

Query  509  ipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  330
            +P PD +LSPIGLPLR GEPLC FYSRYGICKFGPSCKFDHPM VF YN + S +T++P 
Sbjct  289  MPVPDCVLSPIGLPLRTGEPLCVFYSRYGICKFGPSCKFDHPMRVFAYNAAASPSTDSPA  348

Query  329  VRHF  318
            +RHF
Sbjct  349  IRHF  352


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQ ECQ+Y+KTG CKFGA CKF +PRE+        L+ +G P+R  E  CA+Y 
Sbjct  59   YPERMGQSECQYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYM  118

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  119  RNGQCKFGSTCKFHHP  134


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
            ++P R  +P+C +Y++TG C+FGA C+F++P  R      +       P R G+  C +Y
Sbjct  13   LYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATAKMKGEYPERMGQSECQYY  71

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKFDHP
Sbjct  72   LKTGTCKFGATCKFDHP  88



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
             GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFYMKTGDCKFGAVC+FH+P+ER
Sbjct  235  AGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQER  294

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  333
            L+P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM +F++NIS S + +AP
Sbjct  295  LVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAP  354

Query  332  TVRHFlgsssgtgtltlsSEG  270
            + RH LGSSSGT  L LSSEG
Sbjct  355  S-RHLLGSSSGTAALNLSSEG  374


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ   +T  CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  66   FPERIGQPECQACTRT--CKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  123

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  124  RTGQCKFGNTCKFHHP  139


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  110  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  140



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
             GSQG    +R+GT+P+G+Y LQREN+FPERPGQPECQFYMKTGDCKFGAVC+FH+P+ER
Sbjct  251  AGSQGAYSQFRSGTVPVGFYTLQRENIFPERPGQPECQFYMKTGDCKFGAVCRFHHPQER  310

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  333
            L+P P+ +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM +F++NIS S + +AP
Sbjct  311  LVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMEIFSHNISASPSADAP  370

Query  332  TVRHFlgsssgtgtltlsSEG  270
            + RH LGSSSGT  L LSSEG
Sbjct  371  S-RHLLGSSSGTAALNLSSEG  390


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+P+++        L+ +G PLRP EP C +Y 
Sbjct  80   FPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYL  139

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  140  RTGQCKFGNTCKFHHP  155


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +YM+TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  35   YPERPGEPDCSYYMRTGLCRFGATCRFNHPPNR-KLAIATARMIGEFPERIGQPECQYYL  93

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  94   KTGTCKFGATCKFHHP  109


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RP +PEC +Y++TG CKFG  CKFH+P+
Sbjct  126  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ  156



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E+ N G QG    YR+G++P+G+YALQR+N+FPERP QPECQFYMKTGDCKFGAVC+FH+
Sbjct  244  ELENAGLQGAYSQYRSGSVPVGFYALQRDNIFPERPDQPECQFYMKTGDCKFGAVCRFHH  303

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNIS  357
            PRER IP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN++
Sbjct  304  PRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVA  359


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA C+FH+P+++        L+ +G PLRP E   A+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERAYYL  131

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101



>gb|KJB26822.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=370

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  195  NESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  254

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS
Sbjct  255  HPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPSCKFNHPMGIFTYNYSISS  314

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
             + AP V H L SSSGT  L LSSEG
Sbjct  315  PSGAP-VHHLLESSSGTSGLNLSSEG  339


 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P RP E
Sbjct  16   AARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNE  75

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              CA+Y R G CKFG +CKF HP
Sbjct  76   TECAYYLRTGQCKFGSTCKFHHP  98



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            N G  G+   YR+G++P+G+YALQREN+FPERP QPECQFYMKTGDCKFGAVC+FH+PRE
Sbjct  247  NAGLPGVYSQYRSGSVPVGFYALQRENIFPERPDQPECQFYMKTGDCKFGAVCRFHHPRE  306

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R IP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S S    A
Sbjct  307  RTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMGIFTYNVSASPLAEA  366


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA C+FH+P+++        L+ +G PLRP E  CA+Y 
Sbjct  72   FPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYL  131

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  132  RTGQCKFGNTCKFHHP  147


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE PG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  27   YPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIATARMKGEFPERLGQPECQYYL  85

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +C+F HP
Sbjct  86   KTGTCKFGATCRFHHP  101



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  251  SDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFH  310

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+   N+S SS
Sbjct  311  HPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILN-NLSASS  369

Query  347  TTNAPTVRHF  318
             + AP  R  
Sbjct  370  PSGAPVRRML  379


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 1/130 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  261  SDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFH  320

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPMG+   N+S SS
Sbjct  321  HPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFDHPMGILN-NLSASS  379

Query  347  TTNAPTVRHF  318
             + AP  R  
Sbjct  380  PSGAPVRRML  389


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116



>gb|KJB75170.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=401

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A+ GSQ +   +R+G+ P+G+YALQRENVFPERPG+ ECQFYMKTGDCKFGAVC+FH
Sbjct  226  NESASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFH  285

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMGVFT+N S SS
Sbjct  286  HPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASS  345

Query  347  TTNAPTVR  324
               AP  R
Sbjct  346  PFEAPVHR  353


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  51   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  110

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  111  RTGQCKFGSTCKFHHP  126


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  6    YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAITTARMKGEFPERVGQPECQYYL  64

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  65   KTGTCKFGATCKFHHP  80



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 121/146 (83%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  274  NESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  333

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN S SS
Sbjct  334  HPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPSCKFNHPMGIFTYNYSISS  393

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
             + AP V H L SSSGT  L LSSEG
Sbjct  394  PSGAP-VHHLLESSSGTSGLNLSSEG  418


 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P 
Sbjct  91   LAIAAARMKGEFPERVGQPECQYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPF  150

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  151  RPNETECAYYLRTGQCKFGSTCKFHHP  177


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 9/90 (10%)
 Frame = -2

Query  653  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspig  474
            T+  GYY        PERPG+P+C +Y++TG C+FGA C+F++P  R      +      
Sbjct  51   TMESGYY--------PERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGE  101

Query  473  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             P R G+P C +Y + G CKFG +CKF HP
Sbjct  102  FPERVGQPECQYYLKTGTCKFGATCKFHHP  131



>gb|KHG30243.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=347

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 122/146 (84%), Gaps = 1/146 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E    GSQ     +R+G++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  172  NESVTGGSQASFSQFRSGSVPIGFYALPRENVFPERPGQPECQFYMKTGDCKFGAVCRFH  231

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+ P PD LLSPIGLPLRPGEPLC FYSRYGICKFG SCKF+HPMG+FTYN S SS
Sbjct  232  HPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGSSCKFNHPMGIFTYNYSISS  291

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
             + AP V HFLGSSSGT  L LSSEG
Sbjct  292  PSGAP-VHHFLGSSSGTSGLNLSSEG  316


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = -2

Query  581  QFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPS  402
            ++Y+KTG CKFGA CKFH+PRE+        L+ +G P RP E  CA+Y R G CKFG +
Sbjct  10   RYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  69

Query  401  CKFDHP  384
            CKF HP
Sbjct  70   CKFHHP  75



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  668  SYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsl  489
            SYR G++PMG YALQREN+FPERP QPECQFYMKTGDCKFG  C+FH+PRERL+P P+ +
Sbjct  284  SYRLGSIPMGVYALQRENIFPERPDQPECQFYMKTGDCKFGPACRFHHPRERLMPVPNCI  343

Query  488  lspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG F Y ++ SST + PT+RH 
Sbjct  344  LSPLGLPLRPGEPLCIFYSRYGICKFGPNCKFDHPMGTFAYGLATSSTADVPTIRHL  400


 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++        LS +G PLRP E  CA+Y 
Sbjct  92   YPERVGQPECQYYLKTGSCKFGATCKFHHPKDKAGIVGRVKLSILGYPLRPNEKECAYYL  151

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  152  RTGQCKFGNTCKFHHP  167


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  47   YPERPGEPDCAYYMRTGLCRFGMTCKFNHPPNR-KMAIAAARIRGAYPERVGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGSCKFGATCKFHHP  121



>gb|KJB75168.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=444

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A+ GSQ +   +R+G+ P+G+YALQRENVFPERPG+ ECQFYMKTGDCKFGAVC+FH
Sbjct  269  NESASAGSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFH  328

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMGVFT+N S SS
Sbjct  329  HPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGVFTFNYSASS  388

Query  347  TTNAPTVR  324
               AP  R
Sbjct  389  PFEAPVHR  396


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  94   FPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYL  153

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  154  RTGQCKFGSTCKFHHP  169


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  49   YPERPGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAITTARMKGEFPERVGQPECQYYL  107

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S  A +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  275  SGTAGIGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFH  334

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  + S 
Sbjct  335  HPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGSAMYGHASSP  394

Query  347  TTNAPT  330
            T+ APT
Sbjct  395  TSEAPT  400


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  88   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  147

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  148  RANEKECAYYLRTGQCKFGSTCKFHHP  174


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  54   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  112

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  113  KTGTCKFGATCKFHHP  128



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  268  EPENSGSQGGFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            P ERLIP PD +LSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPMG+FTY +
Sbjct  328  PMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMGIFTYGL  382


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPL  140

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEIECAYYLRTGQCKFGGTCKFHHP  167


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    YR+G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  269  EPENSGSQGGFSPYRSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  328

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            P ERLIP PD +LSPIGLPLRPGEP+C FYSRYGICKFGPSCKFDHPMG+FTY +
Sbjct  329  PMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPSCKFDHPMGIFTYGL  383


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPL  140

Query  464  RP-GEPLCAFYSRYGICKFGPSCKFDHP  384
            RP  E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPQNEIECAYYLRTGQCKFGGTCKFHHP  168


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  268  EPENSGSQGGFSPYSSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            PRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FT N+
Sbjct  328  PRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTLNL  382


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPL  140

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPNEVECAYYLRTGQCKFGSTCKFHHP  167


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYY  104

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+
Sbjct  269  EPENSGSQGGFSPYSSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHH  328

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            PRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FT N+
Sbjct  329  PRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTLNL  383


 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPL  140

Query  464  RP-GEPLCAFYSRYGICKFGPSCKFDHP  384
            RP  E  CA+Y R G CKFG +CKF HP
Sbjct  141  RPQNEVECAYYLRTGQCKFGSTCKFHHP  168


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y
Sbjct  46   AYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYY  104

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  105  LKTGTCKFGATCKFHHP  121



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  N GSQG    Y +G++P+G+YALQRENVFPERPGQPECQFYMKTGDCKFG VC+FH+
Sbjct  268  EPENSGSQGGFSPYGSGSIPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGGVCRFHH  327

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            PRERLIP PD +LSP+GLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTYN+
Sbjct  328  PRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYNL  382


 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PL
Sbjct  81   LAIAAARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGXVALNILGYPL  140

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVR  324
            RP E  CA+Y R G CKFG +CKF HP       +S   +T  PTV+
Sbjct  141  RPNEVECAYYLRTGQCKFGSTCKFHHPQPT-NMMVSVGGSTVYPTVQ  186


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  47   YPERAGEPDCSYYIRTGLCRFGATCRFNHPPNR-KLAIAAARMKGEFPERIGQPECQYYL  105

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  106  KTGTCKFGATCKFHHP  121



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  236  SETPTMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFH  295

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER++P P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  296  HPKERIVPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  355

Query  347  TTNAPTVRHF  318
            T +  T R  
Sbjct  356  TGDMSTARRM  365


 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  49   MAVAAARMKGEYPQRIGQPECQYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPL  108

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHHP  135


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  15   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  73

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  74   KTGACKFGATCKFHHP  89



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   170 bits (430),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 107/130 (82%), Gaps = 4/130 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            +VG QG   SYR+ + PMG YALQR+NVFPERP QPECQFYMKTGDCKFGA CKFH+P+E
Sbjct  277  SVGVQGTMSSYRSSSTPMGQYALQRDNVFPERPDQPECQFYMKTGDCKFGAACKFHHPKE  336

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPSS  348
            RL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH    PMG+F Y++S S 
Sbjct  337  RLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGIFAYSLSTSL  396

Query  347  TTNAPTVRHF  318
            + +AP VR  
Sbjct  397  SADAPVVRRL  406


 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++      + L+ +G P+RP E  CA+Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIRPNEKECAYYL  157

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
            ++PERPG+P+C +Y++TG C++G  C++++P +R      +     G P R G+P C +Y
Sbjct  52   LYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDR-KLAIAAARIRGGYPERVGQPECQYY  110

Query  434  SRYGICKFGPSCKFDHP---MGVF  372
             + G CKFG +CKF HP    G+F
Sbjct  111  LKTGTCKFGATCKFHHPKDKAGIF  134



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 5/129 (4%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  NVGSQ     + + TLP+GYYA +R+NVFPERPGQP+CQFYMKTGDCKFGAVCKFH+
Sbjct  248  EGLNVGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHH  302

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VF +N + S++
Sbjct  303  PRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASAS  362

Query  344  TNAPTVRHF  318
            T+   VR F
Sbjct  363  TDGNAVRDF  371


 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  653  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspig  474
            TL +    ++ E  +PER GQPECQ+Y+KTG CKFGA CKFH+PR+ L       L+ +G
Sbjct  70   TLAIATARMKSE--YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLG  127

Query  473  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             PLRP E  CA+Y R G+CKFG +CKF HP
Sbjct  128  YPLRPNEINCAYYIRNGLCKFGRTCKFHHP  157


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P R G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  37   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNR-TLAIATARMKSEYPERIGQPECQYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGATCKFHHP  111



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  236  SETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFH  295

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  296  HPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  355

Query  347  TTNAPTVRHF  318
            T +    R  
Sbjct  356  TGDVSARRML  365


 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  49   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  108

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHHP  135


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  15   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  73

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  74   KTGTCKFGATCKFHHP  89



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 5/129 (4%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E  NVGSQ     + + TLP+GYYA +R+NVFPERPGQP+CQFYMKTGDCKFGAVCKFH+
Sbjct  238  EGLNVGSQ-----FGSNTLPIGYYAFKRDNVFPERPGQPQCQFYMKTGDCKFGAVCKFHH  292

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PRERLIP PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VF +N + S++
Sbjct  293  PRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFAHNAAASAS  352

Query  344  TNAPTVRHF  318
            T+   VR F
Sbjct  353  TDGNAVRDF  361


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 62/90 (69%), Gaps = 2/90 (2%)
 Frame = -2

Query  653  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspig  474
            TL +    ++ E  +PER GQPECQ+Y+KTG CKFGA CKFH+PR+ L       L+ +G
Sbjct  60   TLAIATARMKSE--YPERIGQPECQYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLG  117

Query  473  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             PLRP E  CA+Y R G+CKFG +CKF HP
Sbjct  118  YPLRPNEINCAYYIRNGLCKFGRTCKFHHP  147


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P R G+P+C +Y++TG C+FGA C+F++P  R      +       P R G+P C +Y 
Sbjct  27   YPVREGEPDCSYYIRTGLCRFGATCRFNHPLNR-TLAIATARMKSEYPERIGQPECQYYL  85

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  86   KTGTCKFGATCKFHHP  101



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             + G+ G  PSYR G +P+G YA+ REN+FPERPGQPECQFYMKTGDCKFGAVCKFH+PR
Sbjct  238  TSTGAHGKFPSYRPGPVPVGMYAVPRENIFPERPGQPECQFYMKTGDCKFGAVCKFHHPR  297

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            ERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CK+DHP+  +TY +S SS   
Sbjct  298  ERLVPVPNCVLSPLGLPLRPGEPLCDFYSRYGICKFGPNCKYDHPIRTYTYGLSASSMAE  357

Query  338  APTVRHF  318
             PT  H 
Sbjct  358  VPTAWHL  364


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  62   YPERVGQPECQYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYYL  121

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF HP 
Sbjct  122  RTGECKFGSTCKFHHPQ  138



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  244  SETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFH  303

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  304  HPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  363

Query  347  TTNAPTVRHF  318
            T +    R  
Sbjct  364  TGDVSARRML  373


 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  57   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  116

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  117  RPNEKECAYYLRTGQCKFGSTCKFHHP  143


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  23   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  81

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  82   KTGTCKFGATCKFHHP  97



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  274  SETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFH  333

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  334  HPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  393

Query  347  TTNAPTVRHF  318
            T +    R  
Sbjct  394  TGDVSARRML  403


 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  87   MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  146

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  147  RPNEKECAYYLRTGQCKFGSTCKFHHP  173


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  53   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  111

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  112  KTGTCKFGATCKFHHP  127



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 4/130 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G QG   SYR+ + PMG YALQR++VFPERP QPECQFYMKTGDCKFGA CKFH+P+E
Sbjct  277  SMGVQGTISSYRSSSTPMGQYALQRDSVFPERPDQPECQFYMKTGDCKFGAACKFHHPKE  336

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPSS  348
            RL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDH    PMG+F Y++S SS
Sbjct  337  RLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPMATPMGIFAYSLSTSS  396

Query  347  TTNAPTVRHF  318
            + +AP VR  
Sbjct  397  SADAPVVRRL  406


 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+P+++      + L+ +G P+RP E  CA+Y 
Sbjct  98   YPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRPNEKECAYYL  157

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  158  RTGQCKFGNTCKFHHP  173



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PRE
Sbjct  239  SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRE  298

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  +PS  + A
Sbjct  299  RIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEA  358

Query  335  PTVRHF  318
            P  R  
Sbjct  359  PAPRRM  364


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  49   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  108

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDH  387
            RP E  CA+Y R G CKFG +CKF H
Sbjct  109  RPNEKECAYYLRTGQCKFGSTCKFHH  134


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  15   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  73

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  74   KTGTCKFGATCKFHHP  89



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PRE
Sbjct  273  SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRE  332

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  +PS  + A
Sbjct  333  RIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEA  392

Query  335  PTVRHF  318
            P  R  
Sbjct  393  PAPRRM  398


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  83   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  142

