BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012J17

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      379   8e-128   Populus euphratica
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             378   1e-127   
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      374   3e-126   Vitis vinifera
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         371   5e-125   Jatropha curcas
emb|CAN65776.1|  hypothetical protein VITISV_030414                     369   7e-124   Vitis vinifera
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      367   2e-123   Prunus mume [ume]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        364   4e-122   Tarenaya hassleriana [spider flower]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             364   5e-122   Prunus persica
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      362   1e-121   Nelumbo nucifera [Indian lotus]
ref|XP_002519426.1|  o-methyltransferase, putative                      362   2e-121   Ricinus communis
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    362   2e-121   Pyrus x bretschneideri [bai li]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    362   3e-121   Pyrus x bretschneideri [bai li]
gb|KJB62320.1|  hypothetical protein B456_009G411600                    362   3e-121   Gossypium raimondii
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             360   1e-120   Capsella rubella
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      357   2e-120   
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        360   3e-120   Nicotiana tomentosiformis
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    359   4e-120   Glycine max [soybeans]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      358   4e-120   Glycine soja [wild soybean]
emb|CDX95399.1|  BnaC04g27590D                                          358   9e-120   
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    359   1e-119   Camelina sativa [gold-of-pleasure]
emb|CDY70033.1|  BnaCnng66420D                                          353   1e-119   Brassica napus [oilseed rape]
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      358   1e-119   Fragaria vesca subsp. vesca
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    357   2e-119   Camelina sativa [gold-of-pleasure]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             357   2e-119   Eutrema salsugineum [saltwater cress]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      357   3e-119   Gossypium arboreum [tree cotton]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    356   4e-119   Camelina sativa [gold-of-pleasure]
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      356   4e-119   Brassica rapa
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 356   5e-119   Morus notabilis
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    355   1e-118   Eucalyptus grandis [rose gum]
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     352   2e-118   Eucalyptus grandis [rose gum]
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     354   2e-118   Eucalyptus grandis [rose gum]
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              354   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    353   4e-118   
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    354   4e-118   Solanum lycopersicum
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             353   8e-118   Eutrema salsugineum [saltwater cress]
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    352   1e-117   Solanum tuberosum [potatoes]
ref|XP_007027514.1|  O-methyltransferase family protein                 351   4e-117   
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    350   1e-116   Arabis alpina [alpine rockcress]
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             344   2e-114   Phaseolus vulgaris [French bean]
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    342   1e-113   Cicer arietinum [garbanzo]
gb|KEH38506.1|  caffeic acid O-methyltransferase                        342   2e-113   Medicago truncatula
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    338   4e-112   Sesamum indicum [beniseed]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       337   1e-111   Cucumis sativus [cucumbers]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      336   7e-111   Cucumis melo [Oriental melon]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      332   3e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    333   4e-109   
gb|KJB62323.1|  hypothetical protein B456_009G411600                    327   1e-107   Gossypium raimondii
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   320   2e-106   Citrus sinensis [apfelsine]
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             321   8e-106   Citrus clementina [clementine]
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    318   3e-104   Citrus sinensis [apfelsine]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             316   4e-104   
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    312   1e-101   Solanum tuberosum [potatoes]
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             304   2e-100   Citrus clementina [clementine]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   304   3e-100   Citrus sinensis [apfelsine]
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    309   6e-100   Elaeis guineensis
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    306   1e-99    Sesamum indicum [beniseed]
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      305   8e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    294   2e-96    Limonium latifolium
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             295   8e-96    
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    297   9e-96    Limonium latifolium
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          296   4e-95    Sorghum bicolor [broomcorn]
ref|NP_001048569.1|  Os02g0823400                                       295   6e-95    
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             289   8e-95    
gb|ACN25427.1|  unknown                                                 293   2e-94    Zea mays [maize]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    292   3e-94    Setaria italica
dbj|BAJ96291.1|  predicted protein                                      293   5e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   290   8e-94    Citrus sinensis [apfelsine]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      291   1e-93    Brachypodium distachyon [annual false brome]
ref|NP_001149617.1|  LOC100283243                                       291   2e-93    
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    290   3e-93    
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   281   2e-90    Citrus sinensis [apfelsine]
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    277   3e-90    Limonium latifolium
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    281   3e-90    
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    282   5e-90    Cicer arietinum [garbanzo]
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        276   6e-88    Medicago sativa subsp. x varia
gb|AES72848.2|  caffeic acid O-methyltransferase                        273   8e-87    Medicago truncatula
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 273   1e-86    Medicago truncatula
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 273   2e-86    
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             259   5e-82    
emb|CBI30187.3|  unnamed protein product                                253   1e-81    Vitis vinifera
gb|EEC74273.1|  hypothetical protein OsI_09508                          251   6e-78    Oryza sativa Indica Group [Indian rice]
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    238   5e-75    Limonium latifolium
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    230   3e-72    Limonium latifolium
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    231   3e-71    
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          229   2e-69    Amborella trichopoda
ref|XP_006381360.1|  hypothetical protein POPTR_0006s12160g             210   3e-63    
ref|XP_009787879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    202   5e-62    Nicotiana sylvestris
ref|XP_008361606.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    206   3e-61    
ref|XP_008361604.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    206   3e-61    
gb|KDO54338.1|  hypothetical protein CISIN_1g032721mg                   200   6e-61    Citrus sinensis [apfelsine]
ref|XP_006428524.1|  hypothetical protein CICLE_v10013655mg             202   3e-60    
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    201   1e-58    Elaeis guineensis
gb|KJB23958.1|  hypothetical protein B456_004G125600                    200   1e-58    Gossypium raimondii
gb|ABI54118.1|  caffeic acid O-methyltransferase                        201   1e-58    Malus domestica [apple tree]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    201   2e-58    Malus domestica [apple tree]
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   2e-58    
gb|KJB23954.1|  hypothetical protein B456_004G125600                    201   3e-58    Gossypium raimondii
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      200   3e-58    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        199   4e-58    Chrysosplenium americanum [water-carpet]
gb|KJB62324.1|  hypothetical protein B456_009G411600                    197   4e-58    Gossypium raimondii
gb|ADN27527.1|  caffeic acid O-methyltransferase                        200   5e-58    Camellia sinensis [black tea]
gb|AGO50639.1|  caffeic acid O-methyltransferase                        199   6e-58    Linum usitatissimum
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   199   7e-58    Selaginella moellendorffii
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   199   7e-58    Selaginella moellendorffii
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      199   7e-58    Gossypium arboreum [tree cotton]
gb|AGS49204.1|  O-methyltransferase                                     199   8e-58    Zea mays [maize]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      199   1e-57    Beta vulgaris subsp. vulgaris [field beet]
gb|ABI54117.1|  caffeic acid O-methyltransferase                        199   1e-57    Malus domestica [apple tree]
gb|AGS49202.1|  O-methyltransferase                                     199   1e-57    Zea mays [maize]
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      199   1e-57    Gossypium hirsutum [American cotton]
gb|AGS49209.1|  O-methyltransferase                                     198   1e-57    Zea mays [maize]
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    194   2e-57    Populus trichocarpa [western balsam poplar]
gb|AID68566.1|  caffeic O-methyltransferase                             198   2e-57    Punica granatum [granado]
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             198   2e-57    
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   2e-57    
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    198   2e-57    Citrus sinensis [apfelsine]
gb|AHM25237.1|  noraucuparin O-methyltransferase                        198   2e-57    Sorbus aucuparia [European mountain ash]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               198   2e-57    Betula pendula [white birch]
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    200   2e-57    
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    194   2e-57    Populus trichocarpa [western balsam poplar]
gb|AIJ28474.1|  O-methyltransferase                                     198   2e-57    Vaccinium corymbosum [American blueberry]
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    193   2e-57    Populus trichocarpa [western balsam poplar]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase               198   2e-57    Citrus aurantium [bitter orange]
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      198   2e-57    Betula platyphylla [Asian white birch]
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   3e-57    Cucumis sativus [cucumbers]
emb|CBI23095.3|  unnamed protein product                                194   3e-57    Vitis vinifera
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   4e-57    Phoenix dactylifera
gb|AGS49206.1|  O-methyltransferase                                     197   4e-57    Zea mays [maize]
gb|AAQ24337.1|  O-methyltransferase                                     197   4e-57    Zea mays [maize]
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    197   4e-57    
gb|AGS49190.1|  O-methyltransferase                                     197   4e-57    Zea mays [maize]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         197   4e-57    Jatropha curcas
gb|ABI54119.1|  caffeic acid O-methyltransferase                        197   5e-57    Malus domestica [apple tree]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    197   5e-57    Cucumis melo [Oriental melon]
ref|XP_002525818.1|  o-methyltransferase, putative                      197   5e-57    Ricinus communis
gb|AAQ24338.1|  O-methyltransferase                                     197   5e-57    Zea mays [maize]
gb|ABI54120.1|  caffeic acid O-methyltransferase                        197   5e-57    Malus domestica [apple tree]
gb|ACT87981.1|  caffeic acid O-methyltransferase                        197   5e-57    Jatropha curcas
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    197   6e-57    Elaeis guineensis
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      197   6e-57    Prunus mume [ume]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      197   6e-57    Glycine soja [wild soybean]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             197   6e-57    Prunus persica
gb|AIY22648.1|  caffeic acid 3-O-methyl transferase                     192   7e-57    Saccharum arundinaceum
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    197   7e-57    Prunus dulcis [sweet almond]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    196   8e-57    Musa acuminata subsp. malaccensis [pisang utan]
gb|AGS49196.1|  O-methyltransferase                                     196   9e-57    Zea mays [maize]
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               196   9e-57    Hibiscus cannabinus [bimli-jute]
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg             190   1e-56    
gb|AGS49210.1|  O-methyltransferase                                     196   1e-56    Zea mays [maize]
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    192   1e-56    
gb|AAQ24339.1|  O-methyltransferase                                     196   1e-56    Zea mays [maize]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    196   1e-56    Populus sieboldii x Populus grandidentata
gb|AAQ24345.1|  O-methyltransferase                                     196   1e-56    Zea mays [maize]
gb|KDO38695.1|  hypothetical protein CISIN_1g037818mg                   191   1e-56    Citrus sinensis [apfelsine]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    196   2e-56    Rosa chinensis [China rose]
gb|ABG27066.1|  caffeic acid O-methyltransferase                        196   2e-56    Boehmeria nivea [Chinese silk-plant]
gb|ABS57468.1|  caffeic acid O-methyl transferase                       196   2e-56    Leucaena leucocephala [cassie]
gb|AIY22649.1|  caffeic acid 3-O-methyl transferase                     191   2e-56    Saccharum arundinaceum
gb|AFK40372.1|  unknown                                                 195   2e-56    Lotus japonicus
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      195   3e-56    Vitis vinifera
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             195   3e-56    Phaseolus vulgaris [French bean]
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      195   3e-56    
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    191   3e-56    
gb|AGS49197.1|  O-methyltransferase                                     195   4e-56    Zea mays [maize]
gb|AEW26161.1|  caffeic acid-O-methyltransferase                        191   4e-56    Medicago sativa subsp. x varia
gb|AAQ24355.1|  O-methyltransferase                                     194   4e-56    Zea mays [maize]
gb|AGS49189.1|  O-methyltransferase                                     194   5e-56    Zea mays [maize]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    194   5e-56    Glycine max [soybeans]
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        194   5e-56    Populus tomentosa [Chinese white poplar]
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                      194   5e-56    Zea nicaraguensis
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...    194   5e-56    Zea mays [maize]
gb|AGS49187.1|  O-methyltransferase                                     194   6e-56    Zea mays [maize]
gb|AGS49185.1|  O-methyltransferase                                     194   6e-56    Zea mays [maize]
ref|NP_001106047.1|  catechol O-methyltransferase                       194   6e-56    Zea mays [maize]
gb|AGS49215.1|  O-methyltransferase                                     194   6e-56    Zea mays [maize]
gb|AGS49205.1|  O-methyltransferase                                     194   6e-56    Zea mays [maize]
gb|AGS49191.1|  O-methyltransferase                                     194   6e-56    Zea mays [maize]
ref|XP_006594705.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    192   6e-56    Glycine max [soybeans]
gb|AEW26209.1|  caffeic acid-O-methyltransferase                        190   6e-56    Medicago sativa subsp. caerulea
gb|AGS49195.1|  O-methyltransferase                                     194   7e-56    Zea mays [maize]
gb|AGS49216.1|  O-methyltransferase                                     194   7e-56    Zea mays [maize]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    194   7e-56    Populus tremuloides
gb|EMT14045.1|  Caffeic acid 3-O-methyltransferase                      189   7e-56    
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...    194   8e-56    Vitis vinifera
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    194   8e-56    Cicer arietinum [garbanzo]
gb|AEW26163.1|  caffeic acid-O-methyltransferase                        190   8e-56    Medicago sativa subsp. x varia
ref|XP_002317838.1|  Chain A family protein                             194   9e-56    Populus trichocarpa [western balsam poplar]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    194   9e-56    Glycine max [soybeans]
gb|AAY86361.1|  caffeic acid O-methyltransferase                        194   9e-56    Acacia auriculiformis x Acacia mangium
ref|NP_001240003.1|  uncharacterized protein LOC100780100               194   1e-55    Glycine max [soybeans]
gb|AGS49181.1|  O-methyltransferase                                     193   1e-55    Zea mays [maize]
gb|AEV93478.1|  caffeic acid O-methyltransferase                        193   1e-55    Caragana korshinskii
ref|NP_001268100.1|  caffeic acid O-methyltransferase                   194   1e-55    Vitis vinifera
gb|AGS49199.1|  O-methyltransferase                                     193   1e-55    Zea mays [maize]
gb|ADB82906.1|  caffeic O-methyltransferase1                            193   1e-55    Eucalyptus camaldulensis
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    193   2e-55    Citrus sinensis [apfelsine]
gb|AAQ24342.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AAQ24344.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AGS49211.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|ACY66932.1|  caffeic O-methyltransferase 1                           193   2e-55    Eucalyptus camaldulensis
gb|AAQ24343.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
ref|NP_001242325.1|  uncharacterized protein LOC100805999               193   2e-55    
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      193   2e-55    Eucalyptus grandis [rose gum]
gb|AAQ24351.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AAQ24361.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AGS49219.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AEO14871.1|  caffeic acid O-methyltransferase                        193   2e-55    Salvia miltiorrhiza [Chinese salvia]
gb|AAQ24348.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|AGS49214.1|  O-methyltransferase                                     193   2e-55    Zea mays [maize]
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                      192   2e-55    
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    192   3e-55    Chrysosplenium americanum [water-carpet]
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg             192   3e-55    Citrus clementina [clementine]
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      192   3e-55    Nicotiana sylvestris
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      193   3e-55    Gossypium arboreum [tree cotton]
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                  192   3e-55    Liquidambar styraciflua [American sweet gum]
gb|AGS49183.1|  O-methyltransferase                                     192   3e-55    Zea mays [maize]
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    192   3e-55    Elaeis guineensis
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg                189   3e-55    Erythranthe guttata [common monkey flower]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       192   4e-55    Rosa chinensis var. spontanea
gb|AGS49184.1|  O-methyltransferase                                     192   4e-55    Zea mays [maize]
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             192   4e-55    Citrus clementina [clementine]
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase      192   4e-55    Eucalyptus grandis [rose gum]
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               192   4e-55    
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                     192   4e-55    Eucalyptus grandis [rose gum]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      192   5e-55    Fragaria vesca subsp. vesca
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             191   5e-55    Citrus clementina [clementine]
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    192   5e-55    Eucalyptus gunnii
gb|AGS49200.1|  O-methyltransferase                                     192   5e-55    Zea mays [maize]
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    191   5e-55    Chrysosplenium americanum [water-carpet]
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 192   5e-55    Pyrus x bretschneideri [bai li]
prf||1906376A  O-methyltransferase                                      192   5e-55 
gb|AEO14870.1|  caffeic acid O-methyltransferase                        192   6e-55    Salvia miltiorrhiza [Chinese salvia]
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase           191   6e-55    Carthamus tinctorius
gb|AAF60951.1|  O-methyltransferase                                     192   6e-55    Populus trichocarpa x Populus deltoides
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    192   6e-55    Populus euphratica
gb|AAF28353.1|AF220491_1  O-methyltransferase                           192   7e-55    Fragaria x ananassa
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    191   7e-55    Populus euphratica
gb|AGS49207.1|  O-methyltransferase                                     191   7e-55    Zea mays [maize]
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                      191   7e-55    Saccharum hybrid cultivar [sugarcane]
gb|AGS49188.1|  O-methyltransferase                                     191   7e-55    Zea mays [maize]
gb|AGS49217.1|  O-methyltransferase                                     191   7e-55    Zea mays [maize]
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 191   7e-55    Anthriscus sylvestris
gb|AGS49213.1|  O-methyltransferase                                     191   8e-55    Zea mays [maize]
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    186   8e-55    Populus trichocarpa [western balsam poplar]
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                      191   8e-55    Panicum virgatum
gb|AGS49198.1|  O-methyltransferase                                     191   9e-55    Zea mays [maize]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     193   1e-54    Eucalyptus grandis [rose gum]
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      191   1e-54    Populus deltoides
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    191   1e-54    Medicago sativa [alfalfa]
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    191   1e-54    Medicago sativa [alfalfa]
gb|AEW26176.1|  caffeic acid-O-methyltransferase                        187   1e-54    Medicago sativa subsp. x varia
gb|AGS49186.1|  O-methyltransferase                                     191   1e-54    Zea mays [maize]
emb|CDX76223.1|  BnaA04g04870D                                          188   1e-54    
ref|XP_002864309.1|  O-methyltransferase 1                              191   1e-54    
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                  191   1e-54    
gb|AFM73597.1|  caffeate O-methyltransferase                            189   1e-54    Populus simonii
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    191   1e-54    Setaria italica
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          191   1e-54    Amborella trichopoda
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...    191   1e-54    Saccharum officinarum [noble cane]
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      191   1e-54    Miscanthus sinensis
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    191   2e-54    Malus domestica [apple tree]
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like      191   2e-54    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    186   2e-54    
gb|KJB52492.1|  hypothetical protein B456_008G264900                    191   2e-54    Gossypium raimondii
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    190   2e-54    Arabis alpina [alpine rockcress]
gb|AGS49194.1|  O-methyltransferase                                     190   2e-54    Zea mays [maize]
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    190   2e-54    Ocimum basilicum [basil]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        190   3e-54    Tarenaya hassleriana [spider flower]
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    190   3e-54    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    190   3e-54    Populus trichocarpa [western balsam poplar]
gb|AGS49182.1|  O-methyltransferase                                     190   3e-54    Zea mays [maize]
ref|XP_002321948.1|  Chain A family protein                             190   3e-54    Populus trichocarpa [western balsam poplar]
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     190   3e-54    Ipomoea nil [qian niu]
emb|CDY19037.1|  BnaC01g20310D                                          190   3e-54    Brassica napus [oilseed rape]
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        189   4e-54    Camelina sativa [gold-of-pleasure]
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase              189   4e-54    Capsicum annuum
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    190   4e-54    Malus domestica [apple tree]
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    189   4e-54    Arabidopsis thaliana [mouse-ear cress]
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         189   4e-54    Jatropha curcas
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   189   4e-54    
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    189   4e-54    
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             189   5e-54    
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      189   5e-54    
ref|XP_003559686.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    189   5e-54    
gb|AAN03726.1|  caffeic acid O-methyltransferase                        189   5e-54    
gb|AFK39235.1|  unknown                                                 189   6e-54    
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    189   6e-54    
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    189   6e-54    
ref|XP_010478733.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    189   7e-54    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    189   7e-54    
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      189   8e-54    
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     189   8e-54    
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      189   1e-53    
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    188   1e-53    
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                       188   1e-53    
dbj|BAK42963.1|  caffeic acid O-methylltransferase                      188   1e-53    
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         188   1e-53    
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    188   1e-53    
gb|AFK39562.1|  unknown                                                 188   1e-53    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    188   2e-53    
gb|AAB96879.1|  O-methyltransferase 1                                   188   2e-53    
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...    189   2e-53    
emb|CAA52462.1|  catechol O-methyltransferase                           188   2e-53    
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg             187   2e-53    
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   187   2e-53    
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   2e-53    
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    189   2e-53    
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   2e-53    
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   2e-53    
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase      187   3e-53    
gb|AGS49208.1|  O-methyltransferase                                     187   3e-53    
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    187   3e-53    
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg             187   3e-53    
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    187   3e-53    
ref|XP_002864307.1|  O-methyltransferase 1                              187   3e-53    
gb|AFZ78574.1|  caffeic acid O-methyltransferase                        187   3e-53    
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase      187   4e-53    
dbj|BAJ34520.1|  unnamed protein product                                187   4e-53    
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    187   4e-53    
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...    186   5e-53    
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg             187   5e-53    
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   5e-53    
gb|ADO16247.1|  caffeic acid O-methyltransferase                        186   5e-53    
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    186   5e-53    
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    187   6e-53    
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    186   6e-53    
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    186   6e-53    
ref|XP_009388361.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    186   7e-53    
emb|CDY18306.1|  BnaC09g30560D                                          186   7e-53    
gb|AGS49203.1|  O-methyltransferase                                     186   7e-53    
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             186   8e-53    
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    186   9e-53    
gb|AGS49192.1|  O-methyltransferase                                     186   1e-52    
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    185   1e-52    
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    185   1e-52    
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg             185   1e-52    
ref|XP_009384339.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    186   1e-52    
emb|CAA52461.1|  catechol O-methyltransferase                           186   1e-52    
ref|XP_011084579.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    185   1e-52    
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    185   2e-52    
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    185   2e-52    
gb|AAK68907.1|  caffeic acid O-methyltransferase                        184   3e-52    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      185   3e-52    
gb|KDP32878.1|  hypothetical protein JCGZ_12170                         184   3e-52    
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    184   3e-52    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    184   3e-52    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              184   3e-52    
gb|ADR31594.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    180   4e-52    
emb|CDY43839.1|  BnaC03g14720D                                          184   4e-52    
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   4e-52    
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                      180   4e-52    
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        184   5e-52    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    184   5e-52    
gb|AAC18623.1|  bispecific caffeic acid/5-hydroxyferulic acid O-m...    184   5e-52    
emb|CDP20700.1|  unnamed protein product                                184   5e-52    
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   6e-52    
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    184   6e-52    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    184   6e-52    
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase                184   6e-52    
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         184   6e-52    
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   6e-52    
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    184   6e-52    
gb|AAK68910.1|  caffeic acid O-methyltransferase                        184   6e-52    
gb|AGS49201.1|  O-methyltransferase                                     184   7e-52    
gb|AFO69477.1|  caffeic acid O-methyltransferase                        184   7e-52    
ref|XP_009398124.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    183   8e-52    
gb|AAO43609.1|  caffeic acid O-methyltransferase                        183   8e-52    
ref|XP_009802353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    183   8e-52    
ref|XP_010461123.1|  PREDICTED: quercetin 3-O-methyltransferase 1       183   9e-52    
ref|XP_002893750.1|  O-methyltransferase family 2 protein               183   9e-52    
gb|AAQ01670.1|  catechol O-methyltransferase                            183   9e-52    
gb|AJK93384.1|  caffeic acid O-methyltransferase                        183   9e-52    
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase      183   1e-51    
gb|AFK45226.1|  unknown                                                 183   1e-51    
gb|ABI54121.1|  caffeic acid O-methyltransferase                        179   1e-51    
gb|ACI42878.1|  caffeic acid ortho-methyltransferase                    182   1e-51    
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    183   1e-51    
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    183   1e-51    
gb|AAL57301.1|AF387790_1  O-methyltransferase                           183   1e-51    
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    183   1e-51    
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860          183   1e-51    
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    182   2e-51    
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                      182   2e-51    
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...    182   2e-51    
emb|CDM87233.1|  unnamed protein product                                182   2e-51    
gb|AAK68908.1|  caffeic acid O-methyltransferase                        182   2e-51    
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...    182   2e-51    
emb|CDY18302.1|  BnaC09g30520D                                          177   2e-51    
ref|XP_006305218.1|  hypothetical protein CARUB_v10009584mg             182   2e-51    
gb|AFX98069.1|  caffeic acid O-methyltransferase                        182   3e-51    
gb|EAY85717.1|  hypothetical protein OsI_07085                          182   3e-51    
gb|KHN06374.1|  Anthranilate N-methyltransferase                        182   3e-51    
gb|AAD10253.1|  caffeic acid O-methyltransferase                        182   4e-51    
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg                181   4e-51    
pdb|3P9C|A  Chain A, Crystal Structure Of Perennial Ryegrass Lpom...    181   5e-51    
gb|AAK68909.1|  caffeic acid O-methyltransferase                        181   5e-51    
ref|XP_003621331.1|  Isoliquiritigenin 2'-O-methyltransferase           181   5e-51    
ref|XP_009387259.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    181   6e-51    
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    181   6e-51    
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    181   6e-51    
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  181   6e-51    
emb|CDY29856.1|  BnaA03g48770D                                          181   7e-51    
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  181   7e-51    
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...    181   7e-51    
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...    181   7e-51    
gb|AAD10255.1|  caffeic acid O-methyltransferase                        181   7e-51    
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029             181   7e-51    
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    181   7e-51    
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    181   8e-51    
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                      181   8e-51    
ref|XP_002518944.1|  o-methyltransferase, putative                      178   8e-51    
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    181   8e-51    
ref|XP_009384757.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    181   1e-50    
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg             181   1e-50    
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg             181   1e-50    
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                      180   1e-50    
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  180   1e-50    
dbj|BAM05579.1|  caffeic acid O-methyltransferase 1                     179   1e-50    
gb|AFD53036.1|  caffeic acid-O-methyltransferase                        180   2e-50    
ref|XP_003528760.1|  PREDICTED: anthranilate N-methyltransferase        180   2e-50    
sp|Q6T1F5.1|COMT1_AMMMJ  RecName: Full=Caffeic acid 3-O-methyltra...    180   2e-50    
dbj|BAO31651.1|  O-methyltransferase                                    179   2e-50    
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...    179   2e-50    
emb|CDM85533.1|  unnamed protein product                                180   2e-50    
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase                 180   3e-50    
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     179   3e-50    
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    179   3e-50    
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747             179   3e-50    
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    179   4e-50    
gb|AIN36846.1|  myricetin 3'-O-methyltransferase 4                      179   5e-50    
gb|AAD29845.1|AF064697_1  O-methyltransferase                           179   5e-50    
gb|ABK25932.1|  unknown                                                 178   6e-50    
ref|NP_174579.1|  O-methyltransferase-like protein                      178   6e-50    
gb|AFK42771.1|  unknown                                                 179   6e-50    
ref|XP_004148286.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    179   7e-50    
ref|XP_006415131.1|  hypothetical protein EUTSA_v10008040mg             178   7e-50    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    178   7e-50    
emb|CDX92835.1|  BnaC07g40930D                                          178   7e-50    
gb|AJK93385.1|  caffeic acid O-methyltransferase                        178   7e-50    
gb|KEH20132.1|  caffeic acid O-methyltransferase                        179   8e-50    
gb|ACJ84475.1|  unknown                                                 178   9e-50    
gb|AFK48989.1|  unknown                                                 178   9e-50    
dbj|BAM05581.1|  caffeic acid O-methyltransferase 1                     177   1e-49    
ref|XP_011097031.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   1e-49    
gb|KDP32876.1|  hypothetical protein JCGZ_12168                         178   1e-49    
gb|AFK44249.1|  unknown                                                 178   2e-49    
sp|Q9SWC2.1|COMT1_EUCGL  RecName: Full=Caffeic acid 3-O-methyltra...    176   2e-49    
emb|CBI19007.3|  unnamed protein product                                176   2e-49    
emb|CDX84055.1|  BnaC08g07320D                                          177   2e-49    
gb|KFK45045.1|  hypothetical protein AALP_AA1G337000                    177   2e-49    
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase                 177   2e-49    
ref|XP_006413045.1|  hypothetical protein EUTSA_v10025522mg             177   2e-49    
ref|XP_007135330.1|  hypothetical protein PHAVU_010G120200g             177   2e-49    
gb|ABP93669.1|  O-methyltransferase 3                                   177   2e-49    
ref|XP_009384375.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   2e-49    
gb|AFK41218.1|  unknown                                                 177   2e-49    
gb|AET00984.2|  caffeic acid O-methyltransferase                        177   3e-49    
gb|KDO42947.1|  hypothetical protein CISIN_1g030025mg                   172   3e-49    
ref|XP_009420747.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   3e-49    
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   3e-49    
emb|CAI30878.1|  caffeate O-methyltransferase                           177   3e-49    
ref|XP_003598824.1|  O-methyltransferase                                177   3e-49    
gb|AAL91506.1|AF484252_1  caffeic acid O-methyltransferase II           177   3e-49    
gb|ABO41852.1|  putative caffeic acid methyltransferase                 177   3e-49    
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     177   3e-49    
ref|XP_009107965.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    176   3e-49    
gb|EPS67212.1|  hypothetical protein M569_07558                         177   3e-49    
gb|ABK22490.1|  unknown                                                 177   3e-49    
gb|AAZ32409.1|  S-methyltransferase                                     176   4e-49    
ref|XP_003634428.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   4e-49    
ref|XP_003626617.1|  Caffeic acid 3-O-methyltransferase                 176   4e-49    
ref|XP_009784058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   4e-49    
gb|ACD56610.1|  putative caffeic acid protein                           176   4e-49    
ref|XP_007139027.1|  hypothetical protein PHAVU_009G258800g             176   4e-49    
emb|CAN76660.1|  hypothetical protein VITISV_032827                     177   4e-49    
sp|Q6T1F6.1|BMT_AMMMJ  RecName: Full=Bergaptol O-methyltransferas...    176   4e-49    
gb|ABR18103.1|  unknown                                                 176   4e-49    
ref|XP_007139032.1|  hypothetical protein PHAVU_009G259300g             177   5e-49    
ref|XP_007139030.1|  hypothetical protein PHAVU_009G259100g             176   5e-49    
gb|AFK35470.1|  unknown                                                 176   5e-49    
dbj|BAJ95117.1|  predicted protein                                      176   6e-49    
ref|XP_007015113.1|  Caffeic acid 3-O-methyltransferase 1 isoform 1     177   6e-49    
gb|AAD29843.1|AF064695_1  catechol O-methyltransferase                  176   6e-49    
emb|CAN69214.1|  hypothetical protein VITISV_033821                     176   8e-49    
ref|XP_009597864.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   8e-49    
gb|ABK23795.1|  unknown                                                 176   9e-49    
gb|ABR18380.1|  unknown                                                 176   9e-49    
gb|ABO41845.1|  putative caffeic acid methyltransferase                 175   9e-49    
prf||2119166A  caffeic acid O-methyltransferase                         175   1e-48 
dbj|BAM05580.1|  caffeic acid O-methyltransferase 1                     174   1e-48    
gb|KFK29300.1|  hypothetical protein AALP_AA7G115400                    175   1e-48    
ref|XP_002443937.1|  hypothetical protein SORBIDRAFT_07g004690          175   1e-48    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg             176   1e-48    
ref|XP_007139029.1|  hypothetical protein PHAVU_009G259000g             175   2e-48    
gb|ABK21417.1|  unknown                                                 175   2e-48    
gb|ABO41834.1|  putative caffeic acid methyltransferase                 174   2e-48    
ref|XP_007032646.1|  Caffeic acid 3-O-methyltransferase 1               175   2e-48    
gb|ABO41840.1|  putative caffeic acid methyltransferase                 174   2e-48    
ref|XP_007019090.1|  Caffeic acid 3-O-methyltransferase 1               174   2e-48    
ref|XP_004248417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    174   2e-48    