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDH  387
            RP E  CA+Y R G CKFG +CKF H
Sbjct  143  RPNEKECAYYLRTGQCKFGSTCKFHH  168


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  49   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  107

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++G QGM  SY+AG++P+G YA+QREN+FPERP QPECQFYMKTGDCKFGAVCKFH+PRE
Sbjct  275  SIGDQGMFSSYQAGSVPVGLYAVQRENLFPERPDQPECQFYMKTGDCKFGAVCKFHHPRE  334

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R+IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKFDHPMG   Y  +PS  + A
Sbjct  335  RIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFDHPMGNAMYGQAPSPASEA  394

Query  335  PTVRHF  318
            P  R  
Sbjct  395  PAPRRM  400


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  85   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  144

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDH  387
            RP E  CA+Y R G CKFG +CKF H
Sbjct  145  RPNEKECAYYLRTGQCKFGSTCKFHH  170


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  51   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  109

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  110  KTGTCKFGATCKFHHP  125



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE  N+G QGM  SY+AG++P+G Y +QRE++FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  359  SETPNMGDQGMFSSYQAGSVPLGLYTVQRESIFPERPDQPECQFYMKTGDCKFGAVCKFH  418

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LS +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  419  HPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  478

Query  347  TTNAPTVR  324
            T +    R
Sbjct  479  TGDVSARR  486


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  172  MAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPL  231

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  232  RPNEKECAYYLRTGQCKFGSTCKFHHP  258


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  138  YPERIGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAVAAARMKGEYPQRIGQPECQYYL  196

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  197  KTGTCKFGATCKFHHP  212



>ref|XP_004157161.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
Length=220

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FH+PRER++P PD +LSPIGLPLRPGEPLC
Sbjct  74   RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  133

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  134  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  174



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A  GSQ      R+G++P+G YALQRENVFPERPG+PECQFYMKTGDCKFGAVCKFH
Sbjct  258  NESATAGSQASFSELRSGSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFH  317

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER++P PD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKF+HPMG+FTY+ SPSS
Sbjct  318  HPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPSCKFNHPMGIFTYSYSPSS  377

Query  347  TTNAPT  330
             ++AP 
Sbjct  378  PSDAPV  383


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 59/93 (63%), Gaps = 6/93 (6%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQ------FYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            +   A + +  FPER GQPECQ      +Y+KTG CKFGA CKFH+PR++        L+
Sbjct  86   LAIAAARMKGEFPERVGQPECQACTYSSYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLN  145

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             +G PLRP E  CA+Y R G CKFG +CKF HP
Sbjct  146  ILGYPLRPNETECAYYLRTGQCKFGSTCKFHHP  178


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC----  444
            +PERPG+P+C +Y++TG C+FGA C F++P  R      +       P R G+P C    
Sbjct  52   YPERPGEPDCSYYIRTGLCRFGATCHFNHPPNR-KLAIAAARMKGEFPERVGQPECQACT  110

Query  443  --AFYSRYGICKFGPSCKFDHP  384
              ++Y + G CKFG +CKF HP
Sbjct  111  YSSYYLKTGTCKFGATCKFHHP  132



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  279  SGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFH  338

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+CKFDHP+G   +  + S 
Sbjct  339  HPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGHASSP  398

Query  347  TTNAPTVRHF  318
            T   PT R  
Sbjct  399  TGEVPTSRRM  408


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P 
Sbjct  92   LAVAAARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPF  151

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  152  RPNEKECAYYLRTGQCKFGSTCKFHHP  178


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  58   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRSGQPECQYYL  116

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  117  KTGTCKFGATCKFHHP  132



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            + G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTGDCKFGA CKFH+P+E
Sbjct  256  SAGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKE  315

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP----MGVFTYNISPSS  348
            RLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP    MG+F Y++S S+
Sbjct  316  RLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSA  375

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + + P VRH L SSS    LTLSSEG
Sbjct  376  SADIPIVRHLLASSSVPPALTLSSEG  401


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 55/100 (55%), Gaps = 24/100 (24%)
 Frame = -2

Query  611  FPERPGQPECQ------------------------FYMKTGDCKFGAVCKFHYPRERlip  504
            +P+R G+P+C                         +Y+KTG CKFGA CKFH+P+++   
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLYYLKTGTCKFGATCKFHHPKDKAGI  112

Query  503  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
               + L+ +G P+RP E  CA+Y R G CKFG +CKF HP
Sbjct  113  LGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTCKFHHP  152



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S    +G QGM  SY+AG++P+G YA+QRENVFPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  277  SGTPGMGDQGMFSSYQAGSVPVGLYAVQRENVFPERPDQPECQFYMKTGDCKFGAVCKFH  336

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRER+IP P+  LS +GLPLRPGEP+C+FYSRYG+CKFGP+CKFDHP+G   +  + S 
Sbjct  337  HPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPNCKFDHPLGTVMFGHASSP  396

Query  347  TTNAPTVRHF  318
            T   PT R  
Sbjct  397  TGEVPTSRRM  406


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P 
Sbjct  90   LAVAAARMKGEYPQRSGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPF  149

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  150  RPNEKECAYYLRTGQCKFGSTCKFHHP  176


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  56   YPERVGEPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRSGQPECQYYL  114

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  115  KTGTCKFGATCKFHHP  130



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPECQFYMKTGDCKFGAVCKF+
Sbjct  270  SETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFN  329

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    S 
Sbjct  330  HPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSVTSP  389

Query  347  TTNAPTVRH  321
            T++ PT+ +
Sbjct  390  TSDVPTLHY  398


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+      + L+ +G PL
Sbjct  83   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPL  142

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  143  RPNEKECAYYLRTGQCKFASTCKFHHP  169


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  49   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  107

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  108  KTGTCKFGATCKFHHP  123



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G  GM PSY+AG++P+G YA+Q +NVFPERP QPECQFYMKTGDCKFGAVCKF+
Sbjct  273  SETTGMGDHGMFPSYQAGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFN  332

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    S 
Sbjct  333  HPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTVMYGSVTSP  392

Query  347  TTNAPTVRH  321
            T++ PT+ +
Sbjct  393  TSDVPTLHY  401


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+      + L+ +G PL
Sbjct  86   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPL  145

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  146  RPNEKECAYYLRTGQCKFASTCKFHHP  172


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  52   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  110

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  111  KTGTCKFGATCKFHHP  126



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            + G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTGDCKFGA CKFH+P+E
Sbjct  277  SAGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKE  336

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP----MGVFTYNISPSS  348
            RLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP    MG+F Y++S S+
Sbjct  337  RLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSA  396

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + + P VRH L SSS    LTLSSEG
Sbjct  397  SADIPIVRHLLASSSVPPALTLSSEG  422


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PE  GQPECQ+Y+KTG CKFGA CKFH+P+++      + L+ +G P+
Sbjct  87   LAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPI  146

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  147  RPNEEECAYYLRTGQCKFGNTCKFHHP  173


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+R G+P+C +Y++TG C++G  C++++P  R +    + L      +  G+P C +Y 
Sbjct  53   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYPEIV-GQPECQYYL  111

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  112  KTGTCKFGATCKFHHP  127



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            + G+QG+  SYR+ ++ MG +ALQ++NVFPER  QPECQFYMKTGDCKFGA CKFH+P+E
Sbjct  238  SAGAQGIVSSYRSSSITMGQHALQKDNVFPERLDQPECQFYMKTGDCKFGAACKFHHPKE  297

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP----MGVFTYNISPSS  348
            RLI  P+ LLSP GLPLRPGEPLC FYSRYGICKFGP+CKFDHP    MG+F Y++S S+
Sbjct  298  RLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPNCKFDHPVVTSMGIFAYSLSTSA  357

Query  347  TTNAPTVRHFlgsssgtgtltlsSEG  270
            + + P VRH L SSS    LTLSSEG
Sbjct  358  SADIPIVRHLLASSSVPPALTLSSEG  383


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PE  GQPECQ+Y+KTG CKFGA CKFH+P+++      + L+ +G P+
Sbjct  48   LAIAAARLKGGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPI  107

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  108  RPNEEECAYYLRTGQCKFGNTCKFHHP  134


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+R G+P+C +Y++TG C++G  C++++P  R +    + L      +  G+P C +Y 
Sbjct  14   YPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLKGGYPEIV-GQPECQYYL  72

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  73   KTGTCKFGATCKFHHP  88



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 1/108 (1%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+  LQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+PRER++P PD +LSPIGLPLR
Sbjct  285  GFLPLQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLR  344

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            PGEPLC FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  345  PGEPLCIFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  391


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  89   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  148

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  149  RTGQCKFGNTCKFHHP  164


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 67/135 (50%), Gaps = 15/135 (11%)
 Frame = -2

Query  686  SQGMNPSYRAGTL---PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            S  + PS R   L    +G   +     +P RPG+P+C +Y++TG C+FGA C+F++P  
Sbjct  16   SSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPN  75

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFT  369
            R      +       P R G+P C +Y + G CKFG +CKF HP           + +  
Sbjct  76   R-ELAIATARMKGEFPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILG  134

Query  368  YNISPSSTTNAPTVR  324
            Y + PS T  A  +R
Sbjct  135  YPLRPSETECAYYLR  149



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 95/104 (91%), Gaps = 1/104 (1%)
 Frame = -2

Query  629  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEP  450
            LQRE VFPERPGQPECQFYMKTGDCKFGAVCKFH+PRER++P PD +LSPIGLPLRPGEP
Sbjct  255  LQRETVFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEP  314

Query  449  LCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            LC FYSRYGICKFGPSCKFDHPMGVFTYN+S SS+T  PTVR  
Sbjct  315  LCIFYSRYGICKFGPSCKFDHPMGVFTYNVS-SSSTEPPTVRRL  357


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  88   YPERMGQPECQYYLKTGTCKFGATCKFHHPREKAGIAGRVTLNALGYPLRPNEIECAYYL  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  148  RTGHCKFGSTCKFHHP  163


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +P R G+P+C +Y++TG C++GA C+F++P  R      +       P R G+P C +Y
Sbjct  42   TYPVREGEPDCSYYIRTGLCRYGATCRFNHPPNR-KLAIATARMRGEYPERMGQPECQYY  100

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  101  LKTGTCKFGATCKFHHP  117



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +   GM  SY+ G++P G YA+QRE +FP+RP QPECQFYMKTGDCKFGAVCKFH
Sbjct  274  SETQGMSDHGMISSYQHGSVPAGLYAVQREYIFPDRPDQPECQFYMKTGDCKFGAVCKFH  333

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ER+IP P   LSP+GLPLR GEP+C FYSRYGICKFGP+CKFDHPMG   Y ++ S 
Sbjct  334  HPKERIIPSPSCALSPLGLPLRSGEPICTFYSRYGICKFGPNCKFDHPMGTVMYGLATSP  393

Query  347  TTNAPTVRHF  318
            T   PT RH 
Sbjct  394  TGEVPTGRHM  403


 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  87   MAVAAARMKGEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPL  146

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  147  RPNEKECSYYLRTGQCKFGSTCKFNHP  173


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 57/98 (58%), Gaps = 4/98 (4%)
 Frame = -2

Query  668  SYRAGTLPMGYYAL---QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlippp  498
            S+R     M + +L       ++PER G+P+C +YM+TG C+FG  CKF++P +R     
Sbjct  31   SHRVDGEAMWHMSLGESMEAGLYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADR-KMAV  89

Query  497  dsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             +       P R G+P C +Y + G+CKFG +CKF HP
Sbjct  90   AAARMKGEYPQRIGQPECQYYLKTGMCKFGATCKFHHP  127



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 103/129 (80%), Gaps = 4/129 (3%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
             G QG  PSYR+  +P+G Y L RENVFPERP QPECQFYMKTGDCKFGA CKFH+PRER
Sbjct  282  AGVQGTIPSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRER  341

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPM----GVFTYNISPSST  345
            L+PPP+ LLSP+GLPLRPGEPLC FYSRYGICKFGP CKFDHPM    GV+ Y++  SS+
Sbjct  342  LLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSS  401

Query  344  TNAPTVRHF  318
             +A   R+ 
Sbjct  402  ADALVSRNL  410


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  FPER GQPECQ+Y++TG CKFGA CKFH+PR++        L+ +G P+
Sbjct  93   MAIAAARIKGGFPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPI  152

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G+CKFG +CKF HP
Sbjct  153  RLNETECAYYMRNGVCKFGSTCKFHHP  179


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C++++P  R      +     G P R G+P C +Y 
Sbjct  59   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNR-QMAIAAARIKGGFPERVGQPECQYYL  117

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  118  RTGTCKFGATCKFHHP  133



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 103/129 (80%), Gaps = 4/129 (3%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
             G QG  PSYR+  +P+G Y L RENVFPERP QPECQFYMKTGDCKFGA CKFH+PRER
Sbjct  284  AGVQGTIPSYRSSAIPLGQYVLARENVFPERPDQPECQFYMKTGDCKFGAACKFHHPRER  343

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPM----GVFTYNISPSST  345
            L+PPP+ LLSP+GLPLRPGEPLC FYSRYGICKFGP CKFDHPM    GV+ Y++  SS+
Sbjct  344  LLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPHCKFDHPMATPIGVYAYSLPTSSS  403

Query  344  TNAPTVRHF  318
             +A   R+ 
Sbjct  404  ADALVSRNL  412


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  FPER GQPECQ+Y++TG CKFGA CKFH+PR++        L+ +G P+
Sbjct  95   MAIAAARIKGGFPERVGQPECQYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPI  154

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G+CKFG +CKF HP
Sbjct  155  RLNETECAYYMRNGVCKFGSTCKFHHP  181


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C++++P  R      +     G P R G+P C +Y 
Sbjct  61   YPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNR-QMAIAAARIKGGFPERVGQPECQYYL  119

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  120  RTGTCKFGATCKFHHP  135



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  224  SETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFH  283

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + S 
Sbjct  284  HPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSP  343

Query  347  TTNAPTVRH  321
            T +  ++ +
Sbjct  344  TGDVSSMHY  352


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P+
Sbjct  97   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPM  156

Query  464  RPGEPLCAFYSRYGICKFGPSC  399
            RP E  CA+Y R G CKF  +C
Sbjct  157  RPNEKECAYYLRTGQCKFASTC  178


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  121

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E  + GS G    + +G+  +G YAL RENVFPERPGQPECQFYMKTGDCKFGAVCKFH
Sbjct  257  NEAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  316

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN--ISP  354
            +PR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN   + 
Sbjct  317  HPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNINNA  376

Query  353  SSTTNAPT-VRHF  318
            SS+ N  T  RH 
Sbjct  377  SSSMNQETPFRHL  389


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFG  CKFH+PR +        L+ +G P+
Sbjct  77   LAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPI  136

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  137  RPNEVECSYYLRTGHCKFGSTCKFNHP  163


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y
Sbjct  42   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-NLAIAAARMKGEYPERIGQPECQYY  100

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  101  LKTGTCKFGVTCKFHHP  117



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E  + GS G    + +G+  +G YAL RENVFPERPGQPECQFYMKTGDCKFGAVCKFH
Sbjct  246  NEAKDTGSPGSFSGFHSGSAQLGIYALPRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  305

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN--ISP  354
            +PR+R IPPPD +LSPIGLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN   + 
Sbjct  306  HPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNINNA  365

Query  353  SSTTNAPT-VRHF  318
            SS+ N  T  RH 
Sbjct  366  SSSMNQETPFRHL  378


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFG  CKFH+PR +        L+ +G P+
Sbjct  66   LAIAAARMKGEYPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPI  125

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  C++Y R G CKFG +CKF+HP
Sbjct  126  RPNEVECSYYLRTGHCKFGSTCKFNHP  152


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y
Sbjct  31   TYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-NLAIAAARMKGEYPERIGQPECQYY  89

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  90   LKTGTCKFGVTCKFHHP  106



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 2/128 (2%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E     S G  P +R+ ++PMG + LQRENVFPERP QPECQFYMKTGDCKFGA+CKFH
Sbjct  280  TETGGASSPGAFP-FRSSSVPMGLFPLQRENVFPERPDQPECQFYMKTGDCKFGAMCKFH  338

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +PRERL+P P+ +LSP+GLPLRPGEPLC FYSRYGICKFGP+CKFDHPMG F YN+S +S
Sbjct  339  HPRERLLPVPNCMLSPMGLPLRPGEPLCIFYSRYGICKFGPTCKFDHPMGPFAYNLS-TS  397

Query  347  TTNAPTVR  324
            + + P  R
Sbjct  398  SADVPVRR  405


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+PR++       LL+ +G PL
Sbjct  94   LAVAAARIKGGYPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPL  153

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKFG +CKF HP
Sbjct  154  RPNEKECAYYLRTGQCKFGSTCKFHHP  180


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+ +C +Y++TG C+FG  C+F++P  R      +     G P R G+P C +Y 
Sbjct  60   YPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNR-KLAVAAARIKGGYPERVGQPECQYYL  118

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  119  KTGTCKFGATCKFHHP  134



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  238  SETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFH  297

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + S 
Sbjct  298  HPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSP  357

Query  347  TTNAPTVRH  321
            T +  ++ +
Sbjct  358  TGDVSSLHY  366


 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P+
Sbjct  52   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPM  111

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  112  RPNEKECAYYLRTGQCKFASTCKFHHP  138


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  18   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  76

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  77   KTGTCKFGATCKFHHP  92



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE A +G  GM  SY+  ++P+G Y +Q EN+FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  277  SETAGMGDHGMFQSYQGSSVPIGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFH  336

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSS  348
            +P+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + S 
Sbjct  337  HPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATSP  396

Query  347  TTNAPTVRH  321
            T +  ++ +
Sbjct  397  TGDVSSLHY  405


 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P+
Sbjct  91   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPM  150

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  151  RPNEKECAYYLRTGQCKFASTCKFHHP  177


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  57   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  115

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  116  KTGTCKFGATCKFHHP  131



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FH+PRER++P PD +LSPIGLPLRPGEPLC
Sbjct  221  RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  280

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  281  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  321


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +G   +     +P RPG+P+C +Y++TG C+FGA C+F++P  R      +       P 
Sbjct  3    LGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNR-ELAIATARMKGEFPE  61

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  324
            R G+P C +Y + G CKFG +CKF HP           + +  Y + PS T  A  +R
Sbjct  62   RIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLR  119



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 95/102 (93%), Gaps = 1/102 (1%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            RENVFPERPGQPECQFYMKTGDCKFGAVC+FH+PRER++P PD +LSPIGLPLRPGEPLC
Sbjct  221  RENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLC  280

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
             FYSRYGICKFGPSCKFDHPMG+FTYN+S +S+ NAP V+H 
Sbjct  281  IFYSRYGICKFGPSCKFDHPMGIFTYNLSAASSANAP-VQHL  321


 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G PLRP E  CA+Y 
Sbjct  59   FPERIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYL  118

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  119  RTGQCKFGNTCKFHHP  134


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 61/118 (52%), Gaps = 12/118 (10%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +G   +     +P RPG+P+C +Y++TG C+FGA C+F++P  R      +       P 
Sbjct  3    LGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNR-ELAIATARMKGEFPE  61

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP-----------MGVFTYNISPSSTTNAPTVR  324
            R G+P C +Y + G CKFG +CKF HP           + +  Y + PS T  A  +R
Sbjct  62   RIGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLR  119



>dbj|BAG99488.1| unnamed protein product [Oryza sativa Japonica Group]
Length=237

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  98   ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  157

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  158  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---  214

Query  353  SSTTNAPTVRHF  318
            S++TN P VR  
Sbjct  215  SASTNVPMVRRL  226



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 8/129 (6%)
 Frame = -2

Query  689  GSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G ++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR
Sbjct  190  GSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  249

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI-----SP  354
            +R  PPPD +LS +GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN      SP
Sbjct  250  DRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSP  309

Query  353  SSTTNAPTV  327
            SS+ +  T 
Sbjct  310  SSSLHQETA  318


 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FY+KTG CKFG  CKFH+PR +        ++ +  PLRP E  C+++ 
Sbjct  63   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  122

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  123  RIGQCKFGGTCKFNHP  138


 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +       P R G+P C 
Sbjct  15   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  73

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  74   FYLKTGTCKFGVTCKFHHP  92



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 104/129 (81%), Gaps = 8/129 (6%)
 Frame = -2

Query  689  GSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G ++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR
Sbjct  211  GSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  270

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI-----SP  354
            +R  PPPD +LS +GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTYN      SP
Sbjct  271  DRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSP  330

Query  353  SSTTNAPTV  327
            SS+ +  T 
Sbjct  331  SSSLHQETA  339


 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FY+KTG CKFG  CKFH+PR +        ++ +  PLRP E  C+++ 
Sbjct  84   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  143

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  144  RIGQCKFGGTCKFNHP  159


 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +       P R G+P C 
Sbjct  36   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  94

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  95   FYLKTGTCKFGVTCKFHHP  113



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G  GM  SY+ G++P+G Y +Q EN+FPERP QPECQFYMKTGDCKFGAVCKFH
Sbjct  283  SETGGMGDHGMYQSYQGGSVPVGVYTVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFH  342

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  351
            +P+ERL+P P+  L+ +GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y  + S
Sbjct  343  HPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPNCKFDHPMGTLMYGSATS  401


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A +    +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G P+
Sbjct  97   LAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPM  156

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y R G CKF  +CKF HP
Sbjct  157  RPNEKECAYYLRTGQCKFASTCKFHHP  183


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +YM+TG C+FG  CKF++P  R      +       P R G+P C +Y 
Sbjct  63   YPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNR-KLAVAAARMNGEYPYRVGQPECQYYL  121

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  122  KTGTCKFGATCKFHHP  137



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  692  VGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            +G +GM  SY+AG++P+G YA+Q ENVFPERP QPECQFYMKTGDCKFG+VCKFH+PRER
Sbjct  277  IGDRGMFSSYQAGSVPVGLYAVQTENVFPERPDQPECQFYMKTGDCKFGSVCKFHHPRER  336

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  333
            +IP P+  LSP+GLPLRPGEP+C+FY+RYG+CKFGP+CKF HPMG   Y  + S T+ A 
Sbjct  337  IIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPNCKFHHPMGNPMYGHASSPTSEAQ  396

Query  332  TVRHF  318
            T R  
Sbjct  397  TSRRM  401


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P+R GQPECQ+Y+KTG CKFGA CKFH+PRE+        L+ +G PL
Sbjct  85   LAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPL  144

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R  E  CA+Y R G CKFG +CKF HP
Sbjct  145  RLNEKECAYYLRTGQCKFGSTCKFHHP  171


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G P+C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  51   YPERVGDPDCSYYMRTGMCRFGMTCKFNHPADR-KLAVAAARMKGEYPQRIGQPECQYYL  109

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  110  KTGTCKFGATCKFHHP  125



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   154 bits (388),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 94/118 (80%), Gaps = 5/118 (4%)
 Frame = -2

Query  665  YRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsll  486
            +   ++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD  L
Sbjct  191  HSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPAPDCAL  250

Query  485  spiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI-----SPSSTTNAPTV  327
            S +GLPLR GEPLC FYSRYGICKFGPSCKFDHPM VFTYN      SPSS+ +  T 
Sbjct  251  SSVGLPLRQGEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNDASPSPSSSLHQETA  308


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FY+KTG CKFG  CKFH+PR +        ++ +G PLRP E  C+++ 
Sbjct  52   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVLGYPLRPNEDDCSYFL  111

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF+HP 
Sbjct  112  RTGHCKFGGTCKFNHPQ  128


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG  C+F++P +R      +       P R G+P C 
Sbjct  4    DGSYPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  62

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  63   FYLKTGTCKFGVTCKFHHP  81



>ref|XP_008389043.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=195

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = -2

Query  635  YALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPG  456
            YALQRENVFPERPGQPECQFYMKTGDCKFGAVC+FH+P ERLIP PD +LSPIGLPLRPG
Sbjct  43   YALQRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPG  102

Query  455  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            EP+C FYSRYGICKFGPSCKF+HPMG+FTY +
Sbjct  103  EPMCIFYSRYGICKFGPSCKFBHPMGIFTYGL  134



>dbj|BAD87736.1| putative zinc finger protein [Oryza sativa Japonica Group]
Length=322

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  183  ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  242

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  243  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---  299

Query  353  SSTTNAPTVRHF  318
            S++TN P VR  
Sbjct  300  SASTNVPMVRRL  311


 Score = 87.0 bits (214),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  5    YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  64

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF HP
Sbjct  65   KTGQCKYGNTCKFHHP  80



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = -2

Query  704  EVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHY  525
            E   +G  GM  S++AG+ P+G YA+Q EN FPERP QPECQFYMKTGDCKFGAVCKF++
Sbjct  272  ETTGMGEHGMFTSHKAGSAPLGVYAVQGENTFPERPEQPECQFYMKTGDCKFGAVCKFNH  331

Query  524  PRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            P++R++P P+  LSP+GLPLRPGEP+C FYSRYGICKFGP+CKFDHPMG   Y    S T
Sbjct  332  PKKRMVPAPNCALSPLGLPLRPGEPICTFYSRYGICKFGPNCKFDHPMGTILYGSPTSPT  391

Query  344  TNAPTVRH  321
             + P + +
Sbjct  392  GDVPPLHY  399


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            +   A + +  +P R GQPECQ+Y+KTG CKFGA CKFH+PRE+      + L+ +G PL
Sbjct  85   LAVAAARMKGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPL  144

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP------MGVFTYNISPSSTTNAP  333
            R  E  C +Y R G CKF  +CKF HP      + + +   SP  +T +P
Sbjct  145  RLNEKECVYYLRTGQCKFASTCKFHHPQPSSTMVAIRSSICSPGQSTTSP  194


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+ +C +YM+TG C+FG  CKF++P +R      +       P R G+P C +Y 
Sbjct  51   YPERIGERDCSYYMRTGFCRFGVTCKFNHPADR-KLAVAAARMKGEYPYRVGQPECQYYL  109

Query  431  RYGICKFGPSCKFDHPMGVFTYNIS  357
            + G CKFG +CKF HP       IS
Sbjct  110  KTGTCKFGATCKFHHPREKAAIAIS  134



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 101/131 (77%), Gaps = 4/131 (3%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM  SYR+ + P   YALQRENVFPERP QPEC +Y+KTGDCKFGAVCKFH+PR
Sbjct  265  ASAGNQGMQSSYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPR  324

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPS  351
             R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y  S S
Sbjct  325  VRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSAS  384

Query  350  STTNAPTVRHF  318
            ++ NAP  R  
Sbjct  385  ASPNAPMARRL  395


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  86   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  145

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF+HP
Sbjct  146  KTGQCKYGNTCKFNHP  161


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +P RPG+P+C +Y++TG C+FG  C+F++P++R      S       
Sbjct  28   MAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NTAIASARMKGEY  86

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  87   PERVGQPECQYYLKTGTCKFGPTCKFHHP  115



>gb|AFW84181.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=375

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 10/137 (7%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  228  ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  287

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  S 
Sbjct  288  VRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSG  347

Query  353  S-----STTNAPTVRHF  318
            S     ++TNAP  RH 
Sbjct  348  SASVAPASTNAPMTRHL  364


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREK  143



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  241  ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  300

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  301  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---  357

Query  353  SSTTNAPTVRHF  318
            S++TN P VR  
Sbjct  358  SASTNVPMVRRL  369


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FG  C+F++P++R      S       P R G+P C +Y 
Sbjct  18   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  76

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = -2

Query  686  SQGMNPSYRAGT-LPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            SQG    Y AG+ +P+G +YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R
Sbjct  242  SQGSYSGYNAGSSVPVGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDR  301

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
              P PD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  302  QAPSPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTGSET  357


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLRP E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRPNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            R G CKFG +CKF+HP    T  + P+S   +
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTSAQQS  173


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  37   YPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 10/137 (7%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  230  ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  289

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  S 
Sbjct  290  VRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSG  349

Query  353  S-----STTNAPTVRHF  318
            S     ++TNAP  RH 
Sbjct  350  SASVAPASTNAPMTRHL  366


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PL P E  CA+Y 
Sbjct  61   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  120

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  121  KTGQCKYANTCKFHHPE---LFNVVPSS  145


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  3    MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  61

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  62   PERVGQPECQYYLKTGTCKFGPTCKFHHP  90



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  301  ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  360

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  361  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---  417

Query  353  SSTTNAPTVRHF  318
            S++TN P VR  
Sbjct  418  SASTNVPMVRRL  429


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FG  C+F++P++R      S       P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  135

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 102/132 (77%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  300  ASAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  359

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  360  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPTMAPPMGVYAYG---  416

Query  353  SSTTNAPTVRHF  318
            S++TN P VR  
Sbjct  417  SASTNVPMVRRL  428


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  122  YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  181

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF HP
Sbjct  182  KTGQCKYGNTCKFHHP  197


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P+C +Y++TG C+FG  C+F++P++R      S       P R G+P C +Y 
Sbjct  77   YPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NLAIASARMKGEYPERMGQPECQYYL  135

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>ref|XP_006296584.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
 gb|EOA29482.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
Length=329

 Score =   150 bits (380),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 95/113 (84%), Gaps = 4/113 (4%)
 Frame = -2

Query  680  GMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlip  504
            G NP     ++P+G +YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P
Sbjct  179  GFNP---GSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  235

Query  503  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PPD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S +
Sbjct  236  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASES  288


 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  11   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  70

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  71   RTGHCKFGGTCKFNHPQPQPTNMMVPTS  98



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  241  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  300

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  301  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  339


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  122  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  149


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  17   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  76   KTGTCKFGVTCKFHHP  91



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  359


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 10/137 (7%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  280  ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  S 
Sbjct  340  VRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSG  399

Query  353  S-----STTNAPTVRHF  318
            S     ++TNAP  RH 
Sbjct  400  SASVAPASTNAPMTRHL  416


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PL P E  CA+Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  171  KTGQCKYANTCKFHHPE---LFNVVPSS  195


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYDNTASET  359


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G PEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGHPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+ ++PR+R      +       P R G P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDR-ELVIATARMRGEYPERIGHPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 100/130 (77%), Gaps = 4/130 (3%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
              G QGM  SYR+G +P+G Y L R+NVFP RPGQPEC+FY+KTGDCK+GA CKFH+PRE
Sbjct  282  TTGVQGMIHSYRSGAIPLGQYVLARDNVFPVRPGQPECEFYLKTGDCKYGAACKFHHPRE  341

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPSS  348
            RLIP PD +LSP+GLPLRP EP+C FYSRYGICKFG  CKFDH    PMG++ Y+++ SS
Sbjct  342  RLIPIPDCVLSPLGLPLRPEEPICIFYSRYGICKFGTHCKFDHPMAAPMGIYAYSLATSS  401

Query  347  TTNAPTVRHF  318
              +    R+ 
Sbjct  402  LADVAVARNL  411


 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M   A + +  +PER GQPEC+FY++TG CKFGA CKFH+PR++        L+ +G PL
Sbjct  93   MAIAAARIKGGYPERVGQPECEFYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNVLGYPL  152

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            RP E  CA+Y + G CKFG +CKF HP
Sbjct  153  RPDEAECAYYMKNGECKFGNTCKFHHP  179


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPERP +P+C +Y++TG C+FG  C++++P  R      +     G P R G+P C FY 
Sbjct  59   FPERPREPDCTYYLRTGLCRFGITCRYNHPPNR-QMAIAAARIKGGYPERVGQPECEFYL  117

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  118  RTGTCKFGATCKFHHP  133



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            GYYAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  261  GYYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y  + S T  A
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYENTASETDEA  362


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 100/131 (76%), Gaps = 4/131 (3%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P   YALQRENVFPERP QPEC +Y+KTGDCKFGAVCKFH+PR
Sbjct  294  ASAGNQGMQSPYRSSSFPAPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPR  353

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPS  351
             R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y  S S
Sbjct  354  VRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSAS  413

Query  350  STTNAPTVRHF  318
            ++ NAP  R  
Sbjct  414  ASPNAPMARRL  424


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  115  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYL  174

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF+HP
Sbjct  175  KTGQCKYGNTCKFNHP  190


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +P RPG+P+C +Y++TG C+FG  C+F++P++R      S       
Sbjct  57   MAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NTAIASARMKGEY  115

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERVGQPECQYYLKTGTCKFGPTCKFHHP  144



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 102/129 (79%), Gaps = 4/129 (3%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR  + P+  YALQRENVFPERP QPEC +Y+KTGDCKFGAVCKFH+PR
Sbjct  301  ASSGNQGMLSPYRPSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPR  360

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPS  351
             R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y  S S
Sbjct  361  VRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGINCKFDHPMASPMGVYAYGFSAS  420

Query  350  STTNAPTVR  324
            ++TNAP  R
Sbjct  421  ASTNAPMAR  429


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLR  E  CA+Y 
Sbjct  122  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNEKECAYYL  181

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF+HP
Sbjct  182  KTGQCKYGNTCKFNHP  197


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       P R G+P C +Y 
Sbjct  77   YPERPGEPDCTYYLRTGLCRFGISCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYL  135

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  136  KTGTCKFGPTCKFHHP  151



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 100/131 (76%), Gaps = 4/131 (3%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
             + G+QGM   YR+ + P+  YALQRENVFPERP QPEC +Y+KTGDCKFGAVCKFH+PR
Sbjct  242  GSAGNQGMQSPYRSSSFPVPQYALQRENVFPERPDQPECIYYIKTGDCKFGAVCKFHHPR  301

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNISPS  351
             R  PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y  S S
Sbjct  302  VRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNCKFDHPMAAPMGVYAYGYSAS  361

Query  350  STTNAPTVRHF  318
            ++ NAP  R  
Sbjct  362  ASPNAPMARRL  372


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAYYL  122

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF+HP
Sbjct  123  KTGQCKYGNTCKFNHP  138


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P RPG+P+C +Y++TG C+FG  C+F++P++R      S       P R G+P C +Y 
Sbjct  18   YPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDR-NTAIASARMKGEYPERVGQPECQYYL  76

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 88/101 (87%), Gaps = 1/101 (1%)
 Frame = -2

Query  665  YRAGTLPMGYYA-LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsl  489
            +   ++P+GYYA L RE++FPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD +
Sbjct  254  HSGNSVPLGYYASLAREDLFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAPDCV  313

Query  488  lspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  366
            LSP+ LPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY
Sbjct  314  LSPVDLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTY  354


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER  QP+CQFY+KTG CKFG  CKFH+PR          ++ +G PLRP E  C+++ 
Sbjct  77   YPERIDQPDCQFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNALGYPLRPEEDDCSYFL  136

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG +CKF+HP 
Sbjct  137  RTGHCKFGGTCKFNHPQ  153


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 58/93 (62%), Gaps = 3/93 (3%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
            ++PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R  +P C FY
Sbjct  31   LYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-KLVIATARIRGEYPERIDQPDCQFY  89

Query  434  SRYGICKFGPSCKFDHPMGVFTYNISPSSTTNA  336
             + G CKFG +CKF HP      +I+ S + NA
Sbjct  90   LKTGTCKFGVTCKFHHPRN--NADIAGSVSVNA  120



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = -2

Query  680  GMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlip  504
            G NP     ++P+G +YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P
Sbjct  249  GFNP---GSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  305

Query  503  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PPD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  306  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  358


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 94/113 (83%), Gaps = 4/113 (4%)
 Frame = -2

Query  680  GMNPSYRAGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlip  504
            G NP     ++P+G +YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P
Sbjct  251  GFNP---GSSVPLGGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAP  307