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   379 bits (972),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSVPFM+A LDGY GF+GV RLVDVGGSA
Sbjct  151  EPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPFMEAMLDGYDGFKGVERLVDVGGSA  210

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP + QGINFDLPEVV KAP IPG+T+VGGDMFKSIP+GDAIFMKW+LTT
Sbjct  211  GDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVTNVGGDMFKSIPDGDAIFMKWILTT  270

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK IM +CY ALP GGKLVACEPVLP  +DD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  271  WTDNECKLIMENCYKALPMGGKLVACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTKGKH  330

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  331  RTEEEFKQLGQSVGFSHFRAFYVDYFYTVLEFQK  364



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   378 bits (971),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSVPFM+A LDGY GF+GV RLVDVGGSA
Sbjct  151  EPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPFMEAMLDGYDGFKGVERLVDVGGSA  210

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP + QGINFDLPEVV KAP IPG+T+VGGDMFKSIP+GDAIFMKW+LTT
Sbjct  211  GDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVTNVGGDMFKSIPDGDAIFMKWILTT  270

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  271  WTDNECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRAKGKH  330

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  331  RTEEEFKQLGQSVGFSYFRAFYVDYFYTVLEFQK  364



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   374 bits (961),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 192/214 (90%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAYSYYGKKPEMN LM +AMSGVSVPFMKA L+GY+GF+GV RLVDVGGSA
Sbjct  145  EPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAILNGYNGFDGVQRLVDVGGSA  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+LTT
Sbjct  205  GDCLRMILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTT  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  265  WTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKH  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  325  RTEEEFRQLGLSAGFPHLRAFYIDHFYTVLEFQK  358