Query  503  ppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PPD LLS IGLPLRPGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  308  PPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  360


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 100/132 (76%), Gaps = 8/132 (6%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P   YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  242  ASAGNQGMLSPYRSSSYPGPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPR  301

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R +P PD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y    
Sbjct  302  VRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCKFDHPSMAPPMGVYAYG---  358

Query  353  SSTTNAPTVRHF  318
            S++ N P VR  
Sbjct  359  SASANVPMVRRL  370


 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  63   YPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYL  122

Query  431  RYGICKFGPSCKFDHP  384
            + G CK+G +CKF HP
Sbjct  123  KTGQCKYGNTCKFHHP  138


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP +P+C +Y++TG C+FG  C+F++P +R      S       P R G+P C +Y 
Sbjct  18   YPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERMGQPECQYYL  76

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFGP+CKF HP
Sbjct  77   KTGTCKFGPTCKFHHP  92



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 97/129 (75%), Gaps = 15/129 (12%)
 Frame = -2

Query  689  GSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G ++P+G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR
Sbjct  211  GSQGGLFSSGFHSGNSVPLGFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPR  270

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI-----SP  354
            +R  PPPD +LS        GEPLC FYSRYGICKFGPSCKFDHPM VFTYN      SP
Sbjct  271  DRQTPPPDCVLSS-------GEPLCVFYSRYGICKFGPSCKFDHPMRVFTYNNNTASPSP  323

Query  353  SSTTNAPTV  327
            SS+ +  T 
Sbjct  324  SSSLHQETA  332


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FY+KTG CKFG  CKFH+PR +        ++ +  PLRP E  C+++ 
Sbjct  84   YPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFL  143

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  144  RIGQCKFGGTCKFNHP  159


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +       P R G+P C 
Sbjct  36   DGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR-KLVIATARIKGEYPERIGQPECE  94

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  95   FYLKTGTCKFGVTCKFHHP  113



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 10/137 (7%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQR+NVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  280  ASAGNQGMLSPYRSSSFPVPQYALQRDNVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH-----PMGVFTYNISP  354
             R  PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH     PMGV+ Y  S 
Sbjct  340  VRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPTMAAPMGVYAYGFSG  399

Query  353  S-----STTNAPTVRHF  318
            S     ++T AP  RH 
Sbjct  400  SASVAPASTXAPMTRHL  416


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PL P E  CA+Y 
Sbjct  111  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYL  170

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  171  KTGQCKYANTCKFHHPE---LFNVVPSS  195


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  53   MAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  111

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  112  PERVGQPECQYYLKTGTCKFGPTCKFHHP  140



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R +PPPD LLSPIGLPLR
Sbjct  258  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  317

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  318  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  356


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+    TG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECE----TGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  137

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  138  RTGHCKFGGTCKFNHPQPQPTTNM  161


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 5/76 (7%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C ++++TG C+FG+ C+F++PR+R      +       P R G+P C    
Sbjct  37   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPEC----  91

Query  431  RYGICKFGPSCKFDHP  384
              G CKFG SCKF HP
Sbjct  92   ETGTCKFGVSCKFHHP  107



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = -2

Query  665  YRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsll  486
            +   ++P GYYAL RENVFPERPGQPEC+FYMKTGDCKFG VCKFH+PR+R  P PD LL
Sbjct  240  HSGNSVPFGYYALPRENVFPERPGQPECEFYMKTGDCKFGTVCKFHHPRDRQTPAPDCLL  299

Query  485  spiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  366
            SP+GLPLR GEPLC FYSRYGICKFGPSCKFDHPM +FTY
Sbjct  300  SPVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMRIFTY  339


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPEC+FY+KTG CKFG  CKFH+PR +         S +G PLRP E  C+++ 
Sbjct  64   FPERIGQPECEFYLKTGTCKFGVTCKFHHPRNK---AGRVSHSVLGYPLRPNEDDCSYFL  120

Query  431  RYGICKFGPSCKFDHPMGVFT  369
            R G CKFG +CKF+HP    T
Sbjct  121  RTGHCKFGGTCKFNHPQSQST  141


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PERPG+P+C +Y++TG C+FG+ C+F++P +R      +       P R G+P C 
Sbjct  16   DGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATERIKGEFPERIGQPECE  74

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  75   FYLKTGTCKFGVTCKFHHP  93



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R +PPPD LLSPIGLPLR
Sbjct  262  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  321

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  322  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  360


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTTNM  165


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C ++++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG SCKF HP
Sbjct  96   KTGTCKFGVSCKFHHP  111



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R +PPPD LLSPIGLPLR
Sbjct  242  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLR  301

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VFTY  + S T
Sbjct  302  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFTYENTASET  340


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  62   YPERIGQPECEYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  121

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  122  RTGHCKFGGTCKFNHPQPQPTTNM  145


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C ++++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  17   YPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  75

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG SCKF HP
Sbjct  76   KTGTCKFGVSCKFHHP  91



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  262  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  321

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  322  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  360


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  261  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  320

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  321  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  359


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS IGLPLR
Sbjct  263  GFYALPRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLR  322

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FY+RYGICKFGPSCKFDHPM VF Y+ + S T
Sbjct  323  PGEPLCVFYTRYGICKFGPSCKFDHPMRVFAYDNTASET  361


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFI  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            R G CKFG +CKF+HP    T  + P+S
Sbjct  142  RTGHCKFGGTCKFNHPQPQPTNMMVPTS  169


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + +G         +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       
Sbjct  24   MNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEY  82

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFG +CKF HP
Sbjct  83   PERIGQPECEYYLKTGTCKFGVTCKFHHP  111



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 3/111 (3%)
 Frame = -2

Query  689  GSQG--MNPSYRAG-TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G ++P+G YAL  ENVFPERPGQ EC+FYMKTGDCKFG VCKFH+PR
Sbjct  253  GSQGGVFSSGFHSGNSVPLGQYALPSENVFPERPGQLECEFYMKTGDCKFGTVCKFHHPR  312

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTY  366
             R  P PD +LS +GLPLRPGEPLC FYSRYGICKFGPSCKFDHPM VFTY
Sbjct  313  NRQTPAPDCVLSTVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHPMRVFTY  363


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FY+KTG CKFG  CKFH+PR +        ++ +G PLRP E  C+++ 
Sbjct  87   YPERIGQPECEFYIKTGTCKFGVTCKFHHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFL  146

Query  431  RYGICKFGPSCKFDHPM  381
            R G CKFG SCKF+HP 
Sbjct  147  RTGHCKFGGSCKFNHPQ  163


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            + ++PERPG+P+C +Y++TG C+FG+ C+F++P +R      +  +    P R G+P C 
Sbjct  39   DGLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPYDR-KLVIATARTKGEYPERIGQPECE  97

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  98   FYIKTGTCKFGVTCKFHHP  116



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 101/135 (75%), Gaps = 9/135 (7%)
 Frame = -2

Query  695  NVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            + G+QGM   YR+ + P+  YALQRENVFPERP QPECQ+YMKTGDCKFGAVCKFH+PR 
Sbjct  280  SAGNQGMLSPYRSSSFPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRV  339

Query  515  RlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH----PMGVFTYNI----  360
            R +PPPD +LSP+GLP+RPGE LC FYSRYGICKFG +CKFDH    PMGV+ Y      
Sbjct  340  RSLPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGANCKFDHPMTAPMGVYAYGFSASA  399

Query  359  -SPSSTTNAPTVRHF  318
               S++TN P  R  
Sbjct  400  SPASASTNVPMARRL  414


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+ +G PLRP E  CA+Y 
Sbjct  110  YPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYL  169

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N  PSS
Sbjct  170  KTGQCKYANTCKFHHPE---LFNAVPSS  194


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  52   MAMNSGATMQPGPYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  110

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  111  PERVGQPECQYYLKTGTCKFGPTCKFHHP  139



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = -2

Query  707  SEVANVGS--QGMNPSYRAGT-LPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAV  540
            SE+   GS  QG       G+ +P+G +YAL  E+VFPERPGQPECQFYMKTGDCKFG V
Sbjct  240  SEIKESGSHSQGSFSGLNTGSSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTV  299

Query  539  CKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNI  360
            CKFH+PR+R  PPPD LLS IGLPLRPGEPLC FYSRYGICKFGPSCKF HPM VF Y+ 
Sbjct  300  CKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDN  359

Query  359  SPSST  345
            + S T
Sbjct  360  TASET  364


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C +Y++TG C+FG+ C+F++P +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLSPIGLPLR
Sbjct  230  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  289

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FYSRY ICKFGPSCKF HPMGVFTY+ + S T
Sbjct  290  PGEPLCVFYSRYRICKFGPSCKFHHPMGVFTYDNTASET  328


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  68   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  127

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  128  RTGHCKFGATCKFNHPQPQPTTNL  151


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  23   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  81

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  82   KTGTCKFGVTCKFHHP  97



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = -2

Query  659  AGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            A ++P+G ++AL  E+VFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS
Sbjct  254  ASSVPLGGFFALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLS  313

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PIGLPLRPGEPLC FYSRYGICKFGPSCKF HPM VF Y+ + S T
Sbjct  314  PIGLPLRPGEPLCVFYSRYGICKFGPSCKFHHPMEVFAYDNTASET  359


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C +Y++TG C+FG+ C+F++P +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 2/105 (2%)
 Frame = -2

Query  629  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppds-llspiglpLRPGE  453
            LQREN+FP+RPGQPECQFYMKTGDCKFGAVC+FH+P +RLIP P   LLS +GLPLR GE
Sbjct  234  LQRENIFPDRPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGE  293

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            PLC FYSRYGICKFGPSCKFDHPMG+F+YN+S S   ++ T RH 
Sbjct  294  PLCVFYSRYGICKFGPSCKFDHPMGIFSYNLSASPLADS-TGRHL  337


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQPECQFY+KTG CKFGA CKFH+PR++        L+ +G PLRP E  C++Y 
Sbjct  82   FPERIGQPECQFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAECSYYL  141

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  142  RTGECKFGNTCKFHHP  157


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P RPG+P+C +Y++TG C+FGA C+F++P         +       P R G+P C FY 
Sbjct  37   YPHRPGEPDCSYYIRTGLCRFGATCRFNHP-PNANLAIVTARMIGEFPERIGQPECQFYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGATCKFHHP  111



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G+YAL RENVFPE+PGQPECQFYMKTGDCKFG+VCKFH+PR R  P PD +LSPIGLPLR
Sbjct  264  GFYALPRENVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPLR  323

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FYSRYGICKFGPSCKFDHPM     +++P  T
Sbjct  324  PGEPLCGFYSRYGICKFGPSCKFDHPMQRVFTSMNPEET  362


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PR ++    +  L+ +G P+RP E  CA+Y 
Sbjct  87   YPERIGQPECQYYLKTGTCKFGVTCKFHHPRNKVGIAGNVSLNALGYPIRPNEVDCAYYL  146

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  147  RTGHCKFGSTCKFNHP  162


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
 Frame = -2

Query  614  VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFY  435
             +P+RPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y
Sbjct  41   AYPDRPGEPDCAYYIRTGLCRFGSTCRFNHPRDR-NLAIATARMKGEYPERIGQPECQYY  99

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  100  LKTGTCKFGVTCKFHHP  116



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G YAL  E+VFPERPGQPECQFY+KTGDCKFG VCKFH+PR+R  PPPD LLSPIGLPLR
Sbjct  236  GIYALPSESVFPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  295

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEP C FYSRYGICKFGPSCKF HPMGVFTY+ + S T
Sbjct  296  PGEPSCVFYSRYGICKFGPSCKFHHPMGVFTYDNTASET  334


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  75   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLR-NEVDCAYFL  133

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  134  RTGHCKFGATCKFNHPQPQPTTNL  157


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  30   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  88

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  89   KTGTCKFGVTCKFHHP  104



>gb|ACF80171.1| unknown [Zea mays]
 tpg|DAA56153.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=320

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  174  ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  233

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  375
             R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  234  VRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  281


 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+  G PLRP E  CA+Y 
Sbjct  5    YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  64

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  65   KTGHCKYANTCKFHHPE---LFNVVPSS  89



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = -2

Query  659  AGTLPMG-YYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            A ++P+G +YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLS
Sbjct  256  ASSVPLGGFYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLS  315

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PIGLPLRPGEPLC FYSRY ICKFGPSCKF HPM VF Y+ + S T
Sbjct  316  PIGLPLRPGEPLCVFYSRYRICKFGPSCKFHHPMEVFAYDNTASET  361


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  142  RTGHCKFGATCKFNHP  157


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P C +Y++TG C+FG+ C+F++P +R      +       P R G+P C +Y 
Sbjct  37   YPERPGEPNCSYYIRTGLCRFGSTCRFNHPPDR-ELVIATARMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR+ + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  284  ASTGNQGMLSPYRSSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  343

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  375
             R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  344  VRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  57   MAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  115

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  284  ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  343

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  375
             R +PPPD +LSP+GLPLRPGE LC FYSRYGICKFG +CKFDHP  V
Sbjct  344  VRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGANCKFDHPTVV  391


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  57   MAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  115

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLSPIGLPLR
Sbjct  244  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  303

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FYSRY ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  304  PGEPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASET  342


 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGATCKFNHPQPQPTTNL  165


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR--ELVIATAMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = -2

Query  641  GYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLR  462
            G YAL  E+VFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  PPPD LLSPIGLPLR
Sbjct  242  GIYALPSESVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLR  301

Query  461  PGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            PGEPLC FYSRY ICKFGPSCKF  PMGVFTY+ + S T
Sbjct  302  PGEPLCVFYSRYRICKFGPSCKFHPPMGVFTYDNTASET  340


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  82   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFL  141

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  142  RTGHCKFGATCKFNHPQPQPTTNL  165


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR--ELVIATAMRGEYPERIGQPECEYYL  95

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  96   KTGTCKFGVTCKFHHP  111



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  440  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            FYSRYGICKFGPSCKF+HPM VF Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEVFAYDNTASET  336


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 88/112 (79%), Gaps = 9/112 (8%)
 Frame = -2

Query  689  GSQG--MNPSYRAGT-LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G+ +P+G YA      FPERPGQ ECQFYMKTGDCKFG VCKFH+PR
Sbjct  260  GSQGGLFSSEFHSGSYVPLGLYA------FPERPGQLECQFYMKTGDCKFGTVCKFHHPR  313

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN  363
            +R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPSCKFDHPMGV TYN
Sbjct  314  DRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVLTYN  365


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FYMKTG CKFG  CKFH+P  +        ++ +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFL  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      + ++    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATAMTKGEYPERIGQPECE  98

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  440  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  336


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  245  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  304

Query  440  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  305  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  336


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ENVFPERPGQPECQFYMKTGDCKFG VCKFH+PR+R  P PD LLSPIGLPLRPGEP+C 
Sbjct  243  ENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCV  302

Query  440  FYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
            FYSRYGICKFGPSCKF+HPM +F Y+ + S T
Sbjct  303  FYSRYGICKFGPSCKFNHPMEIFAYDNTASET  334


 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC++Y+KTG CKFG  CKFH+PR +        L+ +G PLR  E  CA++ 
Sbjct  83   YPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFL  142

Query  431  RYGICKFGPSCKFDHPMGVFTYNI  360
            R G CKFG +CKF+HP    T N+
Sbjct  143  RTGHCKFGATCKFNHPQPQPTTNL  166


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FG+ C+F++PR+R      +       P R G+P C +Y 
Sbjct  38   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDR-ELVIATARMRGEYPERIGQPECEYYL  96

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  97   KTGTCKFGVTCKFHHP  112



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 88/112 (79%), Gaps = 9/112 (8%)
 Frame = -2

Query  689  GSQG--MNPSYRAGT-LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            GSQG   +  + +G+ +P+  YA      FPERPGQ ECQFYMKTGDCKFG VCKFH+PR
Sbjct  257  GSQGGLFSSEFHSGSSVPLCLYA------FPERPGQLECQFYMKTGDCKFGTVCKFHHPR  310

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN  363
            +R  P PD +LS +GLPLR GEPLC FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  311  DRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  362


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FYMKTG CKFG  CKFH+PR                PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNN---AGTDDGRVSVYPLRPNEDDCSYFL  144

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  145  RTGHCKFGGTCKFNHP  160


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARAKGEYPERIGQPECE  98

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_008672228.1| PREDICTED: uncharacterized protein LOC100194377 isoform X1 [Zea 
mays]
Length=410

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 73/108 (68%), Gaps = 20/108 (19%)
 Frame = -2

Query  698  ANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            A+ G+QGM   YR  + P+  YALQRENVFPERP +PECQ+YMKTGDCKFGAVCKFH+PR
Sbjct  284  ASTGNQGMLSPYRPSSFPVPQYALQRENVFPERPDEPECQYYMKTGDCKFGAVCKFHHPR  343

Query  518  ERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGV  375
                                GE LC FYSRYGICKFG +CKFDHP  V
Sbjct  344  --------------------GEELCKFYSRYGICKFGANCKFDHPTVV  371


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 3/88 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFG  CKFH+PRE+        L+  G PLRP E  CA+Y 
Sbjct  115  YPERAGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYL  174

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPSS  348
            + G CK+  +CKF HP     +N+ PSS
Sbjct  175  KTGHCKYANTCKFHHPE---LFNVVPSS  199


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 54/89 (61%), Gaps = 1/89 (1%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            + M   A  +   +PERPG+P+C +Y++TG C+FG  C+F++P +R      S       
Sbjct  57   MAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEY  115

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            P R G+P C +Y + G CKFGP+CKF HP
Sbjct  116  PERAGQPECQYYLKTGTCKFGPTCKFHHP  144



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPGQPECQ+Y+KTGDCKFGA CK+H+P E   P  + +LSP+GLPLRPG PL
Sbjct  309  QKEHPFPERPGQPECQYYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGAPL  368

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C+ Y++ G+CKFGPSCKFDHPM + +Y+ S SS T+ P  
Sbjct  369  CSHYAQNGVCKFGPSCKFDHPMRILSYSPSASSLTDMPVA  408


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P+  +       L+  G PLRPGE  C++Y 
Sbjct  102  YPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRPGEKECSYYV  161

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  162  KTGQCKFGVTCKFHHP  177


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP +P+C +Y++TG C +G  C+F++PR+R +            P R G+P+C +Y 
Sbjct  56   YPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALRAGGGEYPERAGQPVCQYYM  115

Query  431  RYGICKFGPSCKFDHP  384
            R G+CKFG SCK+ HP
Sbjct  116  RTGMCKFGASCKYHHP  131


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +Y+KTG CKFG  CKFH+P+
Sbjct  148  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQ  178



>gb|EYU22370.1| hypothetical protein MIMGU_mgv1a005385mg [Erythranthe guttata]
Length=485

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPGQPECQ+Y++TGDCKFGA CK+H+P E  +P  + +LS +GLPLRPG PL
Sbjct  302  QKEHAFPERPGQPECQYYLRTGDCKFGATCKYHHPSEWSVPRGNFVLSAMGLPLRPGAPL  361

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C+ Y++ G+CKFGPSCKFDHPM   +Y+ S SS T+ P  
Sbjct  362  CSHYAQNGMCKFGPSCKFDHPMKTLSYSPSASSLTDMPVA  401


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFG  CK+ +P+  L     + L+  G PLRPGE  C++Y+
Sbjct  92   YPERVGQPICQYYMRTGMCKFGTSCKYDHPKHGLGSSAPAGLNFYGYPLRPGEKECSYYA  151

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CK+ HP
Sbjct  152  KTGQCKFGVTCKYHHP  167


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP +P+  +Y++ G C++G  C+F++PR R +            P R G+P+C +Y 
Sbjct  46   YPERPDEPDRMYYLRIGFCRYGNRCRFNHPRVRSMVMGALRAGGGEYPERVGQPICQYYM  105

Query  431  RYGICKFGPSCKFDHP  384
            R G+CKFG SCK+DHP
Sbjct  106  RTGMCKFGTSCKYDHP  121



>ref|XP_007222805.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
 gb|EMJ24004.1| hypothetical protein PRUPE_ppa005056mg [Prunus persica]
Length=479

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E++FPERPGQPECQ+YM+TGDCKFG+ C++H+P E + P     LSP GLP RPG PL
Sbjct  293  QKEHLFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVGPKTTVALSPSGLPSRPGAPL  352

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y++ G+CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  353  CTHYAQRGVCKFGPACKFDHPMGTLSYSPSASSLADMPVA  392


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLR GE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSGSPVSLNYYGYPLRQGERECSYYV  148

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  149  KTGQCKFGATCKFHHPQ  165


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PERP + +C +Y++TG C +G+ C++++PR+R      +    +  P 
Sbjct  32   MWQLGLGPGESYPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGAARPGGLEYPE  91

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RAGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_008223126.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Prunus 
mume]
Length=479

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E++FPERPGQPECQ+YM+TGDCKFG+ C++H+P E + P     L+P GLP RPG PL
Sbjct  293  QKEHLFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVGPKTTVALNPSGLPSRPGAPL  352

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y++ G+CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  353  CTHYAQRGVCKFGPACKFDHPMGTLSYSPSASSLADMPVA  392


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLR GE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSSSPVSLNYYGYPLRQGERECSYYV  148

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  149  KTGQCKFGATCKFHHPQ  165


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PERP + +C +Y++TG C +G+ C++++PR+R      +    +  P 
Sbjct  32   MWQLGLGPGESYPERPNETDCSYYLRTGICGYGSRCRYNHPRDRSAVTGGARPGGLEYPE  91

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RAGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 82/122 (67%), Gaps = 8/122 (7%)
 Frame = -2

Query  668  SYRAGTLPMGYY--------ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            S    +LP G Y         LQ+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R
Sbjct  315  SSTTASLPPGVYPSLSSPTGILQKEQTFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDR  374

Query  512  lipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAP  333
            + P  + +LSPIGLPLRPG   C FY + G CKFG +CKFDHPMG   YN S SS  +AP
Sbjct  375  IPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAP  434

Query  332  TV  327
              
Sbjct  435  VA  436


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A++    +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G P+R GE
Sbjct  135  AVRATGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGE  194

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C++Y + G CKFG +CKF HP
Sbjct  195  KDCSYYLKTGQCKFGITCKFHHP  217


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  94   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ATVEAAVRATGQYPERIGEPPCQ  152

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  153  FYLKTGTCKFGASCKFHHP  171



>ref|XP_011071464.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
 ref|XP_011071465.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
Length=488

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPG+PECQ+Y+KTGDCKFG+ CK+H+P E   P  + LLSP+GLPLRPG PL
Sbjct  306  QKESPFPERPGEPECQYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSPMGLPLRPGAPL  365

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C+ Y++ G+CKFGPSCKFDHPM   +Y+ S SS T+ P  
Sbjct  366  CSHYAQNGVCKFGPSCKFDHPMRTLSYSPSASSLTDMPVA  405


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER  QP CQ+YM+TG CKFGA CK+H+P++ +      +L+  G PLRPGE  C++Y 
Sbjct  88   YPERISQPVCQYYMRTGMCKFGASCKYHHPKQGIGSSAPIMLNFYGYPLRPGEKECSYYV  147

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  148  KTGQCKFGVTCKFHHP  163


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 3/88 (3%)
 Frame = -2

Query  647  PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp  468
            PM    L+    +PERP +P+C +Y++TG C +G  C+F++PR+R         S  G P
Sbjct  33   PMWQLGLES---YPERPDEPDCIYYLRTGSCGYGTRCRFNHPRDRGAAVGALRASGGGYP  89

Query  467  LRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             R  +P+C +Y R G+CKFG SCK+ HP
Sbjct  90   ERISQPVCQYYMRTGMCKFGASCKYHHP  117


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +Y+KTG CKFG  CKFH+P+
Sbjct  134  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQ  164



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 75/96 (78%), Gaps = 12/96 (13%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            +P+G YA      FPERPGQ ECQFYMKTGDCKF      H+PR+R  P PD +LS +GL
Sbjct  274  VPLGLYA------FPERPGQLECQFYMKTGDCKF------HHPRDRQTPAPDCVLSTVGL  321

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN  363
            PLR GEPLC FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  322  PLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  357


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FYMKTG CKFG  CKFH+PR  +       +  +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARTKGEYPERIGQPECE  98

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 75/96 (78%), Gaps = 12/96 (13%)
 Frame = -2

Query  650  LPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspigl  471
            +P+G YA      FPERPGQ ECQFYMKTGDCKF      H+PR+R  P PD +LS +GL
Sbjct  276  VPLGLYA------FPERPGQLECQFYMKTGDCKF------HHPRDRQTPAPDCVLSTVGL  323

Query  470  pLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYN  363
            PLR GEPLC FYSRYGICKFGPSCKFDHPMGVFTYN
Sbjct  324  PLRLGEPLCVFYSRYGICKFGPSCKFDHPMGVFTYN  359


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPEC+FYMKTG CKFG  CKFH+PR  +       +  +G PLRP E  C+++ 
Sbjct  88   YPERIGQPECEFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFL  147

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF+HP
Sbjct  148  RTGHCKFGGTCKFNHP  163


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PER G+P+C +Y++TG C+FG+ C+F++P +R      +  +    P R G+P C 
Sbjct  40   DGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDR-KLVIATARTKGEYPERIGQPECE  98

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  99   FYMKTGTCKFGVTCKFHHP  117



>ref|XP_002276435.1| PREDICTED: zinc finger CCCH domain-containing protein 34 isoform 
X1 [Vitis vinifera]
 emb|CBI26091.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ CK+H+P E   P  + +LSP+GLPLRPG P 
Sbjct  295  QKEQIFPERPGQPECQYYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQ  354

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y++ GICKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  355  CTHYAQRGICKFGPTCKFDHPMGTLSYSPSASSLADMPVA  394


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQFYMKTG CKFGA CK+H+PR+         L+  G PLRPGE  C++Y 
Sbjct  92   FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  151

Query  431  RYGICKFGPSCKFDHP  384
            + G+CKFG +CKF HP
Sbjct  152  KTGLCKFGETCKFHHP  167


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  617  NVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAF  438
              +PERP + +C +Y+KTG C +GA C+F++PR+R              P R G+P+C F
Sbjct  44   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  103

Query  437  YSRYGICKFGPSCKFDHP  384
            Y + G CKFG SCK+ HP
Sbjct  104  YMKTGTCKFGASCKYHHP  121



>emb|CAN78551.1| hypothetical protein VITISV_003243 [Vitis vinifera]
Length=518

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ CK+H+P E   P  + +LSP+GLPLRPG P 
Sbjct  335  QKEQIFPERPGQPECQYYMRTGDCKFGSSCKYHHPPEWDTPKTNCVLSPMGLPLRPGAPQ  394

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y++ GICKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  395  CTHYAQRGICKFGPTCKFDHPMGTLSYSPSASSLADMPVA  434


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQFYMKTG CKFGA CK+H+PR+         L+  G PLRPGE  C++Y 
Sbjct  132  FPERVGQPVCQFYMKTGTCKFGASCKYHHPRQGGGTVSPVTLNYFGYPLRPGEKECSYYV  191

Query  431  RYGICKFGPSCKFDHP  384
            + G+CKFG +CKF HP
Sbjct  192  KTGLCKFGETCKFHHP  207


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  617  NVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAF  438
              +PERP + +C +Y+KTG C +GA C+F++PR+R              P R G+P+C F
Sbjct  84   EAYPERPDEADCIYYLKTGFCGYGARCRFNHPRDRGGVGGTVRPGGGEFPERVGQPVCQF  143

Query  437  YSRYGICKFGPSCKFDHP  384
            Y + G CKFG SCK+ HP
Sbjct  144  YMKTGTCKFGASCKYHHP  161



>ref|NP_001078077.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10898.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=442

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  253  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGV  312

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  313  QRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVA  354


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
             + +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  39   SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  97

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  98   FYLKTGTCKFGASCKFHHP  116


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            +PER G+P CQFY+KTG CKFGA CKFH+P+ 
Sbjct  87   YPERFGEPPCQFYLKTGTCKFGASCKFHHPKN  118



>ref|XP_002880326.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56585.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  282  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGV  341

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  342  QRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVA  383


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A++    +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G P+R G+
Sbjct  82   AVRATGQYPERLGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMTHVPLNIYGYPVREGD  141

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C++Y + G CKFG +CKF HP
Sbjct  142  NECSYYLKTGQCKFGITCKFHHP  164


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C FY 
Sbjct  44   YPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEAAVRATGQYPERLGEPPCQFYL  102

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG SCKF HP
Sbjct  103  KTGTCKFGASCKFHHP  118



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+VFPERPGQPECQ+YMKTGDCKF + C++H+P E +    + +LSP+GLPLRPG P 
Sbjct  293  QKEHVFPERPGQPECQYYMKTGDCKFESSCRYHHPPELVTSKTNVVLSPMGLPLRPGAPT  352

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y+++G CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  353  CTHYTQHGQCKFGPACKFDHPMGTLSYSPSASSLADMPVA  392


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQ+YM+TG CKFGA CK+++P++         L+  G PLRPGE  C +Y 
Sbjct  90   FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYYGYPLRPGERECTYYI  149

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  150  KTGQCKFGATCKFHHPQ  166


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            + E+ +PERP + +C +Y++TG C +GA C++++PR+R      +       P R G+PL
Sbjct  39   ETESEYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAVLGAARAGGGEFPERVGQPL  98

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C +Y R G CKFG SCK++HP
Sbjct  99   CQYYMRTGTCKFGASCKYNHP  119



>ref|NP_182306.2| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 ref|NP_001078078.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 sp|Q84W91.2|C3H32_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 32; 
Short=AtC3H32; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 1 [Arabidopsis thaliana]
 gb|ABO45694.1| At2g47850 [Arabidopsis thaliana]
 gb|AEC10897.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
 gb|AEC10899.1| zinc finger CCCH domain-containing protein 32 [Arabidopsis thaliana]
Length=468

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  279  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGV  338

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  339  QRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVA  380


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G P+R G+  C++Y 
Sbjct  87   YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYL  146

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  147  KTGQCKFGITCKFHHP  162


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
             + +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  39   SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  97

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  98   FYLKTGTCKFGASCKFHHP  116



>gb|AAC63639.1| unknown protein [Arabidopsis thaliana]
Length=553

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  364  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGV  423

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  424  QRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVA  465


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G P+R G+  C++Y 
Sbjct  161  YPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYL  220

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  221  KTGQCKFGITCKFHHP  236


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
             + +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  113  SDSYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERFGEPPCQ  171

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  172  FYLKTGTCKFGASCKFHHP  190



>ref|XP_006294140.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27038.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=445

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  255  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGV  314

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  315  QRCTFYVQNGFCKFGSTCKFDHPMGNIRYNPSASSLADAPVA  356


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  41   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERIGEPPCQ  99

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  100  FYLKTGTCKFGASCKFHHP  118


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            +PER G+P CQFY+KTG CKFGA CKFH+P+ 
Sbjct  89   YPERIGEPPCQFYLKTGTCKFGASCKFHHPKN  120



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+VFPERPGQPECQ+YMKTGDCKF + C++H+P E +    + +LSP+G PLRPG P 
Sbjct  293  QKEHVFPERPGQPECQYYMKTGDCKFESSCRYHHPPELVASKTNVVLSPMGFPLRPGAPT  352

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y+++G CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  353  CTHYTQHGQCKFGPACKFDHPMGTLSYSPSASSLADMPVA  392


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 5/100 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQ+YM+TG CKFGA CK+++P++         L+  G PLRPG+  C +Y 
Sbjct  90   FPERVGQPLCQYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKECTYYI  149

Query  431  RYGICKFGPSCKFDHP----MGVFTYNISPS-STTNAPTV  327
            + G CKFG +CKF HP    M +   +++P  ++  APT+
Sbjct  150  KTGQCKFGATCKFHHPQPANMQIPAQSLAPQVASVPAPTL  189


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            + E+ +PERP + +C +Y++TG C +GA C++++PR+R              P R G+PL
Sbjct  39   ETESEYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGRTGGGEFPERVGQPL  98

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C +Y R G CKFG SCK++HP
Sbjct  99   CQYYMRTGTCKFGASCKYNHP  119



>emb|CDO98891.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            QRE+ FPERPGQPECQ+YMK GDCKFGA C++H+P E      + +LSP+GLPLRPG  +
Sbjct  306  QREHAFPERPGQPECQYYMKYGDCKFGASCRYHHPPELSAQKSNPVLSPMGLPLRPGAAV  365

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C+ Y + G+CKFGPSCKFDHPMG  +Y+ S SS  + P  
Sbjct  366  CSHYIQNGVCKFGPSCKFDHPMGTLSYSPSASSLADMPVA  405


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 60/93 (65%), Gaps = 2/93 (2%)
 Frame = -2

Query  662  RAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdslls  483
            R  T  MG  A   E  +PER GQP CQFYM+TG+CKFGA CK+H+PR+         L+
Sbjct  77   RDRTAAMGARATAGE--YPERVGQPVCQFYMRTGNCKFGASCKYHHPRQGSGSQTPVNLN  134

Query  482  piglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
              G PLRPGE  C++Y + G CK+G +CK+ HP
Sbjct  135  FFGYPLRPGEKDCSYYVKTGQCKYGVTCKYHHP  167


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP Q +C +Y++TG C +GA C+F++PR+R      +  +    P R G+P+C FY 
Sbjct  47   YPERPDQADCIYYLRTGLCGYGARCRFNHPRDR-TAAMGARATAGEYPERVGQPVCQFYM  105

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG SCK+ HP
Sbjct  106  RTGNCKFGASCKYHHP  121



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -2

Query  653  TLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspig  474
            TL +   + QRE++FPERPGQ ECQFYMKTGDCKFG  C++H+P+ER+IP P+ +L+ +G
Sbjct  308  TLQLPSSSAQRESMFPERPGQQECQFYMKTGDCKFGMTCRYHHPKERIIPVPNCVLNSLG  367

Query  473  lpLRPGEPLCAFYSRYGICKFGPSCKFDHPMG  378
            LPLRPG P C F++RYGICKFG +CKFDHPMG
Sbjct  368  LPLRPGAPACTFFTRYGICKFGATCKFDHPMG  399


 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A + +  +PER GQPECQ+Y+KTG CKFGA CKFH+PR++      ++++  G PLRP E
Sbjct  98   AARNKGEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRPNE  157

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFT  369
              CA+Y R G CK+G +CKF HP  V T
Sbjct  158  KECAYYMRTGQCKYGATCKFHHPQPVST  185



>ref|XP_009802826.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
isoform X2 [Nicotiana sylvestris]
Length=492

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            ++Q+E+ FPERPGQPECQ+YMK GDCKFG+ C++H+P E   P    +LS +GLPLRPG 
Sbjct  304  SIQKEHAFPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGA  363

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            P+C+ YS+ G+CKFGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  364  PICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVA  404


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+PR+    P     +  G PLRPGE  C FY 
Sbjct  94   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECLFYM  153

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  154  KTGQCKFGITCKFHHP  169


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp-----LRPGEPL  447
            +PERP + +C +Y++TG C +G+ C+F++P +R +    +     G        R G+P+
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGGGEGEYPERVGQPV  102

Query  446  CAFYSRYGICKFGPSCKFDHPM------GVFTYNI  360
            C +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  CQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  632  ALQRENVF--PERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            AL   N++  P RPG+ EC FYMKTG CKFG  CKFH+P+
Sbjct  131  ALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQ  170