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   371 bits (953),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 193/214 (90%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKAN EPAY+YYGK+PEMNGLM KAMSGVSVPFMKA L+GY GF+G+ +LVDVGGSA
Sbjct  144  EPFVKANDEPAYAYYGKQPEMNGLMQKAMSGVSVPFMKAILNGYDGFQGMEKLVDVGGSA  203

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P+I +GINFDLPEVV KAPNIPG+THVGGDMFKSIP+ D IFMKW+LTT
Sbjct  204  GDCLRMILKKYPNIREGINFDLPEVVAKAPNIPGVTHVGGDMFKSIPSADGIFMKWVLTT  263

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP Q+DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  264  WTDEECKQIMENCYKALPVGGKLIACEPVLPKQSDDSHRTRALLEGDIFVMTIYRAKGKH  323

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT EE++ L +SVGFS F+AFY+D+FYTVLEF K
Sbjct  324  RTAEEFKLLGQSVGFSHFQAFYIDYFYTVLEFHK  357



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   369 bits (946),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAYSYYGKKPEMN LM +AMSGVSVPFMKA L+GY GF+GV RLVDVGGSA
Sbjct  145  EPFVKANGEPAYSYYGKKPEMNDLMQRAMSGVSVPFMKAILNGYSGFDGVQRLVDVGGSA  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH +I +GINFDLPEVV KAP IPG+THVGGDMFKS+P+GDAIFMKW+LTT
Sbjct  205  GDCLRMILQKHTNIKEGINFDLPEVVAKAPTIPGVTHVGGDMFKSVPDGDAIFMKWVLTT  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  265  WTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKH  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+RQL  S GF    AFY+D FYTVLEFQK
Sbjct  325  RTEEEFRQLGLSAGFPHLXAFYIDXFYTVLEFQK  358



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   367 bits (943),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGKKPEMNGLM +AMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  155  EPFVKANGEPAYEYYGKKPEMNGLMQRAMSGVSVPFMKAILDGYDGFEGVGRLVDVGGSA  214

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHPS+ +GINFDLPEVV KAP I G++HVGGDMFKSIP+GDAIFMKW+L+T
Sbjct  215  GDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPSGDAIFMKWVLST  274

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLE D+FVMTIYRAKGK+
Sbjct  275  WTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSSRTRALLENDVFVMTIYRAKGKN  334

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE RQL  S GFS FR  Y+D+FYT+LEFQK
Sbjct  335  RTEEELRQLGLSAGFSHFRPIYIDYFYTLLEFQK  368



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   364 bits (934),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 189/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGEPAY+ YGK  EMNGLML+AMSGVSVPFM+A LDGY GF+ V  LVDVGGSA
Sbjct  141  EPYVKANGEPAYAQYGKSEEMNGLMLRAMSGVSVPFMRAILDGYDGFKSVEHLVDVGGSA  200

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+ K P++ QGINFDLPEVV KAP IPG+THVGGDMFKSIP+GDAIFMKW+LTT
Sbjct  201  GDCLRMILRKFPNVRQGINFDLPEVVSKAPPIPGVTHVGGDMFKSIPSGDAIFMKWVLTT  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR+KGKH
Sbjct  261  WTDEECKQIMRNCYNALPPGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRSKGKH  320

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE++QL  + GFS FR FY+D+FYTVLEFQK
Sbjct  321  RTEEEFKQLGLASGFSLFRPFYIDYFYTVLEFQK  354



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   364 bits (934),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK NGEPAY YYGKKPEMNGLM +AMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  155  EPFVKVNGEPAYEYYGKKPEMNGLMQRAMSGVSVPFMKAILDGYDGFEGVGRLVDVGGSA  214

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHPS+ +GINFDLPEVV KAP I G++HVGGDMFKSIP+GDAIFMKW+L+T
Sbjct  215  GDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPSGDAIFMKWVLST  274

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLE DIFVMTIYRAKGK+
Sbjct  275  WTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDDSPRTRALLENDIFVMTIYRAKGKN  334

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+E RQL  S GFS F+  Y+D+FYTVLEFQK
Sbjct  335  RTEDELRQLGLSAGFSHFKPIYIDYFYTVLEFQK  368



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAYSYYG K EMN LM KAMSGVSVPFMKA L+GY+GF+GV RLVDVGGSA
Sbjct  141  EPFVKANGEPAYSYYGDKSEMNELMQKAMSGVSVPFMKAILEGYNGFKGVERLVDVGGSA  200

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+ KHP + +GINFDLPEVV KAPNIPG+THVGGDMF+SIP GDAIFMKW+LTT
Sbjct  201  GDCLRMILHKHPHVREGINFDLPEVVAKAPNIPGVTHVGGDMFESIPAGDAIFMKWVLTT  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGK++ACEPVLP ++D + RTR LLEGDIFVM IYRAKGKH
Sbjct  261  WTDDECKLIMRNCYEALPPGGKMIACEPVLPKESDRSHRTRALLEGDIFVMAIYRAKGKH  320

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE++QL  + GF  FRAFY+D FYTVLEFQK
Sbjct  321  RTEEEFKQLGLASGFPHFRAFYIDQFYTVLEFQK  354



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KANGEPAY YYGK+PEMN LM KAMSG+SVPFMKA L+GY GF+GV ++VDVGGSA
Sbjct  144  EPFAKANGEPAYDYYGKRPEMNELMQKAMSGLSVPFMKAVLNGYDGFQGVEKIVDVGGSA  203

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+ I++K+P++ +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+ DAIFMKW+LTT
Sbjct  204  GDCLKTILQKYPNVREGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPSADAIFMKWILTT  263

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP QTDD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  264  WTDDECKVIMENCYKALPVGGKLIACEPVLPNQTDDSHRTRALLEGDIFVMTIYRAKGKH  323

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  SVGFS FR  Y D F+TVLEFQK
Sbjct  324  RTEEEFKKLGHSVGFSHFRPLYFDHFHTVLEFQK  357



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   362 bits (930),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  156  EPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSA  215

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF KW+L+T
Sbjct  216  GDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFFKWILST  275

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAKGK+
Sbjct  276  WTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKN  335

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  336  RSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  369



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  159  EPFVKANGEPAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSA  218

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF KW+L+T
Sbjct  219  GDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFFKWILST  278

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAKGK+
Sbjct  279  WTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKN  338

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  339  RSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  372



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   362 bits (929),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 190/214 (89%), Gaps = 1/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM+A LDGY G +GV RLVDVGGSA
Sbjct  149  EPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSA  208

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P + +GINFDLPEVV KAP+IPG+THVGGDMF+SIP  DAIFMKW+LTT
Sbjct  209  GDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVTHVGGDMFESIPAADAIFMKWVLTT  267

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  268  WTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKH  327

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  328  RTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY  YGK  EMN LMLKAMSGVSVPFMKA L+GY GF+ V RLVDVGGSA
Sbjct  146  EPYVKANGEAAYVQYGKSEEMNSLMLKAMSGVSVPFMKAILEGYEGFKSVERLVDVGGSA  205

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++  P++ +GINFDLPEVV KAPNIPG++HVGGDMF+S+P+GDAIFMKW+LTT
Sbjct  206  GDCLRMILQHFPNVREGINFDLPEVVAKAPNIPGVSHVGGDMFQSVPSGDAIFMKWVLTT  265

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECKEIM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  266  WTDEECKEIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  325

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GF +FR FY+D+FYT+LEFQK
Sbjct  326  RTEEEFKELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   357 bits (916),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  71   EPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSA  130

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF+KW+L+T
Sbjct  131  GDCLRMILQKHPNVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFLKWILST  190

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK I+ +CY ALP+GGKL+ACEPVLP ++D++ RTR LLE DIFVMTIYRAKGK+
Sbjct  191  WTDSECKVILENCYKALPEGGKLIACEPVLPKKSDESHRTRALLENDIFVMTIYRAKGKN  250

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  251  RSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  284



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   360 bits (923),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KANGEPAY+YYGK+PEMN LML AMSGVSVPFMKA L+ Y GF+GV  LVDVGGS 
Sbjct  152  EPFAKANGEPAYNYYGKRPEMNNLMLNAMSGVSVPFMKAILESYEGFQGVKILVDVGGSG  211

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MI+EKH SI  GINFDLPEVV KAP IP I H+GGDMFK +P GDAIFMKW+LTT
Sbjct  212  GDCLKMILEKHQSIQLGINFDLPEVVGKAPKIPRINHIGGDMFKYVPKGDAIFMKWVLTT  271

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK+IM SCY ALP+ GKL+ACEPVLP  TDD++RTR LLEGDIFVMTIYRAKGKH
Sbjct  272  WTDDECKQIMKSCYNALPEKGKLIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKH  331

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+EYRQL RS GF+  R FY+D F+T+LEFQK
Sbjct  332  RTEDEYRQLGRSAGFADCRGFYIDHFFTILEFQK  365



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   359 bits (921),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF  ANGEPAY YY K+PEMN LM++AMSGVSVPFM+A L+GY GF+GV +LVDVGGS 
Sbjct  143  EPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAMLEGYDGFQGVEKLVDVGGSG  202

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP+I +GINFDLPEVV KAP IP +THVGGDMFKSIP GDAIFMKW+LTT
Sbjct  203  GDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVTHVGGDMFKSIPQGDAIFMKWVLTT  262

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK IM SC+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  263  WTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKH  322

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  323  RTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  356



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   358 bits (919),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF  ANGEPAY YY K+PEMN LM++AMSGVSVPFM+A L+GY GF+GV +LVDVGGS 
Sbjct  124  EPFEMANGEPAYGYYLKQPEMNDLMVRAMSGVSVPFMRAMLEGYDGFQGVEKLVDVGGSG  183

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KHP+I +GINFDLPEVV KAP IP +THVGGDMFKSIP GDAIFMKW+LTT
Sbjct  184  GDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVTHVGGDMFKSIPQGDAIFMKWVLTT  243

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK IM SC+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  244  WTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKH  303

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  304  RTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  337



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   358 bits (919),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  146  EPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSA  205

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+LTT
Sbjct  206  GDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWVLTT  265

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  266  WTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  325

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEEY++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  326  RTEEEYKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY  YGK  EMN LMLKAMSGVSVPFMKA L+GY GF+ V RLVDVGGSA
Sbjct  172  EPYVKANGEAAYVQYGKNEEMNDLMLKAMSGVSVPFMKAILEGYDGFKSVERLVDVGGSA  231

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G CLRMI+E+ P++ +GINFDLPEVV KAP+IPG+THVGGDMF+SIP+GDAIFMKW+LTT
Sbjct  232  GVCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVTHVGGDMFQSIPSGDAIFMKWVLTT  291

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  292  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  351

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  352  RTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  385



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  17   EPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSA  76

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+LTT
Sbjct  77   GDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWVLTT  136

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  137  WTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  196

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  197  RTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  230



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGK+PEMNGLM KAMSGVSVPF+KA LDGY GF+GVTRLVDVGGSA
Sbjct  145  EPFVKANGEPAYQYYGKRPEMNGLMQKAMSGVSVPFIKAVLDGYDGFQGVTRLVDVGGSA  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MIM+++P++ +GINFDLPEVV KAP I G+THVGGDMFKSIP+ D IFMKW+L+T
Sbjct  205  GDCLKMIMDRYPNVREGINFDLPEVVAKAPTIAGVTHVGGDMFKSIPSADVIFMKWILST  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D ECK I+ +CY ALP GGKL+ACEPV+P ++DD+ RTR LLE DIFVMTIYR KGK+
Sbjct  265  WTDCECKLILENCYKALPAGGKLIACEPVVPRKSDDSHRTRALLENDIFVMTIYRTKGKN  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE RQL  S GFS FR  Y+D+FYTVLEFQK
Sbjct  325  RTEEELRQLGHSAGFSHFRPIYIDYFYTVLEFQK  358



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKAN E AY  YGK  EMN LMLKAMSGVSVPFMKA L+GY GF+ V +L+DVGGSA
Sbjct  142  EPYVKANSEAAYVQYGKNEEMNDLMLKAMSGVSVPFMKAILEGYDGFKSVEQLIDVGGSA  201

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+E+ P++ +GINFDLPEVV KAP+IPG+THVGGDMF+SIP+GDAIFMKW+LTT
Sbjct  202  GDCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVTHVGGDMFQSIPSGDAIFMKWVLTT  261

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  262  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  321

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  322  RTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  355



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   357 bits (916),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AYS YGK  EMNGLM KAMSGVS PFMKA LDGY GF+ V  LVDVGGSA
Sbjct  148  EPYVKANGEAAYSQYGKCEEMNGLMQKAMSGVSAPFMKAILDGYDGFKSVEHLVDVGGSA  207

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+E+ P++ +GINFDL EVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+LTT
Sbjct  208  GDCLRMIIEQFPNVRRGINFDLLEVVAKAPKIPGVTHIGGDMFQSVPSGDAIFMKWVLTT  267

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  268  WTDEECKQIMKNCYNALPAGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  327

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  328  RTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  361



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   357 bits (915),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/214 (77%), Positives = 189/214 (88%), Gaps = 1/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM+A LDGY G +GV RLVDVGGSA
Sbjct  149  EPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSA  208

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P + +GINFDLPEVV KAP+IPG+T+VGGDM +SIP  DAIFMKW+LTT
Sbjct  209  GDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVTYVGGDMLESIPVADAIFMKWVLTT  267

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  268  WTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKH  327

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  328  RTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY  YGK  EMNGLMLKAMSGVSVPFMKA LDGY GF+ V RLVDVGGSA
Sbjct  143  EPYVKANGEGAYVQYGKNEEMNGLMLKAMSGVSVPFMKAILDGYDGFKSVERLVDVGGSA  202

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+E+ P++ +GINFDL EVV KAP IPG+ HVGGDMF+SIP G+AIFMKW+LTT
Sbjct  203  GDCLRMILEQFPNVREGINFDLHEVVAKAPTIPGVIHVGGDMFQSIPTGEAIFMKWVLTT  262

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  263  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  322

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  323  RTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  356



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  146  EPYVKANGEAAYAQYGKCEEMNGLMQKAMSGVSVPFMKAILDGYDGFKYVEHLVDVGGSA  205

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+++ P++ QGINFDLPEVV KAP IPG+TH+GGDMF+S+P+GDAIFMKW+LTT
Sbjct  206  GDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVTHMGGDMFQSVPSGDAIFMKWVLTT  265

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKLVACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  266  WTDEECKQIMKNCYKALPVGGKLVACEPVLPQETDDSHRTRALLEGDIFVMTIYRTKGKH  325

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  326  RTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   356 bits (914),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KANGEPAY YYGK PEMNGLM +AMSGVSVPFMKA L+GY GFEGV RLVDVGGSA
Sbjct  146  EPFAKANGEPAYKYYGKMPEMNGLMQRAMSGVSVPFMKAILNGYDGFEGVRRLVDVGGSA  205

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P++T+ INFDLPEVV +AP++PG+THVGGDMFK IP  DAIFMKW+LTT
Sbjct  206  GDCLRMILQKYPNVTEAINFDLPEVVARAPHVPGVTHVGGDMFKLIPEADAIFMKWILTT  265

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+EC+ IM SC  A+P GGKL+ACEPVLP +TDD+ RTR LL GDIFVMTIYRAKGKH
Sbjct  266  WTDDECQAIMESCCKAVPGGGKLIACEPVLPKETDDSHRTRALLSGDIFVMTIYRAKGKH  325

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+EYR+L  + GF  F+AFY+D+F+TVLEF K
Sbjct  326  RTEDEYRKLGLAAGFPHFQAFYIDYFHTVLEFTK  359



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY GF GV RLVDVGGSA
Sbjct  147  EPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSA  206

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+LTT
Sbjct  207  GDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWILTT  266

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  267  WTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKH  326

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  327  RTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  360



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY GF GV RLVDVGGSA
Sbjct  72   EPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSA  131

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+LTT
Sbjct  132  GDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWILTT  191

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  192  WTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKH  251

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  252  RTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  285



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 184/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANG+ AY++YGK PEMN LM +AMSGVSVPFMKA LDGY GF GV RLVDVGGSA
Sbjct  132  EPFVKANGDTAYAHYGKNPEMNKLMQRAMSGVSVPFMKAILDGYDGFSGVGRLVDVGGSA  191

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMIM KH  + +GINFDLPEVV KAP IPG+THVGGDMFKSIP GDAIFM+W+LTT
Sbjct  192  GDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVTHVGGDMFKSIPAGDAIFMRWILTT  251

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  252  WTDDECKQILENCFKALPAGGKLIACEPVLPQDSDDSHRTRALLEGDIFVMTIYRAKGKH  311

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  312  RTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  345