>ref|XP_009802825.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana sylvestris]
Length=496

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            ++Q+E+ FPERPGQPECQ+YMK GDCKFG+ C++H+P E   P    +LS +GLPLRPG 
Sbjct  308  SIQKEHAFPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGA  367

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            P+C+ YS+ G+CKFGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  368  PICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVA  408


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRP----GEPLC  444
            +PER GQP CQ+YM+TG CKFGA CK+H+PR+    P     +  G PLRP    GE  C
Sbjct  94   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPFLAQGEKEC  153

Query  443  AFYSRYGICKFGPSCKFDHP  384
             FY + G CKFG +CKF HP
Sbjct  154  LFYMKTGQCKFGITCKFHHP  173


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp-----LRPGEPL  447
            +PERP + +C +Y++TG C +G+ C+F++P +R +    +     G        R G+P+
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGGGEGEYPERVGQPV  102

Query  446  CAFYSRYGICKFGPSCKFDHPM------GVFTYNI  360
            C +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  CQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  137



>ref|XP_006829498.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
 gb|ERM96914.1| hypothetical protein AMTR_s00074p00109750 [Amborella trichopoda]
Length=201

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            +E A+ G   M   +    LP    ALQ   +FPERP QPECQ+YMKTGDCKFGA CK+H
Sbjct  26   TEPASSGPMRMPSPFVHQLLP----ALQN-GLFPERPDQPECQYYMKTGDCKFGASCKYH  80

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDH  387
            +P ER +P  +  L P+GLPLRPG+PLC FYS+YGICKFGP+CKFDH
Sbjct  81   HPLERAMPLTNCALGPLGLPLRPGQPLCTFYSKYGICKFGPTCKFDH  127



>ref|XP_010523985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523986.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523988.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
 ref|XP_010523989.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Tarenaya hassleriana]
Length=475

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG   
Sbjct  286  QKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHPRDRVPPRANCILSPIGLPLRPGVQP  345

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C FY + G C+FG +CKFDHPMG  +YN S SS  +AP  
Sbjct  346  CTFYLQNGFCRFGSTCKFDHPMGTLSYNPSASSLVDAPVA  385


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A++    +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G PLR GE
Sbjct  83   AVRATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREGE  142

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C+ Y + G CKFG +CKF HP
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHP  165


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 61/114 (54%), Gaps = 7/114 (6%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGY------YALQRENVFPERPGQPECQFYMKTGDCKFG  546
            ++  N    G  P + +G    G         L     +PERPG P+C +YM+TG C +G
Sbjct  7    NQATNGSQSGQAPEWSSGGNETGLEESMWRLGLSNSETYPERPGVPDCAYYMRTGICGYG  66

Query  545  AVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            + C++++PR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  67   SRCRYNHPRDR-AMVEAAVRATGDYPERVGEPPCQFYLKTGTCKFGASCKFHHP  119



>ref|XP_006294141.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
 gb|EOA27039.1| hypothetical protein CARUB_v10023134mg [Capsella rubella]
Length=471

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
             +Q+E  FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG 
Sbjct  281  VIQKEQAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPGV  340

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
              C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  341  QRCTFYVQNGFCKFGSTCKFDHPMGNIRYNPSASSLADAPVA  382


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G P+R GE  C++Y 
Sbjct  89   YPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  148

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  149  KTGQCKFGITCKFHHP  164


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +PERPG P+C +YM+TG C +G  C++++PR+R      ++ +    P R GEP C 
Sbjct  41   SETYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPERIGEPPCQ  99

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF HP
Sbjct  100  FYLKTGTCKFGASCKFHHP  118



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein, partial [Physcomitrella patens]
Length=332

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            +E VFPERPGQPECQ+YMKTGDCKFG+ C++H+P++R  P P   LSP+GLPLRPG P C
Sbjct  252  QETVFPERPGQPECQYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLRPGNPPC  311

Query  443  AFYSRYGICKFGPSCKFDHPM  381
            +FYSRYGICKFGP+CKFDHP+
Sbjct  312  SFYSRYGICKFGPTCKFDHPL  332


 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A + +  +PER G PECQ+Y+KTG CKFGA CK+H+PRE+        L+ +GLPLR GE
Sbjct  59   ATRGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLRLGE  118

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              CA+Y R G CK+G +CKF HP
Sbjct  119  KECAYYMRTGSCKYGVTCKFHHP  141


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            +  +PERPG+P+C +YM+TG C FG  C++++P  R      +       P R G P C 
Sbjct  18   QGPYPERPGEPDCVYYMRTGLCGFGMTCRYNHPPNR-KLAAAATRGKGEYPERVGHPECQ  76

Query  440  FYSRYGICKFGPSCKFDHP  384
            +Y + G CKFG +CK+ HP
Sbjct  77   YYLKTGTCKFGATCKYHHP  95



>ref|XP_009339837.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ C++H+P E +      LLS  GLP RPG PL
Sbjct  289  QKEQIFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPL  348

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  349  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  388


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRPGE  C++Y 
Sbjct  89   YPERVGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERDCSYYV  148

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  149  KTGQCKFGATCKFHHPQ  165


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PER  + +C +Y++TG C +G+ C++++PR+R +    +    +  P 
Sbjct  32   MWQLGLGPGESYPERSDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPE  91

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RVGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            ++Q+E+ FPERPGQPECQ+Y+K GDCKFG+ C++H+P E   P    +LS +GLPLRPG 
Sbjct  300  SIQKEHAFPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGA  359

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            P+C+ YS+ G+CKFGPSCKFDHPMG+ +Y+ S SS  + P  
Sbjct  360  PICSHYSQNGVCKFGPSCKFDHPMGI-SYSPSASSLVDMPVA  400


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            E  +PER GQP CQ+YM+TG CKFGA CK+H+PR+    P     +  G PLRPGE  C 
Sbjct  89   EEKYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECL  148

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG +CKF HP
Sbjct  149  FYMKTGQCKFGITCKFHHP  167


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 55/93 (59%), Gaps = 9/93 (10%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRP---GEPLCA  441
            +PERP + +C +Y++TG C +G+ C+F++P +R +    +     G    P   G+P+C 
Sbjct  43   YPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGEEKYPERVGQPVCQ  102

Query  440  FYSRYGICKFGPSCKFDHPM------GVFTYNI  360
            +Y R G+CKFG SCK+ HP        + T+NI
Sbjct  103  YYMRTGMCKFGASCKYHHPRQGGGSPALMTHNI  135


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  632  ALQRENVF--PERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            AL   N++  P RPG+ EC FYMKTG CKFG  CKFH+P+
Sbjct  129  ALMTHNIYGYPLRPGEKECLFYMKTGQCKFGITCKFHHPQ  168



>ref|XP_008340827.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Malus 
domestica]
Length=476

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPGQPECQ+YM+TGDCKFG+ C++H+P E +      LLS  GLP RPG PL
Sbjct  292  QKEQLFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPL  351

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  352  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  391


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRPGE  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERECSYYV  148

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP+
Sbjct  149  KTGQCKFGATCKFHHPL  165


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = -2

Query  647  PMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp  468
            PM    L     +PERP + +C +Y++TG C +G+ C++++PR+R +    +    +  P
Sbjct  31   PMWQLGLGPGESYPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGXLEYP  90

Query  467  LRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             R G+P+C +Y R G CKFG SCK+ HP
Sbjct  91   ERAGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_009142498.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Brassica rapa]
Length=456

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -2

Query  656  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi  477
            G  P G   L+ E+ FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P P+  LS I
Sbjct  271  GVYPSGVVTLKEES-FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSI  329

Query  476  glpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            GLPLRPG   C+FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  330  GLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  379


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp--LRPGEPLCAF  438
            +PER G   CQFY+KTG CKFGA CKF++PR        + +        +R GE  C++
Sbjct  93   YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  152

Query  437  YSRYGICKFGPSCKFDHP  384
            + + G CKFG +CKF HP
Sbjct  153  FLKTGQCKFGITCKFHHP  170


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +P+R G P+C +YM+TG C +G+ C+F++P +R      ++ +    P R G   C 
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERIGALPCQ  103

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>emb|CDX80137.1| BnaA05g00190D [Brassica napus]
Length=456

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -2

Query  656  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi  477
            G  P G   L+ E+ FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P P+  LS I
Sbjct  271  GVYPSGVVTLKEES-FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSI  329

Query  476  glpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            GLPLRPG   C+FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  330  GLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  379


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp--LRPGEPLCAF  438
            +PER G   CQFY+KTG CKFGA CKF++PR        + +        +R GE  C++
Sbjct  93   YPERMGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  152

Query  437  YSRYGICKFGPSCKFDHP  384
            + + G CKFG +CKF HP
Sbjct  153  FLKTGQCKFGITCKFHHP  170


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +P+R G P+C +YM+TG C +G+ C+F++P +R      ++ +    P R G   C 
Sbjct  45   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERMGALPCQ  103

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>ref|XP_009142499.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Brassica rapa]
Length=455

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 1/110 (1%)
 Frame = -2

Query  656  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi  477
            G  P G   L+ E+ FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P P+  LS I
Sbjct  270  GVYPSGVVTLKEES-FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSI  328

Query  476  glpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            GLPLRPG   C+FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  329  GLPLRPGVQRCSFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  378


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp--LRPGEPLCAF  438
            +PER G   CQFY+KTG CKFGA CKF++PR        + +        +R GE  C++
Sbjct  92   YPERIGALPCQFYLKTGTCKFGASCKFNHPRNAAAGGSMTHVPLNIYGYPVRQGENECSY  151

Query  437  YSRYGICKFGPSCKFDHP  384
            + + G CKFG +CKF HP
Sbjct  152  FLKTGQCKFGITCKFHHP  169


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +P+R G P+C +YM+TG C +G+ C+F++P +R      ++ +    P R G   C 
Sbjct  44   SETYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERIGALPCQ  102

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF+HP
Sbjct  103  FYLKTGTCKFGASCKFNHP  121



>gb|EEE54266.1| hypothetical protein OsJ_01160 [Oryza sativa Japonica Group]
Length=182

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            ++E  FP RPGQPECQ+Y+KTG CKFG+ CK+H+P+    P  + +LSP+GLPLRPG   
Sbjct  7    KQEPAFPARPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRPGSQP  66

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            CA+Y+++G CKFGP+CKFDHPMG  +Y+ S SS T+ P  
Sbjct  67   CAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLPIA  106



>ref|XP_009369128.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 72/100 (72%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E +FPERPGQPECQ++M+TGDCKFG+ C++H+P E +      LLS  GLPLRPG PL
Sbjct  289  QKEQIFPERPGQPECQYFMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPLRPGAPL  348

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y + G CKFG +CKFDHP+G  +Y+ S SS  + P  
Sbjct  349  CTHYQQRGACKFGSACKFDHPIGTLSYSPSASSLADMPVA  388


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRP E  C++Y 
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPSERDCSYYV  148

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  149  KTGQCKFGSTCKFHHPQ  165


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PER  + +C +Y++TG C +G+ C++++PR+R +    +    +  P 
Sbjct  32   MRQLGLGTGESYPERSNEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPE  91

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R G+P+C +Y R G CKFG SCK+ HP
Sbjct  92   RAGQPVCQYYMRTGTCKFGASCKYHHP  118



>ref|XP_008796232.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Phoenix dactylifera]
Length=409

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            +RE +FPERPGQPECQFYM+TGDCKFGA CK+H+PR+  IP  + +LSP+GLPLRPG  +
Sbjct  226  EREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  285

Query  446  CAFYSRYGICKFGPSCKFDHPMGVF  372
            C++Y+++G+CKFGP+CKFDHP+G  
Sbjct  286  CSYYAQHGVCKFGPTCKFDHPVGTL  310


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+  GQP C++YMKTG CKFG+ CK+H+PR+        LL+  G PLRPGE  C++Y 
Sbjct  28   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYM  87

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  88   KTGQCKFGLTCKFHHP  103


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +YMKTG CKFG  CKFH+P+
Sbjct  74   YPLRPGEKECSYYMKTGQCKFGLTCKFHHPQ  104



>ref|XP_008802110.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Phoenix dactylifera]
Length=466

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            QRE+ FPERPGQPECQFYM+TGDCKFGA C++H+PR+  IP  +  LSP+GLPLRPG   
Sbjct  283  QREHTFPERPGQPECQFYMRTGDCKFGATCRYHHPRDWSIPKTNCALSPLGLPLRPGAQP  342

Query  446  CAFYSRYGICKFGPSCKFDHPMGVF  372
            CA+Y+++G+CKFGP+CKFDHPMG  
Sbjct  343  CAYYAQHGVCKFGPTCKFDHPMGTL  367


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 4/99 (4%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP C++YM+TG CKFG+ CK+H+PR+        L +  G PLRPGE  C++Y 
Sbjct  86   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLFNYYGFPLRPGEKECSYYM  145

Query  431  RYGICKFGPSCKFDHPMGVFTYNISPS----STTNAPTV  327
            + G CKFG +CKF HP        SP+     T  +PTV
Sbjct  146  KTGQCKFGSTCKFHHPQPAGASVPSPAPTFYPTVQSPTV  184


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +YM+TG C +G  C++++PR+R              P R G+P+C +Y 
Sbjct  40   YPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGGGRTGVGEYPERVGQPVCEYYM  99

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CK+ HP
Sbjct  100  RTGTCKFGSTCKYHHP  115



>ref|XP_006419655.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
 ref|XP_006489144.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Citrus sinensis]
 gb|ESR32895.1| hypothetical protein CICLE_v10004882mg [Citrus clementina]
Length=476

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPGQ ECQ+YMKTGDCKFG+ C+FH+PRE ++P  D  LSP GLPLRPG   
Sbjct  293  QKEHPFPERPGQQECQYYMKTGDCKFGSSCRFHHPRELIVPKMDVTLSPFGLPLRPGAAP  352

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y + G+CKFGP+CKFDHPMG+ +Y+ S SS  + P  
Sbjct  353  CTHYVQRGVCKFGPACKFDHPMGMLSYSPSASSLADMPVA  392


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQ+YM+TG CK+GA CK+H+PR+      +  L+  G PLRPGE  C++Y 
Sbjct  84   FPERVGQPVCQYYMRTGTCKYGASCKYHHPRQGAGSVSNVSLNYYGYPLRPGEKECSYYM  143

Query  431  RYGICKFGPSCKFDHP  384
            +   CKFG +CKF HP
Sbjct  144  KTRQCKFGATCKFHHP  159


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP + +C  Y++TG C +G+ C+F++PR+R      +       P R G+P+C +Y 
Sbjct  38   YPERPDEADCIHYVRTGFCAYGSRCRFNHPRDRGSVMGAARAGGGEFPERVGQPVCQYYM  97

Query  431  RYGICKFGPSCKFDHP  384
            R G CK+G SCK+ HP
Sbjct  98   RTGTCKYGASCKYHHP  113


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +YMKT  CKFGA CKFH+P+
Sbjct  130  YPLRPGEKECSYYMKTRQCKFGATCKFHHPQ  160



>ref|XP_010507789.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Camelina 
sativa]
Length=399

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -2

Query  632  ALQRENV-FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPG  456
             +Q+E   FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG
Sbjct  209  VIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPG  268

Query  455  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
               C FY + G CKFG +CKFDHPMG   YN S SS  +AP  
Sbjct  269  VQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVA  311


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+  CQFY+KTG CKFGA CKFH+P+          L+  G P+R GE  C++Y 
Sbjct  13   YPERFGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  72

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  73   KTGQCKFGITCKFHHP  88



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            + Q+E++FPERPGQPECQ+Y+KTGDCKF + C++H+P E ++   + +LSPIGLPLRPG 
Sbjct  291  STQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPLRPGA  350

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            P C+ Y++ G CKFGP+CKFDHPMG  +Y+ S SS  + P   + 
Sbjct  351  PTCSHYTQRGQCKFGPACKFDHPMGTLSYSPSASSLADMPVAPYL  395


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRPGE  C +Y 
Sbjct  90   YPERVGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYI  149

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  150  KTGQCKFGATCKFHHPQ  166


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            + E+V+PERP + +C +Y++TG C +GA C++++PR+R              P R G+PL
Sbjct  39   ETESVYPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPRAGGAEYPERVGQPL  98

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119



>ref|XP_010545038.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X2 [Tarenaya hassleriana]
Length=463

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -2

Query  680  GMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipp  501
            G  PS  + T P      Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFH+ R+R+   
Sbjct  263  GAYPSLSSSTAPS--VGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQR  320

Query  500  pdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
             + +LSPIGLPLRPG   C FY + G C+FG +CKFDHPMG   YN S SS  +AP  
Sbjct  321  ANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVDAPVA  378


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 60/108 (56%), Gaps = 1/108 (1%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+  +    G  P + +     G   L     +PERPG P+C +YM+TG C +G+ C+++
Sbjct  7    SQAMSGAQSGQAPEWSSEGADTGLEGLSSSETYPERPGAPDCAYYMRTGICGYGSRCRYN  66

Query  527  YPRERlipppdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
            +PR+R      ++ +    P R GEP C FY + G CKFG SCKF HP
Sbjct  67   HPRDR-AVVEAAVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHP  113


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A++    +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G PLR  E
Sbjct  77   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  136

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
              C+ Y + G CKFG +CKF HP    T   +P+ST
Sbjct  137  KECSHYLKTGQCKFGVTCKFHHPQPAGT--TTPAST  170



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            + Q+E++FPERPGQPECQ+Y+KTGDCKF + C++H+P E ++   + +LSPIGLPLRPG 
Sbjct  291  STQKEHLFPERPGQPECQYYIKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPLRPGA  350

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTVRHF  318
            P C+ Y++ G CKFGP+CKFDHPMG  +Y+ S SS  + P   + 
Sbjct  351  PTCSHYTQRGQCKFGPACKFDHPMGTLSYSPSASSLADMPVAPYL  395


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRPGE  C +Y 
Sbjct  90   YPERAGQPLCQYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYI  149

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  150  KTGQCKFGATCKFHHPQ  166


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            + E+ +PER  + +C +Y++TG C +GA C++++PR+R      +       P R G+PL
Sbjct  39   ETESEYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAARAGGAEYPERAGQPL  98

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C +Y R G CKFG SCK+ HP
Sbjct  99   CQYYMRTGTCKFGASCKYHHP  119



>ref|XP_010545037.1| PREDICTED: zinc finger CCCH domain-containing protein 32 isoform 
X1 [Tarenaya hassleriana]
Length=469

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 2/118 (2%)
 Frame = -2

Query  680  GMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipp  501
            G  PS  + T P      Q+E +FPERPG+PECQ+Y++TGDCKFG  CKFH+ R+R+   
Sbjct  269  GAYPSLSSSTAPS--VGSQKEQIFPERPGEPECQYYLRTGDCKFGLSCKFHHRRDRIPQR  326

Query  500  pdsllspiglpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
             + +LSPIGLPLRPG   C FY + G C+FG +CKFDHPMG   YN S SS  +AP  
Sbjct  327  ANCILSPIGLPLRPGVQPCTFYLQNGFCRFGSTCKFDHPMGTLRYNPSASSLVDAPVA  384


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PERPG P+C +YM+TG C +G+ C++++PR+R      ++ +    P 
Sbjct  34   MWRLGLSSSETYPERPGAPDCAYYMRTGICGYGSRCRYNHPRDR-AVVEAAVRATGEYPE  92

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R GEP C FY + G CKFG SCKF HP
Sbjct  93   RVGEPPCQFYLKTGTCKFGASCKFHHP  119


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A++    +PER G+P CQFY+KTG CKFGA CKFH+P+          L+  G PLR  E
Sbjct  83   AVRATGEYPERVGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSQVPLNIHGYPLREAE  142

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSST  345
              C+ Y + G CKFG +CKF HP    T   +P+ST
Sbjct  143  KECSHYLKTGQCKFGVTCKFHHPQPAGT--TTPAST  176



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            QRE+ FPERPGQPECQFYM+TGDCKFG+ C++H+PR+  +P  +  LSP+GLPLRPG   
Sbjct  283  QREHTFPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGAQP  342

Query  446  CAFYSRYGICKFGPSCKFDHPMGVF  372
            CA+Y+++G+CKFGP+CKFDHPMG  
Sbjct  343  CAYYAQHGVCKFGPTCKFDHPMGTL  367


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP C++YM+TG CKFG+ CK+H+PR+        LL+  G PLRPGE  C++Y 
Sbjct  85   YPERVGQPVCEYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKECSYYM  144

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  145  KTGQCKFGSTCKFHHP  160


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ++ +PERPG+P+C +YM+TG C +G  C++++PR+R         +    P R G+P+C 
Sbjct  36   DSPYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGRTAAGEYPERVGQPVCE  95

Query  440  FYSRYGICKFGPSCKFDHP  384
            +Y R G CKFG +CK+ HP
Sbjct  96   YYMRTGTCKFGSTCKYHHP  114



>ref|XP_008796231.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            +RE +FPERPGQPECQFYM+TGDCKFGA CK+H+PR+  IP  + +LSP+GLPLRPG  +
Sbjct  281  EREQMFPERPGQPECQFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  340

Query  446  CAFYSRYGICKFGPSCKFDHPMGVF  372
            C++Y+++G+CKFGP+CKFDHP+G  
Sbjct  341  CSYYAQHGVCKFGPTCKFDHPVGTL  365


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+  GQP C++YMKTG CKFG+ CK+H+PR+        LL+  G PLRPGE  C++Y 
Sbjct  83   YPQHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYM  142

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  143  KTGQCKFGLTCKFHHP  158


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            ++ +PERPG+P+C +Y++TG C +G  C++++PR+            +  P   G+P+C 
Sbjct  34   DSPYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCE  93

Query  440  FYSRYGICKFGPSCKFDHP  384
            +Y + G CKFG +CK+ HP
Sbjct  94   YYMKTGTCKFGSTCKYHHP  112


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +YMKTG CKFG  CKFH+P+
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGLTCKFHHPQ  159



>ref|XP_010938478.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Elaeis guineensis]
Length=463

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            +RE +FPERPGQPECQFYM+TGDCK+G  CK+H+PR+  IP  + +LSP+GLPLRPG  +
Sbjct  280  EREQMFPERPGQPECQFYMRTGDCKYGVTCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQI  339

Query  446  CAFYSRYGICKFGPSCKFDHPMGVF  372
            CAFY+++G+CKFGP+CKFDHP+G  
Sbjct  340  CAFYAQHGVCKFGPTCKFDHPVGTL  364


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PE  GQP C++YMKTG CKFG+ CK+H+PR+        LL+  G PLRPGE  C++Y 
Sbjct  83   YPEHVGQPVCEYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYCGYPLRPGEKECSYYM  142

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  143  KTGQCKFGSTCKFHHP  158


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C +G  C++++P +R           +  P   G+P+C +Y 
Sbjct  37   YPERPGEPDCAYYIRTGSCGYGERCRYNHPPDRGALARSGRTGVVEYPEHVGQPVCEYYM  96

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CK+ HP
Sbjct  97   KTGTCKFGSTCKYHHP  112


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPR  519
            +P RPG+ EC +YMKTG CKFG+ CKFH+P+
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGSTCKFHHPQ  159



>ref|XP_010507842.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
 ref|XP_010507843.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Camelina sativa]
Length=449

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -2

Query  632  ALQRENV-FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPG  456
             +Q+E   FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG
Sbjct  259  VIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPG  318

Query  455  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
               C FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  319  VQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  361


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PER G P+C +YM+TG C +G  C++++PR+R      ++ +    P 
Sbjct  34   MWRLGLGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPE  92

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R GE  C FY + G CKFG SCKF HP
Sbjct  93   RIGELPCQFYLKTGTCKFGASCKFHHP  119


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            +PER G+  CQFY+KTG CKFGA CKFH+P+ 
Sbjct  90   YPERIGELPCQFYLKTGTCKFGASCKFHHPKN  121



>emb|CDY53022.1| BnaC04g00080D [Brassica napus]
Length=458

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -2

Query  656  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi  477
            G  P G   L+ E+ FPERP +PECQ+Y+KTGDCKFG  CKFH+PR+R+ P P+  LS +
Sbjct  270  GVYPSGVVTLKEES-FPERPAEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRPNCDLSSV  328

Query  476  glpLRPGEPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            GLPLRPG   C FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  329  GLPLRPGVQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  378


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi-glpLRPGEPLCAFY  435
            +PER G   CQFY+KTG CKFGA CKF++PR         +   I G P+R GE  C+++
Sbjct  93   YPERLGALPCQFYLKTGTCKFGASCKFNHPRNAAGGSMTHVPLNIYGYPVRQGENECSYF  152

Query  434  SRYGICKFGPSCKFDHP  384
             + G CKFG +CKF HP
Sbjct  153  LKTGQCKFGITCKFHHP  169


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
               +P+R G P+C +YM+TG C +G+ C+F++P +R      ++ +    P R G   C 
Sbjct  45   SEAYPQRAGAPDCAYYMRTGVCGYGSRCRFNHPPDR-ASVEATVRATGQYPERLGALPCQ  103

Query  440  FYSRYGICKFGPSCKFDHP  384
            FY + G CKFG SCKF+HP
Sbjct  104  FYLKTGTCKFGASCKFNHP  122



>tpg|DAA53995.1| TPA: hypothetical protein ZEAMMB73_505725 [Zea mays]
 tpg|DAA53996.1| TPA: hypothetical protein ZEAMMB73_505725 [Zea mays]
Length=220

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            +E  FPERPGQPEC+ YMKTG CK+GA CK+H+P+    P  + +LSP+GLPLRPG   C
Sbjct  51   QEYAFPERPGQPECEHYMKTGTCKYGAACKYHHPQYFSGPKSNCILSPLGLPLRPGSQPC  110

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            A+Y+ +G CKFGP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  111  AYYAHHGYCKFGPTCKFDHPMGTPNYSISTSSLTDVPIA  149



>ref|XP_006855486.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            +EN FPERPGQPECQFYM+TGDCK+G+ C++H+P +R++P  +  LSPIG PLRPG P C
Sbjct  286  KENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLSPIGFPLRPGAPTC  345

Query  443  AFYSRYGICKFGPSCKFDHPMG  378
            +FY+++G+CKFGP+CKFDHP+G
Sbjct  346  SFYAQHGVCKFGPTCKFDHPLG  367


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+++KTG CKFGA CK+H+PR          L+ +G PLRPG+  C++Y 
Sbjct  90   YPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKECSYYV  149

Query  431  RYGICKFGPSCKFDHPMGVFT  369
            + G CKFGP+CKF HP  V T
Sbjct  150  KTGQCKFGPTCKFHHPQPVNT  170


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = -2

Query  644  MGYYALQREN---VFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspig  474
            M   +L RE+    +PERPG+ +C FYMKTG C++GA C++++P +R             
Sbjct  30   MWRLSLGRESGGEYYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPAADVLQTGGGE  89

Query  473  lpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
             P R G+P C ++ + G CKFG +CK+ HP
Sbjct  90   YPERVGQPTCQYFIKTGTCKFGATCKYHHP  119



>ref|XP_009588295.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Nicotiana 
tomentosiformis]
Length=494

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPGQPECQ+YMK GDCK+G+ C++H+P E   P    +LS +GLPLRPG P+
Sbjct  305  QKEHAFPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPI  364

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            C+ Y++ G+CKFGPSCKFDHPMG+ +Y+ S SS T+
Sbjct  365  CSHYAQNGVCKFGPSCKFDHPMGM-SYSPSASSLTD  399


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+PR+    P    ++  G PLRPGE  C++Y 
Sbjct  93   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYV  152

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  153  KTGQCKFGVTCKFHHP  168


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP +P+C +Y++TG C +GA C+F++PR+R         +    P R G+P+C +Y 
Sbjct  47   YPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYM  106

Query  431  RYGICKFGPSCKFDHP  384
            R G+CKFG SCK+ HP
Sbjct  107  RTGMCKFGASCKYHHP  122



>ref|XP_010507840.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
 ref|XP_010507841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Camelina sativa]
Length=475

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 76/103 (74%), Gaps = 1/103 (1%)
 Frame = -2

Query  632  ALQRENV-FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPG  456
             +Q+E   FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG
Sbjct  285  VIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPG  344

Query  455  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
               C FY + G CKFG +CKFDHP+G   YN S SS  +AP  
Sbjct  345  VQRCTFYVQNGFCKFGSTCKFDHPVGTIRYNPSASSLADAPVA  387


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER G+  CQFY+KTG CKFGA CKFH+P+          L+  G P+R GE  C++Y 
Sbjct  90   YPERIGELPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGENECSYYL  149

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  150  KTGQCKFGITCKFHHP  165


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 50/87 (57%), Gaps = 1/87 (1%)
 Frame = -2

Query  644  MGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL  465
            M    L     +PER G P+C +YM+TG C +G  C++++PR+R      ++ +    P 
Sbjct  34   MWRLGLGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGQYPE  92

Query  464  RPGEPLCAFYSRYGICKFGPSCKFDHP  384
            R GE  C FY + G CKFG SCKF HP
Sbjct  93   RIGELPCQFYLKTGTCKFGASCKFHHP  119



>ref|XP_010518502.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Camelina sativa]
Length=445

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 1/103 (1%)
 Frame = -2

Query  632  ALQRENV-FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPG  456
             +Q+E   FPERPG+PECQ+Y+KTGDCKFG  CKFH+PR+R+ P  + +LSPIGLPLRPG
Sbjct  255  VIQKEQAAFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCILSPIGLPLRPG  314

Query  455  EPLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
               C FY + G CKFG  CKFDHP+G   YN S SS  +AP  
Sbjct  315  VQRCTFYVQNGFCKFGSKCKFDHPVGTIRYNPSASSLADAPVA  357


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -2

Query  629  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEP  450
            L     +PER G P+C +YM+TG C +G  C++++PR+R      ++ +    P R G+ 
Sbjct  35   LGSSETYPERLGAPDCAYYMRTGVCGYGNRCRYNHPRDR-ASVEATVRATGLYPERIGDL  93

Query  449  LCAFYSRYGICKFGPSCKFDHP  384
             C FY + G CKFG SCKF HP
Sbjct  94   PCQFYLKTGTCKFGASCKFHHP  115


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  629  LQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            ++   ++PER G   CQFY+KTG CKFGA CKFH+P+ 
Sbjct  80   VRATGLYPERIGDLPCQFYLKTGTCKFGASCKFHHPKN  117



>ref|XP_006644012.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
[Oryza brachyantha]
Length=436

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            ++E  FPERPGQPECQ+Y+KTG CKFG+ CK+H+P+    P  + +LSP+GLPLRPG   
Sbjct  260  KQEPAFPERPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRPGSQP  319

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            CA+Y+++G CKFGP+CKFDHPMG   Y+ S SS T+ P  
Sbjct  320  CAYYTQHGFCKFGPTCKFDHPMGTLNYSPSASSITDLPIA  359


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPGQP C+++MK G CKFG+ CK+ +PRE        +L+  G PLRPGE  C++Y 
Sbjct  69   YPERPGQPVCEYFMKNGTCKFGSNCKYDHPRE--GSVQPVVLNASGYPLRPGEKDCSYYV  126

Query  431  RYGICKFGPSCKFDHP-MGVFTYNISP  354
            +   CKFG +CKF HP  G  T N+ P
Sbjct  127  KTSHCKFGSTCKFHHPETGGVTPNMYP  153


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 5/81 (6%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppd-----sllspiglpLRPGEPL  447
             PERPG+ +C +Y++TG C +G  C++++PR+R                   P RPG+P+
Sbjct  18   LPERPGEADCVYYLRTGACGYGENCRYNHPRDRASAAAALNGGGKSTHSAEYPERPGQPV  77

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C ++ + G CKFG +CK+DHP
Sbjct  78   CEYFMKNGTCKFGSNCKYDHP  98



>ref|XP_007035523.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOY06449.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=472

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E  FPERPGQPECQ+YMKTGDCK+G+ C++H+P E + P  D +L P+GLPLRPG P 
Sbjct  286  QKEQSFPERPGQPECQYYMKTGDCKYGSSCRYHHPPEVIAPKADVMLGPLGLPLRPGAPP  345

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C+ YS+ G+CKFG +CKFDHP G  +Y+ S SS  + P  
Sbjct  346  CSHYSQRGVCKFGAACKFDHPTGTLSYSPSASSLADMPVA  385


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFG  CK+H+P++        LL+  G PLRPGE  C++Y 
Sbjct  84   YPERVGQPVCQYYMRTGTCKFGVSCKYHHPKQGGGSVSSVLLNYYGYPLRPGEKECSYYV  143

Query  431  RYGICKFGPSCKFDH  387
            + G CKFG +CKF H
Sbjct  144  KTGQCKFGATCKFHH  158


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP + +C +Y++TG C +G+ C+F++PR+R              P R G+P+C +Y 
Sbjct  38   YPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRAAVMGAGRGGVGEYPERVGQPVCQYYM  97

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG SCK+ HP
Sbjct  98   RTGTCKFGVSCKYHHP  113



>gb|AGT16102.1| hypothetical protein SHCRBa_134_J05_F_10 [Saccharum hybrid cultivar 
R570]
Length=353

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            +E  FPERPGQPEC+ YMKTG CK+GAVCK+H+P+    P  + +LSP+GLPLRPG   C
Sbjct  198  QEYAFPERPGQPECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCILSPLGLPLRPGSQPC  257

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            A+Y+ +G CKFGP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  258  AYYAHHGFCKFGPTCKFDHPMGTPNYSISASSLTDVPVA  296


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPGQP C++Y K G CKFG+ CKF +PRE         L+  G PLR GE  C++Y 
Sbjct  4    YPERPGQPLCEYYAKNGTCKFGSNCKFDHPRE--GGFVPVTLNSSGFPLRLGEKECSYYM  61

Query  431  RYGICKFGPSCKFDHP-MGVFT  369
            + G CKFG +CKF HP +G  T
Sbjct  62   KTGHCKFGATCKFHHPELGFLT  83



>ref|XP_001752915.1| predicted protein [Physcomitrella patens]
 gb|EDQ82419.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            E++FPERPGQPECQ+YMKTGDCKFG  C++H+P++R  P P   LSPIGLPLRPG   C+
Sbjct  1    ESLFPERPGQPECQYYMKTGDCKFGTTCRYHHPKDRTTPSPTCHLSPIGLPLRPGNLPCS  60

Query  440  FYSRYGICKFGPSCKFDH  387
            FY+RYGICKFGP+CKFDH
Sbjct  61   FYTRYGICKFGPTCKFDH  78



>gb|AGT16494.1| zinc finger CCCH type domain-containing protein [Saccharum hybrid 
cultivar R570]
Length=448

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
            +E  FPERPGQPEC+ YMKTG CK+GAVCK+H+P+    P  + +LSP+GLPLRPG   C
Sbjct  280  QEYAFPERPGQPECEHYMKTGTCKYGAVCKYHHPQYFSGPKSNCILSPLGLPLRPGSQPC  339

Query  443  AFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            A+Y+ +G CKFGP+CKFDHPMG   Y+IS SS T+ P  
Sbjct  340  AYYAHHGFCKFGPTCKFDHPMGTPNYSISASSLTDVPVA  378


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp--LRPGEPL  447
            E   PERPG+ +C +Y++TG C +G  C++++PR+R  P      +   +    RPG+PL
Sbjct  35   EEKLPERPGEADCAYYLRTGACGYGERCRYNHPRDRPAPVNGVGKTAGMVEYPERPGQPL  94