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   354 bits (908),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY+ YGK  EMNGLM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  146  EPYVKANGEAAYAQYGKSEEMNGLMQKAMSGVSVPFMKAILDGYDGFKSVDILVDVGGSA  205

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+++ P++ +GINFDLPEVV KAPNIPG+THVGGDMF+S+P+ DAIFMKW+LTT
Sbjct  206  GDCLRMILQQFPNVREGINFDLPEVVAKAPNIPGVTHVGGDMFQSVPSADAIFMKWVLTT  265

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TD++ RTR LLEGDIFVMTIYR KGKH
Sbjct  266  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDESHRTRALLEGDIFVMTIYRTKGKH  325

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+ +L  S GF +FR FY+D+FYT+LEFQK
Sbjct  326  RTEEEFIELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   353 bits (907),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF +ANGEPAY YY K PEMN LM++AMSGVSVPF++A L+GY GF+GV +LVDVGGS 
Sbjct  142  EPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAMLEGYDGFQGVEKLVDVGGSG  201

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+EKHP+I +GINFDLPEVV KAP IP +THVGGDMFK IP GDAIFMKW+LTT
Sbjct  202  GDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPFVTHVGGDMFKFIPQGDAIFMKWVLTT  261

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK IM +C+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  262  WTDEECKHIMQNCHKALPEGGKLIACEPVLPEDSDESHRTRALLEGDIFVMTIYRAKGKH  321

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  322  RTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  355



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   354 bits (908),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KANGEPAYSYYGK  EMN LML AMSGVSVPFMKA L GY GF+GV  LVDVGGS 
Sbjct  147  EPFAKANGEPAYSYYGKNSEMNSLMLNAMSGVSVPFMKAILQGYDGFQGVKTLVDVGGSG  206

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MI+EKH  I  GINFDLPEVV+KAP IP I HVGGDMF  IP GDAIFMKW+LTT
Sbjct  207  GDCLKMILEKHTDIELGINFDLPEVVEKAPQIPSIKHVGGDMFDYIPKGDAIFMKWVLTT  266

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD++RTR LLEGDIFVMTIYRAKGKH
Sbjct  267  WTDDECKEIMKSCYNALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKH  326

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  327  RTEEEYRQLGRAAGFNECKGFYIDHFFTILEFHK  360



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   353 bits (906),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP+VKANGE AY  YGK  EMNGLM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  150  EPYVKANGEAAYVQYGKCEEMNGLMQKAMSGVSVPFMKAILDGYDGFKSVEHLVDVGGSA  209

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+++ P++ +GINFDLPEVV KAP IPG+THVGGDMF S+P+GDAIFMKW+LTT
Sbjct  210  GDCLRMILKQFPNVREGINFDLPEVVAKAPKIPGVTHVGGDMFLSVPSGDAIFMKWVLTT  269

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEG+IFVMTIYR KGKH
Sbjct  270  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGNIFVMTIYRTKGKH  329

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GF SFR FY+D+FYT+LEFQK
Sbjct  330  RTEEEFKELGLSAGFPSFRPFYIDYFYTILEFQK  363



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/214 (75%), Positives = 181/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY+YYGK  EMN LML AMSGVSVPFMKA L+GY GF+GV  LVDVGGS 
Sbjct  147  EPFVKANGEPAYNYYGKNSEMNSLMLNAMSGVSVPFMKAILEGYDGFQGVKTLVDVGGSG  206

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MI++KH +I  GINFDLPEVV+KAP IP I HVGGDMF  IP GDAIFMKW+LTT
Sbjct  207  GDCLKMILDKHTNIELGINFDLPEVVEKAPQIPSIKHVGGDMFDYIPKGDAIFMKWVLTT  266

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD++RTR LLEGDIFVMTIYRAKGKH
Sbjct  267  WTDDECKEIMKSCYIALPEKGKFIACEPVLPHHTDDSKRTRALLEGDIFVMTIYRAKGKH  326

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  327  RTEEEYRQLGRAAGFNDCKGFYIDHFFTILEFHK  360



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   351 bits (901),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK NGE AYSYYGKKPEMNGLM KAMSGVSVPFM+A L+ Y GF+GV RLVDVGGS 
Sbjct  143  EPFVKVNGEAAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILNSYDGFKGVKRLVDVGGSV  202

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G+CLRMI++KHP + +GINFDLPEVV KAP IPG++HVGGDMFKSIP+GD IFMKW+L T
Sbjct  203  GECLRMILQKHPHVEEGINFDLPEVVAKAPTIPGVSHVGGDMFKSIPSGDGIFMKWVLVT  262

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  263  WTDDECKLIMENCYKALPVGGKLIACEPVLPKDSDDSHRTRALLEGDIFVMTIYRTKGKH  322

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE++QL  S GF  FRAF  D FY+VLEFQK
Sbjct  323  RTEEEFKQLGLSAGFPHFRAFCFDDFYSVLEFQK  356



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   350 bits (898),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 185/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP++KANGE AY+ YGK  EMN LM KAMSGVSVPFMKA LDGY GF+ V  LVDVGGSA
Sbjct  147  EPYMKANGETAYAQYGKCEEMNCLMQKAMSGVSVPFMKAILDGYDGFKSVDHLVDVGGSA  206

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+E+ P++ +GINFDLPEVV KAP IPG+ H+GGDMF+S+P+GDAIFMKW+LTT
Sbjct  207  GDCLRMILEQFPNVREGINFDLPEVVAKAPKIPGVIHMGGDMFQSVPSGDAIFMKWVLTT  266

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+IM +CY ALP GGKL+ACEPVLP +TDD+ RTR LLEGDIFVMTIYR KGKH
Sbjct  267  WTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDDSHRTRALLEGDIFVMTIYRTKGKH  326

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEE+++L  S GFS+FR FY+D+FYT+ EFQK
Sbjct  327  RTEEEFKELGLSAGFSTFRPFYIDYFYTIFEFQK  360



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   344 bits (882),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF +ANGE AY+YY K+ EMN LM+KAMSGVSVPFM+A L+GY GF+GV RLVDVGGS 
Sbjct  141  EPFERANGEGAYAYYLKQAEMNELMVKAMSGVSVPFMRAMLEGYDGFQGVERLVDVGGSG  200

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+ K+P+I +GINFDLPEVV KAP  P +THVGGDMFKSIP GDAIFMKW+LTT
Sbjct  201  GDCLRMILLKYPNIKEGINFDLPEVVAKAPPTPCVTHVGGDMFKSIPQGDAIFMKWVLTT  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEE K+IM +C+ ALP+GGKL+ACEPVLP  +D++ RTR LLEGDIFVMTIYRAKGKH
Sbjct  261  WTDEEIKQIMQNCHKALPEGGKLIACEPVLPEHSDESHRTRALLEGDIFVMTIYRAKGKH  320

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL+   GF  FRAF VD FYTVLEFQK
Sbjct  321  RTEEQFRQLANDAGFPRFRAFNVDHFYTVLEFQK  354



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   342 bits (877),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF +ANGE AY YY KKPEMN LMLKAMSGVSVPFMKA L  Y+GF+GV +LVDVGGS 
Sbjct  140  EPFERANGEAAYDYYLKKPEMNELMLKAMSGVSVPFMKALLASYNGFQGVEKLVDVGGSG  199

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI+ K+PSI + INFDLP+VV KAP IPG+THVGGDMFK +P GDAIFMKW+L T
Sbjct  200  GDCLRMILHKYPSIKEAINFDLPQVVAKAPQIPGVTHVGGDMFKYVPQGDAIFMKWVLIT  259

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+E K IM +CY ALP GGKL+ACEPVLP  +DD+ RTR LL+GDIFVMTIYRAKGKH
Sbjct  260  WTDKEIKHIMQNCYKALPAGGKLIACEPVLPEDSDDSHRTRALLQGDIFVMTIYRAKGKH  319

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF+ F+AF+VD FY VLEFQK
Sbjct  320  RTEEQFKQLGISAGFNLFKAFHVDHFYAVLEFQK  353



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   342 bits (876),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF +ANGE AY YY KKPEMN LMLKAM+GVSVPFMKA  + YHGF+ V +LVDVGGS 
Sbjct  141  EPFERANGEGAYDYYLKKPEMNELMLKAMAGVSVPFMKALFESYHGFQNVEKLVDVGGSG  200

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P+I QG NFDLPEVV KAP IPG+THVGGDMFK IP  DAIFMKW+LTT
Sbjct  201  GDCLRMILQKYPNIKQGFNFDLPEVVAKAPQIPGVTHVGGDMFKYIPQADAIFMKWVLTT  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEE K IM +CY ALP GGKL+ACEPVLP  +DD+ RTR  L GDIFVMTIYRAKGKH
Sbjct  261  WTDEEIKHIMLNCYKALPAGGKLIACEPVLPETSDDSHRTRASLAGDIFVMTIYRAKGKH  320

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL+ S GF+ F++F+VD+F+ VLEFQK
Sbjct  321  RTEEQFRQLAISAGFNLFKSFHVDYFHIVLEFQK  354



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   338 bits (867),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AYSYYGKKPEMN LMLKAMSGVSVPFMKAFL+ Y GF+GV  LVDVGGSA
Sbjct  140  EPFVKANGEGAYSYYGKKPEMNELMLKAMSGVSVPFMKAFLNSYDGFQGVGTLVDVGGSA  199

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMIM K+PSI +G+NFDLPEVV+KAP IPG+ HVGGD+ K+IP+   IFMKW+LTT
Sbjct  200  GDCLRMIMSKNPSIKKGVNFDLPEVVEKAPKIPGVEHVGGDLLKTIPSAVDIFMKWILTT  259

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK I+ +C+ ALP GGK+VACEPVLP  TD++ R+R LLEGDIFVMTIYR+KGKH
Sbjct  260  WTDDECKHILKNCHDALPPGGKVVACEPVLPNHTDNSHRSRALLEGDIFVMTIYRSKGKH  319

Query  209  RTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  108
            RTE EYR+L  + GF  F+A   +D FYTVLEFQK
Sbjct  320  RTEMEYRELGIAAGFRYFKAKILLDQFYTVLEFQK  354



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFV+ANGE AYSYYGKK EMN LM +AM+GVSVPFMKA LDGY GF+GV +LVDVGGSA
Sbjct  157  EPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSA  216

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P I +GINFDLPEVV +AP IPG++HVGGDMFKSIP GDAIFMKW+L+T
Sbjct  217  GDCLRMILQKYPHIKEGINFDLPEVVARAPTIPGVSHVGGDMFKSIPTGDAIFMKWVLST  276

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+AK K 
Sbjct  277  WTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKSKQ  336

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  337  RTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  370



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   336 bits (861),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFV+ANGEPAYSYYGKK EMN LM +AM+GVSVPFMKA LDGY GF+GV +LVDVGGSA
Sbjct  158  EPFVRANGEPAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSA  217

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+PSI +GINFDLPEVV +AP IPG++HVGGDMFKSIP  DA+FMKW+L+T
Sbjct  218  GDCLRMILQKYPSIKEGINFDLPEVVARAPPIPGVSHVGGDMFKSIPTADAMFMKWVLST  277

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+AK K 
Sbjct  278  WTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKSKQ  337

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE++RQL  S GFS+ R F++D+FY +LEF K
Sbjct  338  RTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFTK  371



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDG-YHGFEGVTRLVDVGGSA  570
            PF  ANGEPAY YYGK  EMNGLM +AM+GVSVPFMKA ++G Y GF+GV +LVDVGGSA
Sbjct  170  PFEVANGEPAYDYYGKNEEMNGLMQRAMAGVSVPFMKAVVEGGYDGFDGVVKLVDVGGSA  229

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MIM K+  I +GINFDLPEVV +AP IPG+THVGGDMFKSIP GDAIFMKW+LTT
Sbjct  230  GDCLKMIMSKYGGIKEGINFDLPEVVAQAPQIPGVTHVGGDMFKSIPCGDAIFMKWVLTT  289

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+E K IM +CY +LP GGKL+ACEPVLP  +DD+ RTR LL GDIFVMTIY AKG+H
Sbjct  290  WTDDEIKLIMKNCYDSLPAGGKLIACEPVLPETSDDSHRTRALLSGDIFVMTIYGAKGRH  349

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            R EEEYRQL  S GF  FRA ++D+F+TVLEFQK
Sbjct  350  RMEEEYRQLGNSAGFPHFRAVHIDYFFTVLEFQK  383



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   333 bits (853),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 182/216 (84%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFV+ANGE AYSYYGKK EMN LM +AM+GVSVPFMKA LDGY GF+GV +LVDVGGSA
Sbjct  194  EPFVRANGEAAYSYYGKKTEMNELMQRAMAGVSVPFMKAVLDGYDGFKGVEKLVDVGGSA  253

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP--GITHVGGDMFKSIPNGDAIFMKWML  396
            GDCLRMI++K+P I +GINFDLPEVV +AP IP  G++HVGGDMFKSIP GDAIFMKW+L
Sbjct  254  GDCLRMILQKYPHIKEGINFDLPEVVARAPTIPETGVSHVGGDMFKSIPTGDAIFMKWVL  313

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
            +TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD++ RTR LL  D+F+MTIY+AK 
Sbjct  314  STWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDESHRTRALLASDVFIMTIYKAKS  373

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            K RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  374  KQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  409



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   327 bits (837),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 176/214 (82%), Gaps = 15/214 (7%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM+A LDGY G +GV RLVDVGGSA
Sbjct  149  EPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSA  208

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++K+P + +GINFDLPEVV KAP              SIP  DAIFMKW+LTT
Sbjct  209  GDCLRMILQKYPHV-EGINFDLPEVVAKAP--------------SIPAADAIFMKWVLTT  253

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP ++DD+ RTR LLEGDIFVMTIYRAKGKH
Sbjct  254  WTDDECKAIMENCYKALPVGGKLIACEPVLPKESDDSHRTRALLEGDIFVMTIYRAKGKH  313

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  314  RTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  347



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + L+GY+GF+GV RLVDVGGSA
Sbjct  49   EPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSA  108

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  109  GDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTT  168

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKG H
Sbjct  169  WTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGNH  228

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
            RTE+E++QL    GF   R + V
Sbjct  229  RTEQEFKQLGFFAGFPHLRLYRV  251



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   321 bits (822),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 173/203 (85%), Gaps = 0/203 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + L+GY+GF+GV RLVDVGGSA
Sbjct  112  EPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  172  GDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTT  231

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKG H
Sbjct  232  WTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGNH  291

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
            RTE+E++QL    GF   R + V
Sbjct  292  RTEQEFKQLGFFAGFPHLRLYRV  314



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   318 bits (814),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 0/198 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF+K +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + L+GY+GF+GV RLVDVGGSA
Sbjct  112  EPFLKVHGEPAYSYYGKIPEMNGLMRKAMSGVSVPFMTSVLEGYNGFKGVKRLVDVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  172  GDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTT  231

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  232  WTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKH  291

Query  209  RTEEEYRQLSRSVGFSSF  156
             TE+E++QL  S+  SS 
Sbjct  292  MTEQEFKQLGFSLHSSSL  309



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 172/203 (85%), Gaps = 0/203 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP VK +G+PAYSYYGK PEMNGLM KAMSGVSVPFM + LDGY+GF+GV RLV+VGGSA
Sbjct  100  EPLVKVHGKPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEVGGSA  159

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +G+NFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  160  GDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPGVTHIGGDMFKSIPATDAIFMKWVLTT  219

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY ALP GGKL+ACEPVLP  ++++QRTR LLEGDIF MTIYRAKGKH
Sbjct  220  WTDDECKLIMENCYKALPTGGKLIACEPVLPDDSNESQRTRALLEGDIFFMTIYRAKGKH  279

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
             TE+E++QL  S GF   R + V
Sbjct  280  MTEQEFKQLGFSTGFPHLRLYRV  302



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   312 bits (799),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 168/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            +PFVK  GE  YSYYGK PEMN LM  AMSGVS+PFMK  L+ Y GFEGV  LVDVGGS 
Sbjct  147  DPFVKVYGEQPYSYYGKNPEMNSLMFNAMSGVSMPFMKVMLERYDGFEGVKTLVDVGGSV  206

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCL+MI+EKHPSI  GINFDLP+VV+KAP IP I HVGGDM   IP GDAIFMKW+L  
Sbjct  207  GDCLKMILEKHPSIELGINFDLPKVVEKAPQIPRIKHVGGDMLDYIPKGDAIFMKWILAI  266

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            + ++ECK+IM SCY ALP+ GK + C+PVLP  TDD++RTR LLE DI+ M IYRA+GKH
Sbjct  267  FTEDECKQIMKSCYNALPEKGKFIICDPVLPHHTDDSKRTRALLEIDIYGMAIYRAQGKH  326