Query  446  CAFYSRYGICKFGPSCKFDHP  384
            C +Y++ G CKFG +CKFDHP
Sbjct  95   CEYYAKNGTCKFGSNCKFDHP  115


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPGQP C++Y K G CKFG+ CKF +PRE         L+  G PLR GE  C++Y 
Sbjct  86   YPERPGQPLCEYYAKNGTCKFGSNCKFDHPRE--GGFVPVTLNSSGFPLRLGEKECSYYM  143

Query  431  RYGICKFGPSCKFDHP-MGVFT  369
            + G CKFG +CKF HP +G  T
Sbjct  144  KTGHCKFGATCKFHHPELGFLT  165



>ref|XP_009774842.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Nicotiana sylvestris]
Length=492

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E+ FPERPGQPECQ+YMK GDCK+G+ C++H+P E   P    +LS +GLPLRPG P+
Sbjct  305  QKEHAFPERPGQPECQYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPI  364

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTN  339
            C+ Y++ G+CKFGPSCKFDHPMG+ +Y+ S SS  +
Sbjct  365  CSHYAQNGVCKFGPSCKFDHPMGM-SYSPSASSLAD  399


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQP CQ+YM+TG CKFGA CK+H+PR+    P    ++  G PLRPGE  C++Y 
Sbjct  93   YPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYV  152

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  153  KTGQCKFGVTCKFHHP  168


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERP +P+C +Y++TG C +GA C+F++PR+R         +    P R G+P+C +Y 
Sbjct  47   YPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYM  106

Query  431  RYGICKFGPSCKFDHP  384
            R G+CKFG SCK+ HP
Sbjct  107  RTGMCKFGASCKYHHP  122



>ref|XP_010270054.1| PREDICTED: zinc finger CCCH domain-containing protein 12 isoform 
X2 [Nelumbo nucifera]
Length=385

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPERP QPECQ+YMKTG CKFG  CK+H+P+ER+ P   S L P+GLPLRPG+ +C FY+
Sbjct  222  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  281

Query  431  RYGICKFGPSCKFDHPMGV-FTYNIS-PSSTTNAPTV  327
             YGICK+GP+CK+DHP+G  F+Y++S P+ +   PT+
Sbjct  282  LYGICKYGPTCKYDHPLGAYFSYSMSLPALSMPDPTL  318


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A+Q     PER GQP+CQ+++KTG CKFGA CK+H+PR+R       LL+ +GLP+R  E
Sbjct  19   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR-HDTAHVLLNILGLPMRQEE  77

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  354
              C +Y R G CKFG +CKF HP       +SP
Sbjct  78   KSCPYYMRTGSCKFGMACKFHHPQPATLGLVSP  110



>ref|XP_001752815.1| predicted protein [Physcomitrella patens]
 gb|EDQ82319.1| predicted protein, partial [Physcomitrella patens]
Length=78

 Score =   104 bits (259),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -2

Query  620  ENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCA  441
            E++FPER GQPECQ+YMKTG+CKFG  C++H+P++R  P     LS +GLPLRPG P C+
Sbjct  1    ESLFPERLGQPECQYYMKTGECKFGTTCRYHHPKDRSTPSSTCHLSAMGLPLRPGNPPCS  60

Query  440  FYSRYGICKFGPSCKFDH  387
            FY+RYGICKFGP+CKFDH
Sbjct  61   FYTRYGICKFGPTCKFDH  78



>ref|NP_001042632.2| Os01g0257400 [Oryza sativa Japonica Group]
 sp|Q5NAV3.1|C3H5_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 5; Short=OsC3H5; 
AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 3 [Oryza sativa Japonica Group]
 dbj|BAD81393.1| putative floral homeotic protein HUA1 [Oryza sativa Japonica 
Group]
 dbj|BAG93710.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04546.2| Os01g0257400 [Oryza sativa Japonica Group]
Length=466

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            ++E  FP RPGQPECQ+Y+KTG CKFG+ CK+H+P+    P  + +LSP+GLPLRPG   
Sbjct  291  KQEPAFPARPGQPECQYYLKTGSCKFGSACKYHHPQYLNTPKSNCMLSPLGLPLRPGSQP  350

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            CA+Y+++G CKFGP+CKFDHPMG  +Y+ S SS T+ P  
Sbjct  351  CAYYTQHGFCKFGPTCKFDHPMGTLSYSPSASSITDLPIA  390


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 51/76 (67%), Gaps = 2/76 (3%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPGQP C++YMK G CKFG+ CK+ +PRE        +L+  G PLR GE  C +Y 
Sbjct  98   YPERPGQPVCEYYMKNGTCKFGSNCKYDHPRE--GSVQAVMLNSSGYPLRSGEKDCTYYV  155

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  156  KTGHCKFGSTCKFHHP  171


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpL----RPGEPLC  444
             PERPG+ +C +Y++TG C +G  C++++PR+R      +             RPG+P+C
Sbjct  48   LPERPGEADCVYYLRTGACGYGENCRYNHPRDRAAAAVLNGGGKTTHSAEYPERPGQPVC  107

Query  443  AFYSRYGICKFGPSCKFDHP  384
             +Y + G CKFG +CK+DHP
Sbjct  108  EYYMKNGTCKFGSNCKYDHP  127



>ref|XP_010270055.1| PREDICTED: zinc finger CCCH domain-containing protein 57 isoform 
X3 [Nelumbo nucifera]
Length=345

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPERP QPECQ+YMKTG CKFG  CK+H+P+ER+ P   S L P+GLPLRPG+ +C FY+
Sbjct  182  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  241

Query  431  RYGICKFGPSCKFDHPMGV-FTYNIS-PSSTTNAPTV  327
             YGICK+GP+CK+DHP+G  F+Y++S P+ +   PT+
Sbjct  242  LYGICKYGPTCKYDHPLGAYFSYSMSLPALSMPDPTL  278


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+RPG+P+C +Y++TG C +G+ C+F++P         ++     LP R G+P C ++ 
Sbjct  49   YPDRPGEPDCIYYLRTGLCGYGSNCRFNHP----AYAGRAVQYRGELPERVGQPDCQYFL  104

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CK+ HP
Sbjct  105  KTGTCKFGATCKYHHP  120


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRER  513
            A+Q     PER GQP+CQ+++KTG CKFGA CK+H+PR+R
Sbjct  84   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR  123



>ref|XP_004987433.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
[Setaria italica]
Length=134

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            SE   +G  GM PSY+AG++P+G YA+Q EN+FPERP QPECQFYMKTGDCKFGAVCKF+
Sbjct  25   SETTGMGEHGMYPSYQAGSVPVGLYAVQGENIFPERPDQPECQFYMKTGDCKFGAVCKFN  84

Query  527  YPRER  513
            +P+ER
Sbjct  85   HPKER  89



>ref|XP_009408337.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=482

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q + V+PERPGQPEC ++MKTGDCKF + CKFH+PR RL       +SP+GLPLRP +P+
Sbjct  383  QGDMVYPERPGQPECPYFMKTGDCKFKSACKFHHPRSRLTGISSCNISPLGLPLRPDQPV  442

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  351
            CAFYSR GICK+GP+CKFDHPM  F  + SP+
Sbjct  443  CAFYSRLGICKYGPACKFDHPMD-FASSASPT  473


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            +++ +  FPE+ G+ EC+F++  G CKF   C F + +++        L+ +GLP+R GE
Sbjct  201  SMEEKEEFPEKAGRKECKFFLMPGGCKFRNSCMFAHSQQK-PEVSGIRLNFLGLPIRTGE  259

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C +Y R G CKF  +C F+HP
Sbjct  260  KECPYYMRTGSCKFSSNCWFNHP  282



>ref|XP_009408338.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=470

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q + V+PERPGQPEC ++MKTGDCKF + CKFH+PR RL       +SP+GLPLRP +P+
Sbjct  371  QGDMVYPERPGQPECPYFMKTGDCKFKSACKFHHPRSRLTGISSCNISPLGLPLRPDQPV  430

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  351
            CAFYSR GICK+GP+CKFDHPM  F  + SP+
Sbjct  431  CAFYSRLGICKYGPACKFDHPMD-FASSASPT  461


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            +++ +  FPE+ G+ EC+F++  G CKF   C F + +++        L+ +GLP+R GE
Sbjct  189  SMEEKEEFPEKAGRKECKFFLMPGGCKFRNSCMFAHSQQK-PEVSGIRLNFLGLPIRTGE  247

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C +Y R G CKF  +C F+HP
Sbjct  248  KECPYYMRTGSCKFSSNCWFNHP  270



>ref|XP_010270053.1| PREDICTED: zinc finger CCCH domain-containing protein 12 isoform 
X1 [Nelumbo nucifera]
Length=450

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPERP QPECQ+YMKTG CKFG  CK+H+P+ER+ P   S L P+GLPLRPG+ +C FY+
Sbjct  287  FPERPDQPECQYYMKTGSCKFGPTCKYHHPKERIAPLATSTLGPLGLPLRPGQAVCTFYT  346

Query  431  RYGICKFGPSCKFDHPMGV-FTYNIS-PSSTTNAPTV  327
             YGICK+GP+CK+DHP+G  F+Y++S P+ +   PT+
Sbjct  347  LYGICKYGPTCKYDHPLGAYFSYSMSLPALSMPDPTL  383


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 60/93 (65%), Gaps = 1/93 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A+Q     PER GQP+CQ+++KTG CKFGA CK+H+PR+R       LL+ +GLP+R  E
Sbjct  84   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR-HDTAHVLLNILGLPMRQEE  142

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISP  354
              C +Y R G CKFG +CKF HP       +SP
Sbjct  143  KSCPYYMRTGSCKFGMACKFHHPQPATLGLVSP  175


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +P+RPG+P+C +Y++TG C +G+ C+F++P         ++     LP R G+P C ++ 
Sbjct  49   YPDRPGEPDCIYYLRTGLCGYGSNCRFNHP----AYAGRAVQYRGELPERVGQPDCQYFL  104

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CK+ HP
Sbjct  105  KTGTCKFGATCKYHHP  120



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = -2

Query  707  SEVANVGSQGMNPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFH  528
            S+  N GS G   SY++G++P+G+YALQR+N+FPERPGQPECQFYMKTGDCKFGAVC+FH
Sbjct  261  SDSVNTGSPGAFSSYQSGSMPVGFYALQRDNIFPERPGQPECQFYMKTGDCKFGAVCRFH  320

Query  527  YPRER  513
            +PRER
Sbjct  321  HPRER  325


 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PER GQPECQ+Y+KTG CKFGA CKFH+PR++        L+ +G P RP E  CA+Y 
Sbjct  87   YPERVGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYL  146

Query  431  RYGICKFGPSCKFDHP  384
            R G CKFG +CKF HP
Sbjct  147  RTGQCKFGSTCKFHHP  162


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            +PERPG+P+C +Y++TG C+FGA C+F++P +R      +       P R G+P C +Y 
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGATCRFNHPSDR-KLAIANARMKGEYPERVGQPECQYYL  100

Query  431  RYGICKFGPSCKFDHP  384
            + G CKFG +CKF HP
Sbjct  101  KTGTCKFGATCKFHHP  116



>ref|XP_009408339.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q + V+PERPGQPEC ++MKTGDCKF + CKFH+PR RL       +SP+GLPLRP +P+
Sbjct  370  QGDMVYPERPGQPECPYFMKTGDCKFKSACKFHHPRSRLTGISSCNISPLGLPLRPDQPV  429

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPS  351
            CAFYSR GICK+GP+CKFDHPM  F  + SP+
Sbjct  430  CAFYSRLGICKYGPACKFDHPMD-FASSASPT  460


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            +++ +  FPE+ G+ EC+F++  G CKF   C F + +++        L+ +GLP+R GE
Sbjct  188  SMEEKEEFPEKAGRKECKFFLMPGGCKFRNSCMFAHSQQK-PEVSGIRLNFLGLPIRTGE  246

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
              C +Y R G CKF  +C F+HP
Sbjct  247  KECPYYMRTGSCKFSSNCWFNHP  269



>ref|XP_009411695.1| PREDICTED: zinc finger CCCH domain-containing protein 5-like 
[Musa acuminata subsp. malaccensis]
Length=465

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A +R + FPERPGQPECQFYM+TGDCKFGA CK+H+P +  I   + +LSP+GLPLRPG 
Sbjct  281  ASRRGDKFPERPGQPECQFYMRTGDCKFGATCKYHHPPDWSISKGNCVLSPLGLPLRPGA  340

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  330
             LC +Y+++G+CKFG +CKFDHPMG  + + S SS  + P 
Sbjct  341  QLCNYYAQHGMCKFGTTCKFDHPMGTLSCSPSASSLFDMPV  381


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 0/92 (0%)
 Frame = -2

Query  605  ERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYSRY  426
            ER  QP C++YMKTG CKFG+ CK+ +PR+     P  LL+  G PLRPGE  C++Y + 
Sbjct  87   ERADQPVCEYYMKTGTCKFGSTCKYRHPRQGSGSIPPVLLNDCGYPLRPGEKECSYYMKT  146

Query  425  GICKFGPSCKFDHPMGVFTYNISPSSTTNAPT  330
            G CKFG +CKF HP        SP+    +P 
Sbjct  147  GHCKFGSTCKFHHPQQAEALVPSPAPAFYSPV  178


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglp--LRPGE  453
            +  + +PERPG+P+C  Y++TG C +G  C++++PR+              +    R  +
Sbjct  32   EGSSSYPERPGEPDCSHYVRTGSCSYGERCRYNHPRDHGALTGAGTGRTGAVEYLERADQ  91

Query  452  PLCAFYSRYGICKFGPSCKFDHP  384
            P+C +Y + G CKFG +CK+ HP
Sbjct  92   PVCEYYMKTGTCKFGSTCKYRHP  114


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = -2

Query  674  NPSYRAGTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRE  516
            +P   +G++P     L  +  +P RPG+ EC +YMKTG CKFG+ CKFH+P++
Sbjct  113  HPRQGSGSIPP---VLLNDCGYPLRPGEKECSYYMKTGHCKFGSTCKFHHPQQ  162



>ref|XP_010252578.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Nelumbo 
nucifera]
 ref|XP_010252579.1| PREDICTED: zinc finger CCCH domain-containing protein 3 [Nelumbo 
nucifera]
Length=452

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 8/104 (8%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPERP QPECQ+YMKTG CKFG+ CK+H+PRER+ P   S + P+GLPLRPG+ +C FY+
Sbjct  288  FPERPDQPECQYYMKTGSCKFGSTCKYHHPRERIAPLATSTIGPLGLPLRPGQAICTFYN  347

Query  431  RYGICKFGPSCKFDHP--------MGVFTYNISPSSTTNAPTVR  324
             YGICKFGP+CK+DHP        MG+ T +I+ +  T+ P  R
Sbjct  348  LYGICKFGPTCKYDHPLAGYYNYGMGLPTLSIAAADPTSFPYQR  391


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 1/86 (1%)
 Frame = -2

Query  632  ALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGE  453
            A+Q     PER GQP+CQ+++KTG CKFGA CK+H+PR+R       LL+ +GLP+R  E
Sbjct  83   AVQYRGELPERVGQPDCQYFLKTGTCKFGATCKYHHPRDR-HDADQVLLNVLGLPMRQEE  141

Query  452  PLCAFYSRYGICKFGPSCKFDHPMGV  375
              C +Y R G CKFG +CKF HP  V
Sbjct  142  KSCPYYMRTGSCKFGVACKFHHPQPV  167


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = -2

Query  623  RENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLC  444
              N +P+RPG+P+C +Y++TG C +G+ C+F++P         ++     LP R G+P C
Sbjct  44   HSNPYPDRPGEPDCIYYLRTGLCGYGSNCRFNHP----AYAGQAVQYRGELPERVGQPDC  99

Query  443  AFYSRYGICKFGPSCKFDHP  384
             ++ + G CKFG +CK+ HP
Sbjct  100  QYFLKTGTCKFGATCKYHHP  119



>gb|KDP40004.1| hypothetical protein JCGZ_02002 [Jatropha curcas]
Length=473

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -2

Query  626  QRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPL  447
            Q+E  FPERP QPECQ+YMKTG+CKFG+ C++H+P E + P  + +LSPIGLPLRPG P 
Sbjct  290  QKEPFFPERPDQPECQYYMKTGNCKFGSSCRYHHPPELIAPKTNVVLSPIGLPLRPGAPP  349

Query  446  CAFYSRYGICKFGPSCKFDHPMGVFTYNISPSSTTNAPTV  327
            C  Y++ G CKFGP+CKFDHPMG  +Y+ S SS  + P  
Sbjct  350  CTHYTQRGQCKFGPACKFDHPMGTLSYSPSASSLADMPVA  389


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  611  FPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspiglpLRPGEPLCAFYS  432
            FPER GQP CQ+YM+TG CKFGA CK+H+P++         L+  G PLRPGE  C +Y 
Sbjct  90   FPERVGQPVCQYYMRTGTCKFGASCKYHHPKQEGGSVSPVSLNYYGYPLRPGEKECTYYV  149

Query  431  RYGICKFGPSCKFDHPM  381
            + G CKFG +CKF HP 
Sbjct  150  KTGQCKFGATCKFHHPQ  166


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -2

Query  656  GTLPMGYYALQRENVFPERPGQPECQFYMKTGDCKFGAVCKFHYPRERlipppdsllspi  477
            G  P+G    + E+ +PERP +  C +Y++TG C +GA C+F++PR+R      +     
Sbjct  31   GVWPLGL--GEGESGYPERPDEANCIYYLRTGFCGYGARCRFNHPRDRGAVIGAARAGAG  88

Query  476  glpLRPGEPLCAFYSRYGICKFGPSCKFDHP  384
              P R G+P+C +Y R G CKFG SCK+ HP
Sbjct  89   EFPERVGQPVCQYYMRTGTCKFGASCKYHHP  119



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365