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEEEYRQL R+ GF+  +  Y+D F+T+LEF K
Sbjct  327  RTEEEYRQLGRAAGFTDCKGVYIDHFFTILEFYK  360



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 169/203 (83%), Gaps = 0/203 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGK PEMNGLM KAMSGVSVPFM + LD Y+ F+GV +LVDVGGSA
Sbjct  17   EPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDSYNRFKGVKQLVDVGGSA  76

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFD+PEVV +AP+I G+TH+GGD FKSIP  DAIFMKW+LTT
Sbjct  77   GDCLRMILQKHRFIYEGINFDVPEVVGEAPSILGVTHIGGDTFKSIPAADAIFMKWVLTT  136

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+E K IM +CY ALP GGKL+AC+PVL   ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  137  WTDDEYKLIMENCYKALPAGGKLIACKPVLLDDSNESQRTRALLEGDIFVMTIYRAKGKH  196

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
            RTE+E++QL  S GF   R + V
Sbjct  197  RTEQEFKQLGFSAGFLHLRLYRV  219



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF K +GEPAYSYYGKKP+MNGLM KAMS V VPFM + LDGY GF+GV RLVDVGGSA
Sbjct  17   EPFAKVHGEPAYSYYGKKPKMNGLMRKAMSRVFVPFMTSVLDGYDGFKGVKRLVDVGGSA  76

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLR+I++KH  I +GINFDLPEVV KAP+IP +TH+GGDMFKSI   DAIFMKW+LTT
Sbjct  77   GDCLRIILQKHCFICEGINFDLPEVVAKAPSIPEVTHIGGDMFKSIHVVDAIFMKWVLTT  136

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM + Y AL  G KL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  137  WTDDECKLIMENYYKALLAGRKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKH  196

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVL  120
            +TE+E++QL  S GF   RAF    F   L
Sbjct  197  KTEQEFKQLGFSTGFPHLRAFISIIFTLFL  226



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   309 bits (792),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKANG-EPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG-FEGVTRLVDVGG  576
            EPF +ANG  PAY+YYG   E N LM +AM GVS PFM AFL+G+   F GV  +VDVGG
Sbjct  194  EPFARANGGTPAYAYYGGDGEANELMQRAMWGVSKPFMDAFLNGHAAAFAGVRTVVDVGG  253

Query  575  SAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWML  396
            S+GDCLR IM++ P++ +G+NFDLPEVV KAP  PG+THVGGDMFK+IP GDAIFMKW+L
Sbjct  254  SSGDCLRAIMQRVPTVQRGVNFDLPEVVAKAPKYPGMTHVGGDMFKAIPAGDAIFMKWVL  313

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
             TW DEEC  I+ +CY ALP+ GK++ACEPVLP +TD++QRTR LLE DIFVMTIYR +G
Sbjct  314  MTWTDEECMLILKNCYKALPEKGKVIACEPVLPEETDNSQRTRALLENDIFVMTIYRVQG  373

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            + RTEEE+RQ+  SVGFS+F+AFY D FYT+LEFQK
Sbjct  374  RGRTEEEFRQIGLSVGFSNFKAFYSDHFYTILEFQK  409



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 173/216 (80%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GE  YSYYGK PEMN LM KAMSGVSVPFM+ FLD Y GF+GV  LVDVGG++
Sbjct  140  EPFVKVHGELPYSYYGKNPEMNLLMQKAMSGVSVPFMETFLDRYDGFQGVETLVDVGGNS  199

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKS-IPNGDAIFMKWMLT  393
            GDCLR+IM K+ SI +GINFDLPEVV+KAP IPGI HVGGD+ KS IP GDAIFMKW+L 
Sbjct  200  GDCLRLIMNKYKSIKKGINFDLPEVVEKAPKIPGIEHVGGDLLKSNIPPGDAIFMKWLLV  259

Query  392  TWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGK  213
            T  DEECK I+ +C  ALP GGKL+ C+P+LP  TDD+ R+R +LE DI++MT+YR KGK
Sbjct  260  TCTDEECKHILKNCSDALPSGGKLIICDPLLPNHTDDSHRSRAILEADIYIMTMYRTKGK  319

Query  212  HRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  108
            HRTE EYR L  + GF++ +A F +D ++TVLEF+K
Sbjct  320  HRTETEYRALGVAAGFTNLKANFKIDNYFTVLEFEK  355



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   305 bits (781),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 173/217 (80%), Gaps = 3/217 (1%)
 Frame = -2

Query  749  EPFVKANGE-PAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGY--HGFEGVTRLVDVG  579
            EPF +ANG  PAY+YYG   E N LM +AM GVS PFM+A LDGY   GF  V  LVDVG
Sbjct  154  EPFARANGGVPAYAYYGGDREANALMQRAMWGVSEPFMEALLDGYGSAGFGSVETLVDVG  213

Query  578  GSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  399
            GS+G CL MIM + PS+ +GINFDLPEVV +AP + G+THVGG+MF+SIP GDAIFMKW+
Sbjct  214  GSSGACLDMIMRRFPSVKRGINFDLPEVVAEAPPLAGVTHVGGNMFESIPTGDAIFMKWV  273

Query  398  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  219
            LTTW DEEC  I+ +CY ALP+GGK++ACEPVLP++TD+++RTR LLEGDIFVM IYR  
Sbjct  274  LTTWTDEECTAILRNCYNALPEGGKVIACEPVLPVETDNSRRTRALLEGDIFVMAIYRTL  333

Query  218  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            G+ RTEEE+RQL   VGF++FRA Y+D FY V+E+QK
Sbjct  334  GRERTEEEFRQLGGVVGFTAFRAIYLDPFYAVVEYQK  370



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   294 bits (753),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL-DGYHGFEGVTRLVDVGGS  573
            EPF + NGEPAY YYGK  E+N  M  AMSGVSVP+MKA L  GY GFEGV  LVDVGGS
Sbjct  20   EPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGS  79

Query  572  AGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLT  393
            +GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+LT
Sbjct  80   SGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWVLT  139

Query  392  TWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGK  213
             + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAKGK
Sbjct  140  CFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGK  199

Query  212  HRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            HRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  200  HRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  234



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   295 bits (754),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGK PEMNGLM +A+SGVSVPFM + LD Y+GF+GV RLVDVGGSA
Sbjct  112  EPFVKVHGEPAYSYYGKMPEMNGLMRRAISGVSVPFMTSVLDSYNGFKGVKRLVDVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMF SIP  +AIFMKW+L T
Sbjct  172  GDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFNSIPAANAIFMKWVLAT  231

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY AL  GGKL+ACEPVL   ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  232  WTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAKGKH  291

Query  209  RTE  201
            RTE
Sbjct  292  RTE  294



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   297 bits (761),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL-DGYHGFEGVTRLVDVGGS  573
            EPF + NGEPAY YYGK  E+N  M  AMSGVSVP+MKA L  GY GFEGV  LVDVGGS
Sbjct  161  EPFARVNGEPAYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGS  220

Query  572  AGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLT  393
            +GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+LT
Sbjct  221  SGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWVLT  280

Query  392  TWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGK  213
             + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAKGK
Sbjct  281  CFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGK  340

Query  212  HRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            HRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  341  HRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  375



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH---GFEGVTRLVDV  582
            EPF +AN G PAY+YYGK  E N +ML+AM+GVS PFM A LDGY    GF GV  LVDV
Sbjct  160  EPFARANAGVPAYAYYGKDREANQVMLRAMTGVSEPFMHALLDGYGFDGGFHGVATLVDV  219

Query  581  GGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKW  402
            GGS+G CL MIM + P+I +GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW
Sbjct  220  GGSSGACLEMIMRRVPTIKEGINFDLPDVVADAPAIAGVRHVGGDMFKSIPSGDAIFMKW  279

Query  401  MLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRA  222
            +LTTW ++EC  I+ +C+ ALP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR 
Sbjct  280  VLTTWTNDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRT  339

Query  221  KGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            +G+ R+EEE+  L  + GF+ FRA Y+D FY VLE+ K
Sbjct  340  QGRERSEEEFHHLGIAAGFTGFRAIYLDPFYAVLEYTK  377



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   295 bits (754),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 170/217 (78%), Gaps = 3/217 (1%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH--GFEGVTRLVDVG  579
            EPF +AN G PAY+YYGK  E N +ML+AM+GVS PFM+A L+GY   GFEGV+ LVDVG
Sbjct  149  EPFARANAGVPAYAYYGKDREANEVMLRAMTGVSEPFMEALLEGYGDGGFEGVSTLVDVG  208

Query  578  GSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  399
            GS+G CL MIM +  +I  G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMKW+
Sbjct  209  GSSGACLEMIMRRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKSIPSGDAIFMKWV  268

Query  398  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  219
            LTTW +EEC  I+S+C+ ALP GGK++ACEPV+P  TD + RTR LLE DIFVM  YR +
Sbjct  269  LTTWTNEECTAILSNCHKALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQ  328

Query  218  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  329  GRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  365



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   289 bits (739),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 159/203 (78%), Gaps = 16/203 (8%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEP YSYYGK PEMNGLM KAMSGVSVPFM + LDGY GF+GV RLVDVGGSA
Sbjct  17   EPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSILDGYDGFKGVKRLVDVGGSA  76

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G                INFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  77   G----------------INFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTT  120

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY A+P GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  121  WTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKH  180

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
             TE+E++QL  S GF   R + V
Sbjct  181  MTEQEFKQLGFSAGFPHLRLYRV  203



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   293 bits (751),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 169/219 (77%), Gaps = 5/219 (2%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH---GFEGVTRLVDV  582
            EPF +AN G  AY+YYGK  + N +ML+AM+GVS PFM A LDGY    GF GV  LVDV
Sbjct  156  EPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDGYGAAGGFRGVATLVDV  215

Query  581  GGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKW  402
            GGS+G CL MIM + P+IT+GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW
Sbjct  216  GGSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKW  275

Query  401  MLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRA  222
            +LTTW D+EC  I+ +C+ ALP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR 
Sbjct  276  VLTTWTDDECTAILRNCHAALPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRT  335

Query  221  KGKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEFQK  108
            +G+ R+EEE+R L   + GF++FRA Y+D FY VLE+ K
Sbjct  336  QGRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 168/216 (78%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH-GFEGVTRLVDVGG  576
            EPF +AN G PAY+YYG+  E N +ML+AM+GVS PFM+A LDGY  GFEGV  LVDVGG
Sbjct  127  EPFARANAGVPAYAYYGRDREANEVMLRAMTGVSEPFMEALLDGYAAGFEGVATLVDVGG  186

Query  575  SAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWML  396
            S+G CL MIM +  +I +GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+L
Sbjct  187  SSGACLEMIMRRVDTIREGINFDLPDVVAAAPPIVGVRHVGGDMFKSIPSGDAIFMKWVL  246

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
            TTW +EEC  I+ +CY ALP GGK++ACEPV+P +TD + RTR LLE DIFVMT YR +G
Sbjct  247  TTWTNEECTAILGNCYSALPDGGKVIACEPVVPEETDGSTRTRALLENDIFVMTTYRTQG  306

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            + R+E+E+R L  + GF+ FRA Y+D  Y VLE+ K
Sbjct  307  RERSEDEFRNLGIAAGFTGFRAIYLDPLYAVLEYTK  342



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   293 bits (749),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG-FEGVTRLVDVGG  576
            EPF +A+ G PAY+YYG+  + N +ML+AM+GVS PFM+A LDGY G FEGV  LVDVGG
Sbjct  152  EPFARAHAGVPAYAYYGQDRDANEVMLRAMTGVSEPFMEALLDGYEGGFEGVGTLVDVGG  211

Query  575  SAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWML  396
            S+G CL MIM + P+I +G+NFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+L
Sbjct  212  SSGACLEMIMRRVPTIREGVNFDLPDVVAAAPPIAGVKHVGGDMFKSIPSGDAIFMKWVL  271

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
            TTW ++EC  I+  C+ ALP GGKLVACEPV+P  TD + RTR LLE DIFVMT YR +G
Sbjct  272  TTWTNDECTAILKKCHDALPDGGKLVACEPVVPETTDASTRTRALLENDIFVMTTYRTQG  331

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            + R+EEE+RQL  + GF+ FRA Y+D FY +LE+ K
Sbjct  332  RERSEEEFRQLGIAAGFAGFRALYLDPFYALLEYVK  367



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 159/203 (78%), Gaps = 16/203 (8%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEP YSYYGK PEMNGLM KAMSGVSVPFM + LDGY GF+GV RLVDVGGSA
Sbjct  112  EPFVKVHGEPTYSYYGKMPEMNGLMRKAMSGVSVPFMTSILDGYDGFKGVKRLVDVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G                INFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  172  G----------------INFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMKWVLTT  215

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+ECK IM +CY A+P GGKL+ACEPVLP  ++++QRTR LLEGDIFVMTIYRAKGKH
Sbjct  216  WTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNESQRTRALLEGDIFVMTIYRAKGKH  275

Query  209  RTEEEYRQLSRSVGFSSFRAFYV  141
             TE+E++QL  S GF   R + V
Sbjct  276  MTEQEFKQLGFSAGFPHLRLYRV  298



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   291 bits (746),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHG-FEGVTRLVDVGG  576
            EPF +A+ G PAY++Y +  E N +ML+ M+GVS PFM+A LDGY G FE V  LVDVGG
Sbjct  147  EPFARAHRGLPAYAFYAQDKEANEVMLRGMTGVSEPFMEALLDGYAGGFEDVRTLVDVGG  206

Query  575  SAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWML  396
            S+G CL MIM +  +I QGINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW+L
Sbjct  207  SSGACLDMIMRRVGTIAQGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKWVL  266

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
            TTW ++EC  I+ +CYGALP+GGKL+ACEPV+P  TD + RTR LLE DIFVMT YR +G
Sbjct  267  TTWTNDECTAILKNCYGALPEGGKLIACEPVVPETTDTSTRTRALLENDIFVMTTYRTQG  326

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            + R+EEE+RQL  + GF++FRA Y+D FY VLE+ K
Sbjct  327  RERSEEEFRQLGLAAGFTAFRAIYLDPFYAVLEYLK  362



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 168/219 (77%), Gaps = 5/219 (2%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH---GFEGVTRLVDV  582
            EPF +AN G  AY+YYGK  + N +ML+AM+GVS PFM A LDGY    GF GV  LVDV
Sbjct  156  EPFARANAGVTAYAYYGKDQDANRVMLRAMAGVSEPFMGALLDGYGAAGGFRGVATLVDV  215

Query  581  GGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKW  402
            GGS+G CL MIM + P+IT+GINFDLP+VV  AP I G+ HVGGDMFKSIP+GDAIFMKW
Sbjct  216  GGSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIAGVRHVGGDMFKSIPSGDAIFMKW  275

Query  401  MLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRA  222
            +LTTW D+EC  I+ +C+  LP GGKLVACEPV+P +TD + RTR LLE DIFVMT YR 
Sbjct  276  VLTTWTDDECTAILRNCHAXLPDGGKLVACEPVVPEETDSSTRTRALLENDIFVMTTYRT  335

Query  221  KGKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEFQK  108
            +G+ R+EEE+R L   + GF++FRA Y+D FY VLE+ K
Sbjct  336  QGRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEYTK  374



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   290 bits (743),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 172/234 (74%), Gaps = 20/234 (9%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLM-------------------LKAMSGVSVPFMKAFL  627
            EPFVK +GE AYSYYGK PEMN LM                    KAMSGVSVPFMKAFL
Sbjct  127  EPFVKVHGELAYSYYGKYPEMNLLMHGELPYSYYGKYPEMNLLMQKAMSGVSVPFMKAFL  186

Query  626  DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGD  447
            DGY GF+GV  LVDVGG++G+CLRMIM K+ SI +G+ FDLPEVV+KAP IPGI HVGGD
Sbjct  187  DGYDGFQGVETLVDVGGNSGECLRMIMSKYQSIKKGVKFDLPEVVEKAPKIPGIEHVGGD  246

Query  446  MFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTR  267
            + KS+P GDAIFMKW+L    D+ECK+I  +C+ ALP GGKL+ C+P+LP + DD + +R
Sbjct  247  VLKSVPPGDAIFMKWILVACTDDECKQIFKNCFDALPPGGKLIVCDPLLPDRADDNRSSR  306

Query  266  LLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFR-AFYVDFFYTVLEFQK  108
             +LE DI++MT+YR KGKHRTE E R+L  + GF + +  F VD ++TVLEFQK
Sbjct  307  AILEADIYIMTMYRTKGKHRTETECRELGLAAGFHNLKPKFNVDHYFTVLEFQK  360



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGK PEMNGLM +A+SGVSVPFM + LD Y+GF+GV RLVDVGGSA
Sbjct  112  EPFVKVHGEPAYSYYGKMPEMNGLMRRAISGVSVPFMTSVLDSYNGFKGVKRLVDVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMF SIP  +AIFMKW+L T
Sbjct  172  GDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFNSIPAANAIFMKWVLAT  231

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  219
            W D+ECK IM +CY AL  GGKL+ACEPVL   ++++QRTR LLEGDIFVMTIYRAK
Sbjct  232  WTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNESQRTRALLEGDIFVMTIYRAK  288



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = -2

Query  719  AYSYYGKKPEMNGLMLKAMSGVSVPFMKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIME  543
            AY YYGK  E+N  M  AMSGVSVP+MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ 
Sbjct  2    AYQYYGKNDELNKNMQYAMSGVSVPYMKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIIN  61

Query  542  KHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEI  363
            K+  I + INFDLPEVV KAP IPGITHVGG+MF+S+P+GDAIF+KW+LT + DEE   +
Sbjct  62   KYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFESVPSGDAIFVKWVLTCFTDEEVITL  121

Query  362  MSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQL  183
            M +C  ALP GGKL+  EP LP  +D++ RTR LL  DIF+MT YRAKGKHRTEEEYRQL
Sbjct  122  MRNCNKALPVGGKLICSEPTLPENSDESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQL  181

Query  182  SRSVGFSSFRAFYVDFFYTVLEFQK  108
                GF  FR  +VD+F+ V+EFQK
Sbjct  182  GLLAGFPKFRVIHVDYFFPVVEFQK  206



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 167/216 (77%), Gaps = 2/216 (1%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVT-RLVDVGG  576
            EPF +AN G PAY+YYG+  E N +ML+AM+GVS PFM+A LDGY G       LVDVGG
Sbjct  98   EPFARANAGVPAYAYYGQDREANEVMLRAMTGVSEPFMEALLDGYGGGFEGVGTLVDVGG  157

Query  575  SAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWML  396
            S+G CL MIM +  +I +G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMKW+L
Sbjct  158  SSGACLEMIMRRVRTIREGLNFDLPDVVAAAPPIPGVKHVGGDMFKSIPSGDAIFMKWVL  217

Query  395  TTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKG  216
            TTW ++EC  I+ +CY ALP GGKLVACEPV+P  TD + RTR LLE DIFVMT YR +G
Sbjct  218  TTWTNDECTAILRNCYAALPAGGKLVACEPVVPDTTDGSTRTRALLENDIFVMTTYRTQG  277

Query  215  KHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            + R+EEE+RQL  +VGF+ FRA Y+D FY +LE+ K
Sbjct  278  RERSEEEFRQLGLAVGFTFFRAIYLDPFYALLEYTK  313



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   282 bits (722),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KANGE A +YY K+ ++  L+  +++G+SVPFM+  L+ Y GF+GV  L DVGG++
Sbjct  148  EPFEKANGESAVAYYIKRADVMSLIYSSLAGMSVPFMREMLENYDGFQGVETLADVGGNS  207

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G CL MIM K+P+I +GIN+D P +V  AP  P ITH+GGD  +S+P GDAIFMKW+   
Sbjct  208  GVCLNMIMNKYPNIRKGINYDFPAMVSSAPEFPDITHIGGDALQSVPAGDAIFMKWIFLA  267

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+ + +CY ALP  GKL+ CEPVLP  TD++QRTR LL GDIF+MT+YR KGKH
Sbjct  268  WTDEECKKTLQNCYKALPVDGKLIVCEPVLPELTDESQRTRALLGGDIFIMTMYRTKGKH  327

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF  FRAFY+D +  VLEFQK
Sbjct  328  RTEEQFKQLGASTGFFRFRAFYIDPYLAVLEFQK  361



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 162/214 (76%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y GF+GV  LVDVGG++
Sbjct  145  EPFEKLHGEGAYAYCMKRPDEMSLFYASMSGLSMPHMNEMLEKYDGFKGVETLVDVGGNS  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  +S+P GDAIF KW + T
Sbjct  205  GVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALESVPAGDAIFTKWTMLT  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+YR KGKH
Sbjct  265  WTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYRTKGKH  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  325  RTEEQFKQLGISTGFLRFRAFHIDPYFPVLEFQK  358



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   273 bits (698),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y GF+GV  LVDVGG++
Sbjct  122  EPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKYDGFKGVESLVDVGGNS  181

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  + +P GDAIF KW + T
Sbjct  182  GVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALELVPAGDAIFTKWTMLT  241

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+Y+ KGKH
Sbjct  242  WTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTKGKH  301

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  302  RTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  335



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF K +GE AY+Y  K PE   L   +MSG+S+P+M+  L+ Y GF+GV  LVDVGG++
Sbjct  145  EPFEKLHGEAAYAYCTKGPEEMSLFYASMSGMSLPYMREMLENYDGFKGVETLVDVGGNS  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L MIM K+P+I +GINFDLP+++  AP  PGITHVGGD  +S+P GDAIF+KW + T
Sbjct  205  GVSLNMIMNKYPNILKGINFDLPDMISSAPQYPGITHVGGDALESVPAGDAIFIKWTVLT  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEE K+ + SCY ALP  GKL+ CEPVLP QTD+++RTR LL  DI++MT+YR KGKH
Sbjct  265  WTDEEFKKALQSCYKALPVAGKLILCEPVLPEQTDESKRTRALLAADIWIMTMYRTKGKH  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF SFRAF++D +  VLEF K
Sbjct  325  RTEEQFKQLGISAGFKSFRAFHIDPYLPVLEFHK  358



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 161/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF K +GE AY+Y  K+P+   L   +MSG+S+P M   L+ Y GF+GV  LVDVGG++
Sbjct  145  EPFEKLHGEGAYAYCMKRPDEMSLFYASMSGMSMPHMNEMLEKYDGFKGVESLVDVGGNS  204

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L MIM K+P+I +GINFDLP+++  AP +PGITHVGGD  + +P GDAIF KW + T
Sbjct  205  GVILNMIMNKYPNILKGINFDLPDMISSAPQLPGITHVGGDALELVPAGDAIFTKWTMLT  264

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DEECK+++ +CY ALP  GKL+ CEPV P  TD++QRTR LL GDIF+MT+Y+ KGKH
Sbjct  265  WTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDESQRTRALLSGDIFIMTMYKTKGKH  324

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  325  RTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   259 bits (663),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 144/185 (78%), Gaps = 11/185 (6%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            E FVK +G PAYSYYGK PE+N LM KAMSGVSVPFM + LDGY+GF+GV RLVDVGGS 
Sbjct  80   ELFVKVHGVPAYSYYGKMPEINSLMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVDVGGSV  139

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+   
Sbjct  140  GDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVTHIGGDMFKSIPAADAIFMKWL---  196

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
                    IM  CY ALP GGKL+ CEPVLP  ++++QRTR LLEGDIFVMTIYRAK   
Sbjct  197  --------IMEKCYKALPAGGKLIVCEPVLPDDSNESQRTRALLEGDIFVMTIYRAKAYQ  248

Query  209  RTEEE  195
             T+  
Sbjct  249  WTKNR  253



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  554  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  375
            MI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+LTTW DEE
Sbjct  1    MILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEE  60

Query  374  CKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEE  195
            CK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAKGKHRTEEE
Sbjct  61   CKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEE  120

Query  194  YRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            +RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  121  FRQLGLSAGFPHLRAFYIDHFYTVLEFQK  149



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 154/217 (71%), Gaps = 23/217 (11%)
 Frame = -2

Query  749  EPFVKAN-GEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYH--GFEGVTRLVDVG  579
            EPF +AN G PAY+YYGK  E N +ML+AM+GVS PFM+A L+GY   GFEGV+ LVDVG
Sbjct  149  EPFARANAGVPAYAYYGKDREANEVMLRAMTGVSEPFMEALLEGYGDGGFEGVSTLVDVG  208

Query  578  GSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  399
            GS+G CL M+M +  +I  G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAIFMK  
Sbjct  209  GSSGACLEMMMRRVRTIRDGVNFDLPDVVAAAPPIPGVRHVGGDMFKSIPSGDAIFMK--  266

Query  398  LTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAK  219
                              ALP GGK++ACEPV+P  TD + RTR LLE DIFVM  YR +
Sbjct  267  ------------------ALPGGGKVIACEPVVPDTTDGSTRTRALLENDIFVMATYRTQ  308

Query  218  GKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  309  GRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  345



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   238 bits (606),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -2

Query  617  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  438
            +GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+
Sbjct  19   NGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFE  78

Query  437  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLL  258
            S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL
Sbjct  79   SVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALL  138

Query  257  EGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
              DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  139  VADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  188



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -2

Query  623  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  444
            GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+ 
Sbjct  1    GYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNT  60

Query  443  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRL  264
            F+S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR 
Sbjct  61   FESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRA  120

Query  263  LLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTV  123
            LL  DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V
Sbjct  121  LLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPV  167



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EP VK +G+PAYSYYGK PEMNGLM KAMSGVSVPFM + LDGY+GF+GV RLV+VGGSA
Sbjct  112  EPLVKVHGKPAYSYYGKMPEMNGLMRKAMSGVSVPFMTSVLDGYNGFKGVKRLVEVGGSA  171

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            GDCLRMI++KH  I +G+NFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMKW+LTT
Sbjct  172  GDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPGVTHIGGDMFKSIPATDAIFMKWVLTT  231

Query  389  WMDEECKEIMSSCYGALPQGGKLV  318
            W D+ECK IM +CY AL  GG+L+
Sbjct  232  WTDDECKLIMENCYKALLAGGELL  255



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/214 (51%), Positives = 147/214 (69%), Gaps = 1/214 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF+KA+G+PAY Y+   P  N  M++AMS  S   M  FL+ Y GFEGV R+VD+GGS+
Sbjct  140  EPFIKAHGKPAYHYHADDPVFNERMMEAMSSSSGAVMDWFLERYDGFEGVRRVVDLGGSS  199

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G CL+ I++KH  + +GINFDLP+VV+ AP   GI HVGGDM + +P GD IFMK +L +
Sbjct  200  GFCLKKILDKHKGL-EGINFDLPKVVEAAPPYLGIEHVGGDMLEWVPQGDVIFMKGILCS  258

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W D+EC  ++ +CY ALP+ GK++A E VLP+ TD +  TR LL+ D+F+M IY    K 
Sbjct  259  WDDDECVGLLKNCYKALPEKGKVIALEQVLPMHTDTSPSTRALLQADVFLMAIYSPGSKR  318

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RTE+ +R+LS + GF +        FYT LEFQK
Sbjct  319  RTEDIFRRLSEAAGFRTLEIVLPGSFYTALEFQK  352



>ref|XP_006381360.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59157.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=270

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGEPAY YYGK+PEMN LMLKAMSGVSVPFM+A LDGY GF+GV RLVDVGGSA
Sbjct  151  EPFVKANGEPAYDYYGKQPEMNELMLKAMSGVSVPFMEAMLDGYDGFKGVERLVDVGGSA  210

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWM  399
            GDCLRMI++KHP + QGINFDLPEVV KAP IPG+T+VGGDMFKSIP+GDAIFMK M
Sbjct  211  GDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVTNVGGDMFKSIPDGDAIFMKTM  267



>ref|XP_009787879.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Nicotiana 
sylvestris]
Length=121

 Score =   202 bits (514),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  467  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  288
            I H+GGDMFK +P G+AIFMKW+LTTW D+ECK+IM SCY ALP+ GKL+ACEPVLP  T
Sbjct  1    INHIGGDMFKYVPKGNAIFMKWVLTTWTDDECKQIMKSCYNALPKKGKLIACEPVLPHHT  60

Query  287  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            DD++RTR LLEGDIFVMTIYRAKGKHRTE+EYRQL RS GF+  R FY+D F+TVLEF K
Sbjct  61   DDSKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRGFYIDHFFTVLEFHK  120



>ref|XP_008361606.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X2 [Malus domestica]
Length=278

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  155  EPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSA  214

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF+K
Sbjct  215  GDCLRMILQKHPNVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFLK  269



>ref|XP_008361604.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like isoform 
X1 [Malus domestica]
Length=281

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AY YYGKKPEMNGLM KAMSGVSVPFMKA LDGY GFEGV RLVDVGGSA
Sbjct  158  EPFVKANGELAYEYYGKKPEMNGLMQKAMSGVSVPFMKAILDGYDGFEGVERLVDVGGSA  217

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI++KHP++ +GINFDLPEVV KAP I G++HVGGDMFKSIP GDAIF+K
Sbjct  218  GDCLRMILQKHPNVREGINFDLPEVVAKAPTIAGVSHVGGDMFKSIPRGDAIFLK  272



>gb|KDO54338.1| hypothetical protein CISIN_1g032721mg [Citrus sinensis]
Length=135

 Score =   200 bits (508),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSVPFM + LDGY GF+GV RLVDVGGSA
Sbjct  17   EPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSA  76

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI++KHP I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMK
Sbjct  77   GDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMK  131



>ref|XP_006428524.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
 gb|ESR41764.1| hypothetical protein CICLE_v10013655mg [Citrus clementina]
Length=261

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGKKPEMNGLM KAMSGVSVPFM + LDGY GF+GV RLVDVGGSA
Sbjct  143  EPFVKVHGEPAYSYYGKKPEMNGLMRKAMSGVSVPFMTSVLDGYDGFKGVKRLVDVGGSA  202

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI++KHP I +GINFDLPEVV +AP+IPG+TH+GGDMFKSIP  DAIFMK
Sbjct  203  GDCLRMILQKHPFICEGINFDLPEVVAEAPSIPGVTHIGGDMFKSIPAADAIFMK  257



>ref|XP_010918594.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=362

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  A+ Y+G  P  N +  + MS  +  F+K  LD Y GFE +  LVDVGG  G
Sbjct  152  PFTKAHGMTAFEYHGTDPRFNKVFNQGMSNHTTLFVKKMLDTYKGFEDLKHLVDVGGGLG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L+MI+ K+P I QGINFDLP V+  AP IPG+ HVGGDMF SIP+ DAIFMKW+L  W
Sbjct  212  ATLQMIVSKYPHI-QGINFDLPHVISGAPLIPGVVHVGGDMFSSIPSADAIFMKWILHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ +C+ ALP  GK++  E +LP        T++L  GD+ ++T Y   GK R
Sbjct  271  SDEHCLKILKNCWKALPNNGKVIVAECLLPEAPKANAETQVLYYGDLAMLT-YNIGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF+ F+A        V+EF K
Sbjct  330  TKKEFESLAKEAGFAHFKAECCALNMWVMEFLK  362



>gb|KJB23958.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=318

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  106  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTG  165

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  166  ATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWICHDW  224

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  225  SDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  283

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+RS GF  F+     F   ++EF K
Sbjct  284  TEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  316



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G +P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTEPRFNKVFNKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  TDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G +P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTEPRFNKVFNKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  TDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_008362842.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=253

 Score =   197 bits (501),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  41   PFNKACGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLLENYNGFEGLTCIVDVGGGTG  100

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  101  AILNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  159

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  160  SDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHID-EIMLAHNPGGKER  218

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  219  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  251



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  213  ATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  272  SDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+RS GF  F+     F   ++EF K
Sbjct  331  TEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF +A G  A+ Y+G  P  N +    M   S+   K  LD Y GF+ V RLVDVGG  G
Sbjct  152  PFNRAYGMTAFEYHGTDPRFNAVFNDGMKNHSIIITKKLLDIYRGFDDVNRLVDVGGGIG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  KHP I   INFDLP V+ +AP  PG+ HVGGDMF S+P+GDAI MKW+L  W
Sbjct  212  ATLFMITSKHPHI-HAINFDLPHVISEAPPFPGVEHVGGDMFASVPSGDAILMKWILHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ SC+ ALP+ GK++  E VLP+  + T R + +   D+ +M  +   GK R
Sbjct  271  SDEHCAKILKSCWEALPEKGKVIVVECVLPVVPEPTPRAQGVFHVDL-IMLAHNPGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TEEE+  L++  GFS F+A Y+     V+EF K
Sbjct  330  TEEEFHGLAKQAGFSGFKATYIFANAWVIEFTK  362



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 135/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G P + Y+ K    N +  K MS  S   +K  L+ Y GF+G+T LVDVGG  G
Sbjct  129  PFNKAYGMPIFDYFAKDLGSNKVFNKGMSDFSSMIIKKILETYKGFQGLTSLVDVGGGTG  188

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I+ K+P+I +GINFDLP V+Q AP  PGI HVGGDMF S+P GDAIFMKW+   W
Sbjct  189  ATLTKILSKYPTI-RGINFDLPHVIQDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDW  247

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             +E+C +++ +CY ALP  GK++  E +LP+  D +  ++L +  D+ ++T   + GK R
Sbjct  248  NEEQCLKLLKNCYDALPNNGKVIVAEYILPVVPDSSLASKLSVTADVMIVT-QNSGGKER  306

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  307  TEKEFEALAKAAGFQGFQVFCNAFTIYIIEFSK  339



>gb|KJB62324.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=269

 Score =   197 bits (500),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 104/115 (90%), Gaps = 1/115 (1%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVKANGE AYSYYGKKPEMNGLM KAMSGVSVPFM+A LDGY G +GV RLVDVGGSA
Sbjct  149  EPFVKANGEGAYSYYGKKPEMNGLMQKAMSGVSVPFMRAILDGYDGLKGVKRLVDVGGSA  208

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI++K+P + +GINFDLPEVV KAP+IPG+THVGGDMF+SIP  DAIFMK
Sbjct  209  GDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVTHVGGDMFESIPAADAIFMK  262



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  LD Y GF+G+T +VDVGG  G
Sbjct  151  PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILDIYGGFDGLTTVVDVGGGTG  210

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHP+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  211  ATLNMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  269

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E +LP+  D    T+ ++  D+ +M  +   GK R
Sbjct  270  SDDHCLKFLKNCYDALPHNGKVIIAECILPVAPDTKLATKNVVHIDV-IMLAHNPGGKER  328

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF+ FR     F   V+EF K
Sbjct  329  TQKEFEALAKGAGFAGFRVMCCAFNTYVMEFLK  361



>gb|AGO50639.1| caffeic acid O-methyltransferase [Linum usitatissimum]
Length=367

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GF+ +  LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFDVLKSLVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  AVLSMILSKHPSI-KGINFDLPHVIEDAPALPGVQHVGGDMFASVPTGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +C+ ALP  GK++ CE ++P+  D +  TR ++  D  +M  +   GK R
Sbjct  273  SDQHCLKFLKNCFDALPANGKVIVCECIMPVAPDTSLATRNVVHIDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T+ E+  L++  GF  FR     F   V+EF K
Sbjct  332  TQAEFESLAKGAGFQGFRVVCSAFNTYVMEFLK  364



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 135/214 (63%), Gaps = 2/214 (1%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KA G+  +    +   +N L   AMS  S  +M A L+ YHGF+G+  LVDVGG  
Sbjct  142  EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFKGIGTLVDVGGGV  201

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L +I++K+P I +GINFDLP VV KAP IPG+ HVGGDMF S+P GDAIFMKW+L  
Sbjct  202  GTSLTVILKKYPEI-KGINFDLPHVVAKAPQIPGVEHVGGDMFVSVPQGDAIFMKWILHD  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DE C  ++ +CY ++P+ GK++  + VLP   D     R+ L  D+  M +Y   GK 
Sbjct  261  WSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLL-MLVYNPGGKE  319

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  320  RTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   199 bits (506),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 135/214 (63%), Gaps = 2/214 (1%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF KA G+  +    +   +N L   AMS  S  +M A L+ YHGF+G+  LVDVGG  
Sbjct  142  EPFTKAFGQTEFELGKENSRVNNLFHAAMSNHSKLYMNAILEAYHGFKGIGTLVDVGGGV  201

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTT  390
            G  L +I++K+P I +GINFDLP VV KAP IPG+ HVGGDMF S+P GDAIFMKW+L  
Sbjct  202  GTSLAVILKKYPEI-KGINFDLPHVVAKAPQIPGVEHVGGDMFVSVPQGDAIFMKWILHD  260

Query  389  WMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKH  210
            W DE C  ++ +CY ++P+ GK++  + VLP   D     R+ L  D+  M +Y   GK 
Sbjct  261  WSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDTGAGARVALSIDLL-MLVYNPGGKE  319

Query  209  RTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  320  RTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L M++ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  213  ATLNMLVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  272  SDEHCSKFLKKCYEALPDNGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+RS GF  F+     F   ++EF K
Sbjct  331  TEKEFEALARSAGFQGFQVKCCAFGTYIMEFLK  363



>gb|AGS49204.1| O-methyltransferase [Zea mays]
Length=364

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + R +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKARGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +    MS  S   MK  LD Y GFEG++ LVDVGG  G
Sbjct  150  PFNKAYGMTAFEYHGTDPRFNKVFNNGMSNHSTITMKRILDTYKGFEGLSTLVDVGGGTG  209

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHP+I +GINFDLP V++ AP   G+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  210  ATLNMIISKHPTI-KGINFDLPHVIEDAPAYNGVEHVGGDMFESVPKGDAIFMKWICHDW  268

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY +LP  GK++ CE +LP+  +     R +   D  +M  +   GK R
Sbjct  269  SDEHCLKFLKNCYASLPDHGKVIVCEYILPVAPETNHAARTVFHVDA-IMLAHNPGGKER  327

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     +   V+EF K
Sbjct  328  TEQEFEGLAKGAGFEGFRVACSAYDTKVIEFYK  360



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNRVFNKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|AGS49202.1| O-methyltransferase [Zea mays]
Length=364

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS FRA Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFRATYIYANAWAIEFIK  364



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF K  G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKVYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYDGFEGLKTLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  213  ATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + +  CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  272  SDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+RS GF  F+     F   ++EF K
Sbjct  331  TEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>gb|AGS49209.1| O-methyltransferase [Zea mays]
Length=364

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPQFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ADR31598.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  9    PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTG  68

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  69   AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVXHVGGDMFVSVPKADAVFMKWICHDW  127

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  128  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  186

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  187  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  158  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYKGFEGLNTIVDVGGGTG  217

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP++PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  218  AVLSMIVAKYPSI-KGINFDLPHVIEDAPSLPGVEHVGGDMFVSVPKGDAIFMKWICHDW  276

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  277  SDEHCLKFLKNCYAALPDHGKVIVAECILPLSPDPSLATKGVIHIDC-IMLAHNPGGKER  335

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   V+EF K
Sbjct  336  TEKEFEALAKGAGFEGFRVACCAFNTYVMEFLK  368



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGINHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ L++  GF  F      F   V+EF K
Sbjct  331  TEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_008803442.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Phoenix dactylifera]
Length=330

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  A+ Y+G  P  N +  + M+  +  F+K  LD Y GFEG+  LVDVGG  G
Sbjct  120  PFTKAHGMTAFEYHGTDPRFNKVFNQGMANHATLFVKKMLDTYEGFEGLKDLVDVGGGLG  179

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P I +GINFDLP V+ +AP IPG+ HVGGDMF SIP  DAIFMKW+L  W
Sbjct  180  ATLHMIASKYPHI-KGINFDLPHVISEAPVIPGVVHVGGDMFSSIPRADAIFMKWILHDW  238

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C  I+ +C+ ALP  GK++  E +LP   +    T++    D+ ++T Y   GK R
Sbjct  239  SDEHCLNILKNCWKALPDNGKVIVAECLLPEAPETNAETQIRYYADLAMLT-YNIGGKER  297

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GFS F+A        V+EF K
Sbjct  298  TKKEFESLAKEAGFSRFKAECCVLNIWVMEFLK  330



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+GK    N +    MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSVVDVGGGIG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIF+KW+   W
Sbjct  214  ATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVEHVGGDMFVSVPKGDAIFIKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  +++++  D  +M  +   GK R
Sbjct  273  SDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+R L+++ GF  F+     F   ++EF K
Sbjct  332  TEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLLEIYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKESGFQGFRVVCSAFNIYAIEFLK  363



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 134/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  ++ Y+GK    N +  K MS  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  331  TEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  221  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTG  280

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  281  AVLXMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  339

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  340  XDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKER  398

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  399  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  431



>gb|ADR31595.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31596.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31601.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31605.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31606.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31608.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  9    PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTG  68

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  69   AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  127

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  128  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  186

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  187  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  158  PFNKAYGMTAFEYHGTDPRFNKVFNQGMSNHSTITMKKILEIYQGFEGLTSLVDVGGGTG  217

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P+I +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  218  ATLHMIRSKYPTI-KGINFDLPHVIEDAPTYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  276

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E  LP+  D +  ++ ++  D+ +M  +   GK R
Sbjct  277  SDEHCAKFLKNCYDALPNNGKVIVAECNLPVAPDTSLASKNVIHIDV-IMLAHNPGGKER  335

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T+EE+  L++  GF  FR     F   V+EF K
Sbjct  336  TKEEFEALAKGAGFEGFRVMCSAFNTYVMEFLK  368



>gb|ADR31604.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=216

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  5    PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTG  64

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  65   AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  123

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  124  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  182

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  183  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  215



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+GK    N +    MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMNAFDYHGKDLRFNKIFNNGMSSHSTITMKKILENYKGFEGLNSVVDVGGGIG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIF+KW+   W
Sbjct  214  ATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVEHVGGDMFVSVPKGDAIFIKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  +++++  D  +M  +   GK R
Sbjct  273  SDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDTSLASKVVIHVDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+R L+++ GF  F+     F   ++EF K
Sbjct  332  TEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 134/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  ++ Y+GK    N +  K MS  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAHGMTSFEYHGKDLRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDTSLATKGVIHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  331  TEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF +A G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  147  PFNRAYGMSAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLNSVVDVGGGTG  206

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  207  AVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  265

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  266  SDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKER  324

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ LS++ GF  F+     F   V+EF K
Sbjct  325  TEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>emb|CBI23095.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G   + Y+G +P  N +    +SG     MK  L+ Y GFEG+T +VDVGG  G
Sbjct  24   PFNKAYGMTDFEYHGTEPRFNKVFNNGVSGHPTITMKKILEAYKGFEGLTSIVDVGGGTG  83

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM   W
Sbjct  84   ATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWMCYEW  142

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   GK R
Sbjct  143  DDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKTAVHIDV-IMLAYNTGGKAR  201

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  202  TEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  234



>ref|XP_008803441.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Phoenix dactylifera]
Length=362

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  A+ Y+G  P  N +  + M+  +  F+K  LD Y GFEG+  LVDVGG  G
Sbjct  152  PFTKAHGMTAFEYHGTDPRFNKVFNQGMANHATLFVKKMLDTYEGFEGLKDLVDVGGGLG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P I +GINFDLP V+ +AP IPG+ HVGGDMF SIP  DAIFMKW+L  W
Sbjct  212  ATLHMIASKYPHI-KGINFDLPHVISEAPVIPGVVHVGGDMFSSIPRADAIFMKWILHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C  I+ +C+ ALP  GK++  E +LP   +    T++    D+ ++T Y   GK R
Sbjct  271  SDEHCLNILKNCWKALPDNGKVIVAECLLPEAPETNAETQIRYYADLAMLT-YNIGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GFS F+A        V+EF K
Sbjct  330  TKKEFESLAKEAGFSRFKAECCVLNIWVMEFLK  362



>gb|AGS49206.1| O-methyltransferase [Zea mays]
Length=364

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAIASRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTETTPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24337.1| O-methyltransferase [Zea mays]
 gb|AAQ24349.1| O-methyltransferase [Zea mays]
 gb|AAQ24352.1| O-methyltransferase [Zea mays]
 gb|AAQ24367.1| O-methyltransferase [Zea mays]
 gb|AAQ24369.1| O-methyltransferase [Zea mays]
Length=364

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF +A G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  147  PFNRAYGMSAFEYHGTDPRFNKVFNKRMSDHSTITMKKILETYKGFEGLNSVVDVGGGTG  206

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  207  AVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  265

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  266  SDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDASLATKGVIHIDL-IMLAHNPGGKER  324

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ LS++ GF  F+     F   V+EF K
Sbjct  325  TEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>gb|AGS49190.1| O-methyltransferase [Zea mays]
Length=364

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVEHVGGDMFVSVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYNALPANGKVIVAECILPVAPDTSLATKSVIHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E+E+  L++  GF  F+     F   V+EF K
Sbjct  331  NEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLLENYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +C+ ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCHAALPDNGKVIVAECILPVAPDTSLATKGVVHIDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF +A G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  147  PFNRAYGISAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLNSVVDVGGGTG  206

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  207  AVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  265

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  266  SDHHCLKFLKNCYDALPEHGKVIVAECILPVAPDASLATKGVIHIDL-IMLAHNPGGKER  324

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ LS++ GF  F+     F   V+EF K
Sbjct  325  TEKEFQALSKAAGFLGFKVHCCAFNTYVMEFLK  357



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFDYHGTDPRFNKVFNRGMSDHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +G NFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLSMIVSKYPSI-KGTNFDLPHVIEDAPSFPGVEHVGGDMFASVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C   + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLNFLKNCYDALPANGKVIVAECILPVAPDSSLATKGVIHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   V+EF K
Sbjct  331  TEKEFEALAKGAGFQGFQVMCCAFNSYVMEFLK  363



>gb|AAQ24338.1| O-methyltransferase [Zea mays]
 gb|AAQ24360.1| O-methyltransferase [Zea mays]
Length=364

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFDEGMKNHSVIIAKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGITAFEYHGTDPRFNKVFNKGMADNSTITMKKLLENYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+  GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVSKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDGSLATKEVVHSDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNTVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVEHVGGDMFVSVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYSALPANGKVIVAECILPVAPDASLATKSVIHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E+E+  L++  GF  F+     F   V+EF K
Sbjct  331  NEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   S+   K  L+ Y GFE +  LVDVGG  G
Sbjct  157  PFNKAYGMTAFEYHGTDPRFNNVFNEGMKNHSIVITKKLLESYKGFEDINVLVDVGGGIG  216

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P I +GINFDLP V+ +AP +PG+ HVGGDMF SIP+GDAI MKW++  W
Sbjct  217  ATLHMITSKYPHI-KGINFDLPHVISEAPPLPGVEHVGGDMFASIPSGDAILMKWIMHDW  275

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ +CY ALP  G+++ CE +LP+  +     + +   D+ +M  +   GK R
Sbjct  276  SDEHCAKILENCYKALPNNGRVILCECILPVAPEPVPSAQGVFHLDM-IMLAHNPGGKER  334

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  335  TEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ L++  GF  F      F   V+EF K
Sbjct  331  TEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFE +  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFESLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ KHP+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFASVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   ++EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ L++  GF  F      F   V+EF K
Sbjct  331  TEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|AIY22648.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
Length=224

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  L+ Y GFEGV+ LVDVGG  G
Sbjct  14   PFNKAYGVTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFEGVSTLVDVGGGIG  73

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I   HP I +G+NFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+L  W
Sbjct  74   ATLHAITSHHPQI-RGVNFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDW  132

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+   + + +   D+ +M  +   G+ R
Sbjct  133  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPGGRER  191

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R L++  GFS F+A Y+      +EF K
Sbjct  192  YEREFRDLAKGAGFSGFKATYIYANAWAIEFIK  224



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ L++  GF  F      F   V+EF K
Sbjct  331  TEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ YYG     N +  + M   S    K  LD Y GFEGV  LVDVGG  G
Sbjct  152  PFNKAYGMSAFEYYGADARFNKVFNEGMRNHSTILTKKLLDIYRGFEGVKVLVDVGGGIG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  KHP I +GINFDLP V+ +AP  PG+ H+GGDMF S+P GDAIFMKW+L  W
Sbjct  212  ATLYMITTKHPRI-RGINFDLPHVISEAPPFPGVEHIGGDMFASVPRGDAIFMKWILHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ +C  ALP+ GK++  E VLP+  + T R + +   D+ +M  +   GK R
Sbjct  271  SDEHCTKILKNCCEALPEKGKVIVVECVLPVVPEPTPRAQGVFNIDL-IMLAHNPGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GFS F+A Y+     V+EF K
Sbjct  330  TEKEFEGLAKEAGFSGFKASYIFANTWVMEFTK  362



>gb|AGS49196.1| O-methyltransferase [Zea mays]
Length=364

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASAPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYVNAWAIEFIK  364



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GF+G+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILETYDGFDGLKTLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF+S+P GDAIFMKW+   W
Sbjct  213  ATINMIVSKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFESVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + ++ CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  272  SDEHCSKFLNKCYEALPDNGKVIVAECILPDYPDASLATKLVVHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  FR     F   ++EF K
Sbjct  331  TQKEFEALAKGAGFQGFRVKCCAFGTYIMEFLK  363



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = -2

Query  488  KAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACE  309
            + P+IP +TH+GG MFKSI   DAIFMKW+LTTW D+ECK IM +CY ALP GG+L+ACE
Sbjct  55   QRPSIPRVTHIGGGMFKSIHAVDAIFMKWVLTTWTDDECKLIMENCYKALPAGGELIACE  114

Query  308  PVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFY  129
            PVLP  ++++QRTR LLEGDIFVMTIYRAKGKHR E+E++QL  S  F   RAFY D+F+
Sbjct  115  PVLPDDSNESQRTRALLEGDIFVMTIYRAKGKHRIEQEFKQLGFSASFPHLRAFYFDYFH  174

Query  128  TVLEFQK  108
            T+LEFQK
Sbjct  175  TLLEFQK  181



>gb|AGS49210.1| O-methyltransferase [Zea mays]
Length=364

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+  M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-TMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_008382714.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=229

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 130/213 (61%), Gaps = 6/213 (3%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N    K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  21   PFNKAYGMTAFEYHGTDPRFN----KGMANHSTITMKNLLENYNGFEGLTSIVDVGGGTG  76

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  77   IVLNMIVFKYPSI-KGINFDLPYVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  135

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D  +M  +   GK R
Sbjct  136  SDEHCLKFLKNCYSALPDNGKVIVAECILPVAPDSSLATKGVVHIDA-IMLAHNPGGKER  194

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  195  TEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  227



>gb|AAQ24339.1| O-methyltransferase [Zea mays]
Length=364

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKDHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK +  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+PN DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPNADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+   GF  F      F   V+EF+K
Sbjct  331  TEKEFEGLANGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|AAQ24345.1| O-methyltransferase [Zea mays]
 gb|AAQ24354.1| O-methyltransferase [Zea mays]
Length=358

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 126/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|KDO38695.1| hypothetical protein CISIN_1g037818mg, partial [Citrus sinensis]
Length=199

 Score =   191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPFVK +GEPAYSYYGK PEMNGLM KAMSGVSVPF+ + LDGY+GF+GV +LVDVGGSA
Sbjct  84   EPFVKVHGEPAYSYYGKMPEMNGLMRKAMSGVSVPFITSVLDGYNGFKGVKQLVDVGGSA  143

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKW  402
            GDCLRMI++KH  I +GINFDLPEVV +AP+I G+TH+GGD FKSIP  DAIFMKW
Sbjct  144  GDCLRMILQKHRFICEGINFDLPEVVGEAPSILGVTHIGGDTFKSIPAADAIFMKW  199



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ VM  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDV-VMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF   R     F   V+EF K
Sbjct  331  TEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKLLETYKGFEGLNSVVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+  +PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLSMIVSNYPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + SCY ALP  GK++  E +LP+  D +  T+ +   D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKSCYDALPNNGKVIVAECILPVAPDTSLATKGVAHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E+E++ L++  GF  FR     F   V+EF K
Sbjct  331  AEKEFQALAKGAGFQGFRVVCSAFNTYVMEFLK  363



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  ++ Y+GK    N +  K M+  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAHGMTSFEYHGKDLRFNKVFNKGMADHSTITMKKILETYTGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI  GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVISMIVSKYPSI-NGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP+ GK++  E +LP   D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCVKFLKNCYDALPENGKVIVAECILPASPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF  FR     F   ++EF K
Sbjct  331  TEKEFEALAKAAGFQGFRVCCSAFNTYIMEFLK  363



>gb|AIY22649.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
 gb|AIY22650.1| caffeic acid 3-O-methyl transferase, partial [Miscanthus sp. 
LK-2014]
Length=224

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 127/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  L+ Y GFEGV+ LVDVGG  G
Sbjct  14   PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFEGVSTLVDVGGGIG  73

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I   HP I +GINFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+L  W
Sbjct  74   ATLHAITSHHPQI-KGINFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDW  132

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+   + + +   D+ +M  +   G+ R
Sbjct  133  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPGGRER  191

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+  L++  GFS F+A Y+      +EF K
Sbjct  192  YEREFHDLAKGAGFSGFKATYIYANAWAIEFIK  224



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVINMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   V+EF K
Sbjct  331  TEKEFEALAKGAGFQGFQVLCCAFNSYVMEFLK  363



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +    MSG S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  152  PFNKAYGMTAFEYHGTDPRFNKVFNNGMSGHSTITMKKILEAYKGFEGLTSIVDVGGGTG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I +GINFDLP V+  AP+ PG+ +VGGDMF S+P GDAIFMKW+   W
Sbjct  212  ATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVENVGGDMFVSVPKGDAIFMKWICHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  271  SDAHCLKFLKNCYQALPDNGKVIVAECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  330  TEKEFEALAKGAGFQGFKVVCCAFNTWIMEFCK  362



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AIINMIVSKYPNI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   ++EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVLCSAFNSYIMEFLK  363



>ref|XP_009608171.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana tomentosiformis]
Length=363

 Score =   195 bits (495),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMSMKKILEDYKGFEGLNSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ KHPSI +GINFDLP V+  AP  PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  ATVNMIVSKHPSI-KGINFDLPHVIGDAPAYPGVEHVGGDMFASVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP   D +  T+  +  DI VM  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPANGKVIIAECILPEAPDTSLATKNTVHVDI-VMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF+ FR     +   V+EF K
Sbjct  331  TEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>ref|XP_010934981.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=240

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   S+   K  L+ Y GFE V  LVDVGG  G
Sbjct  30   PFNKAYGMTAFEYHGTDPRFNKVFSEGMKNHSIIITKKLLEFYKGFEDVNVLVDVGGGIG  89

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P I +GINFDLP V+ +AP  PG+ HVGGDMF S+P+GDAI MKW++  W
Sbjct  90   ATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEHVGGDMFTSVPSGDAILMKWIMHDW  148

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ +CY ALP  GK++ CE +LP+  +     + +   D+ +M  +   GK R
Sbjct  149  SDEHCAKILENCYKALPNNGKVILCECILPVAPEPVPSAQSVFHLDM-IMLAHNPGGKER  207

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE++Y+ L++  GF+ F+A Y      VL F K
Sbjct  208  TEKQYQDLTKRAGFTGFKAQYCFSTAWVLVFTK  240



>gb|AGS49197.1| O-methyltransferase [Zea mays]
Length=364

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I   HP I+ G+NF+LP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSHHPHIS-GVNFNLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRKLAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=224

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  12   PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  71

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  72   AVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDW  130

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  131  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  189

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   ++EF K
Sbjct  190  TQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AAQ24355.1| O-methyltransferase [Zea mays]
Length=358

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKDHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK +  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKAIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AGS49189.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYAGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 132/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ ++T +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDVIMLT-HNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   V+EF K
Sbjct  331  TEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSFPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|AGF25396.1| caffeic acid 3-O-methyltransferase [Zea nicaraguensis]
Length=364

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q06509.1|COMT1_MAIZE RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Zea mays]
 gb|AAB03364.1| O-methyltransferase [Zea mays]
 gb|AAQ24346.1| O-methyltransferase [Zea mays]
 gb|AAQ24347.1| O-methyltransferase [Zea mays]
 gb|AGS49180.1| O-methyltransferase [Zea mays]
 gb|AGS49218.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49187.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49185.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|NP_001106047.1| catechol O-methyltransferase [Zea mays]
 gb|AAQ24340.1| O-methyltransferase [Zea mays]
 gb|AAQ24341.1| O-methyltransferase [Zea mays]
 gb|ABQ58826.1| flavonoid O-methyltransferase [Zea mays]
 gb|AFW61191.1| brown midrib3 [Zea mays]
 gb|AGS49212.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49215.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+  +G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFENHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49205.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49191.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006594705.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Glycine max]
Length=298

 Score =   192 bits (488),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -2

Query  749  EPFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSA  570
            EPF +ANGEPAY YY K PEMN LM++AMSGVSVPF++A L+GY GF+GV +LVDVGGS 
Sbjct  142  EPFERANGEPAYGYYLKHPEMNDLMVRAMSGVSVPFIRAMLEGYDGFQGVEKLVDVGGSG  201

Query  569  GDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMK  405
            GDCLRMI+EKHP+I +GINFDLPEVV KAP IP +THVGGDMFK IP GDAIFMK
Sbjct  202  GDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPFVTHVGGDMFKFIPQGDAIFMK  256



>gb|AEW26209.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
Length=224

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  12   PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  71

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  72   AXINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDW  130

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  131  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  189

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   ++EF K
Sbjct  190  TQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|AGS49195.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49216.1| O-methyltransferase [Zea mays]
Length=364

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ + P  PG+ HVGGDMF S+P GDAI +KW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISETPPFPGVRHVGGDMFASVPAGDAILVKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHVDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|EMT14045.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=197

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 118/197 (60%), Gaps = 48/197 (24%)
 Frame = -2

Query  554  MIMEKHPSITQGINFDLPEVVQKA------------------------------------  483
            MIM + P+I +G+NFDLP VV  A                                    
Sbjct  1    MIMRRVPTIREGVNFDLPNVVAAAHPIAEVFTCSEFRVSTSTVDEFDSEVSVQSTLVLLA  60

Query  482  ----PNIP--------GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGAL  339
                 N+P        G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+  C+ AL
Sbjct  61   ILAKKNLPVQVQSDCAGVKHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKKCHEAL  120

Query  338  PQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSS  159
            P+GGKL+ACEPV+P  TD + RTR LLE DIFVMT YR +G+ R+EEE+RQL  + GF+ 
Sbjct  121  PEGGKLIACEPVVPDTTDASTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGLTAGFAG  180

Query  158  FRAFYVDFFYTVLEFQK  108
            FRA Y+D FY VLE+ K
Sbjct  181  FRALYLDPFYAVLEYVK  197



>ref|XP_010662844.1| PREDICTED: caffeic acid O-methyltransferase isoform X1 [Vitis 
vinifera]
Length=372

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G   + Y+G +P  N +    +SG     MK  L+ Y GFEG+T +VDVGG  G
Sbjct  160  PFNKAYGMTDFEYHGTEPRFNKVFNNGVSGHPTITMKKILEAYKGFEGLTSIVDVGGGTG  219

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM   W
Sbjct  220  ATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWMCYEW  278

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   GK R
Sbjct  279  DDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKTAVHIDV-IMLAYNTGGKAR  337

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  338  TEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  370



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   194 bits (493),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILEIYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+  G+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  213  AVINTIVSKYPTI-KGINFDLPHVIEDAPSYQGVEHVGGDMFASIPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++S GF  F+ F   F   ++EF K
Sbjct  331  TEKEFEALAKSAGFQGFKVFCSAFNTYIMEFLK  363



>gb|AEW26163.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score =   190 bits (482),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  12   PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  71

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  72   AVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDW  130

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  131  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  189

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L +  GF  F+     F   ++EF K
Sbjct  190  TQKEFEDLXKGAGFQGFKVHCNAFNTYIMEFLK  222



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+EF+K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVVNMIVSKYPTI-KGINFDLPHVIGDAPSYPGVEHVGGDMFVSVPEADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   V+EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVLCCAFNTYVMEFLK  363



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  ++ Y+GK    N +  K M+  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAHGMTSFEYHGKDARFNKVFNKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V+++AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVINTIVSKYPSI-KGINFDLPHVIEEAPSFPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCVKFLKNCYDALPENGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   ++EF K
Sbjct  331  TEKEFEALAKGAGFQGFRVCCSAFNSYIMEFLK  363



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   V+EF K
Sbjct  331  TEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|AGS49181.1| O-methyltransferase [Zea mays]
Length=364

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDLHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILELYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPNNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   ++EF K
Sbjct  331  TEKEFEALAKGAGFQGFHVLCCAFNTYIMEFLK  363



>ref|NP_001268100.1| caffeic acid O-methyltransferase [Vitis vinifera]
 gb|AAF44672.1|AF239740_1 caffeic acid O-methyltransferase [Vitis vinifera]
Length=386

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G   + Y+G +P  N +    +SG     MK  L+ Y GFEG+T +VDVGG  G
Sbjct  174  PFNKAYGMTDFEYHGTEPRFNKVFNNGVSGHPTITMKKILEAYKGFEGLTSIVDVGGGTG  233

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I +GINFDLP V+  AP+ PG+ HVGGDMF S+P GDAIFMKWM   W
Sbjct  234  ATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVEHVGGDMFVSVPKGDAIFMKWMCYEW  292

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP  GK++  E +LP+  D +  T+  +  D+ +M  Y   GK R
Sbjct  293  DDAHCLKFLENCYQALPDNGKVIVAECILPVVPDTSLATKSAVHIDV-IMLAYNTGGKAR  351

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F   ++EF K
Sbjct  352  TEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  384



>gb|AGS49199.1| O-methyltransferase [Zea mays]
Length=364

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD   GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTGPRFNRVFNEGMKNHSVIITKKLLDFCTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  AVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   GK R
Sbjct  273  SDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   V+EF K
Sbjct  332  TQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>ref|XP_006478221.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=352

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 135/215 (63%), Gaps = 6/215 (3%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF + +G  A+ Y G  P  N +   AM   +   ++  L+ Y GFE + +LVDVGGS G
Sbjct  142  PFDRVHGTNAFEYLGLDPRFNEVFSTAMYNHTTLVLQKILEAYKGFEHIKQLVDVGGSLG  201

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
            + LR I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+L  W
Sbjct  202  NTLREITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWILHDW  260

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY ++P+GGK++  E VLP   + +  +++    D+ VMT Y   GK R
Sbjct  261  SDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-GKER  319

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  108
            T+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  320  TKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AAQ24342.1| O-methyltransferase [Zea mays]
Length=359

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24344.1| O-methyltransferase [Zea mays]
 gb|AAQ24358.1| O-methyltransferase [Zea mays]
 gb|AAQ24362.1| O-methyltransferase [Zea mays]
Length=359

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AGS49211.1| O-methyltransferase [Zea mays]
Length=364

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y       +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYTYANAWAIEFIK  364



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  AVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   GK R
Sbjct  273  SDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   V+EF K
Sbjct  332  TQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|AAQ24343.1| O-methyltransferase [Zea mays]
 gb|AAQ24353.1| O-methyltransferase [Zea mays]
 gb|AAQ24364.1| O-methyltransferase [Zea mays]
Length=359

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFE +  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKILETYTGFESLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ KHP+I +GINFDLP V++ AP+ PG+ +VGGDMF S+P  DAIFMKW+   W
Sbjct  213  AVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVEYVGGDMFASVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  + +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYQALPDNGKVIVAQCILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F   ++EF K
Sbjct  331  TEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  AVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   GK R
Sbjct  273  SDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   V+EF K
Sbjct  332  TQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|AAQ24351.1| O-methyltransferase [Zea mays]
 gb|AAQ24357.1| O-methyltransferase [Zea mays]
 gb|AAQ24359.1| O-methyltransferase [Zea mays]
Length=358

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24361.1| O-methyltransferase [Zea mays]
Length=359

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AGS49219.1| O-methyltransferase [Zea mays]
Length=364

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  + +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFDRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
               E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  HGREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AEO14871.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MSG S   MK  L+ Y GF+G+  +VDVGG  G
Sbjct  154  PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKILETYKGFDGLNSVVDVGGGIG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  ATLHMIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALPQ GK++  E VLP   D    T+ ++  D+ +M  +   GK R
Sbjct  273  SDEHCLKFLKNCYDALPQNGKVILAECVLPEAPDSGLATKNVVHIDV-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF         +   +LE  K
Sbjct  332  TEKEFHNLAKAAGFKHLNKACCAYNTWILELLK  364



>gb|AAQ24348.1| O-methyltransferase [Zea mays]
 gb|AAQ24350.1| O-methyltransferase [Zea mays]
 gb|AAQ24356.1| O-methyltransferase [Zea mays]
 gb|AAQ24363.1| O-methyltransferase [Zea mays]
 gb|AAQ24365.1| O-methyltransferase [Zea mays]
 gb|AAQ24366.1| O-methyltransferase [Zea mays]
 gb|AAQ24368.1| O-methyltransferase [Zea mays]
 gb|AAQ24370.1| O-methyltransferase [Zea mays]
Length=358

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 125/202 (62%), Gaps = 2/202 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYV  141
             E E+R+L++  GFS F+A Y+
Sbjct  332  YEREFRELAKGAGFSGFKATYI  353



>gb|AGS49214.1| O-methyltransferase [Zea mays]
Length=364

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIIAKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVSTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A         +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATCTYANAWAIEFIK  364



>gb|EMT30204.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=339

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y G  P  N +  +AM   S+   K  L+ Y GF+GV  LVDVGG  G
Sbjct  129  PFEKAYGMTAFDYQGTDPRFNRVFNEAMKTHSMIITKKLLEFYKGFDGVGTLVDVGGGVG  188

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ ++PSI +G+NFDLP V+ +AP+  G+ H+GGDMFK +P+GDAI MKW+L  W
Sbjct  189  ATIHTILCRYPSI-EGVNFDLPHVISEAPSFAGVHHIGGDMFKKVPSGDAILMKWILHDW  247

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C  ++S+CY ALP  GK+V  E +LP++ D+T   +   E D+ ++T +   GK R
Sbjct  248  NDEHCTTLLSNCYDALPAHGKVVIVEYILPVKPDETATAQRSFEADMIMLT-HTPGGKER  306

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
               EY +L+RS GF+S +A YV     V+E  K
Sbjct  307  YLREYEELARSAGFASVKATYVYSNIWVIELNK  339



>sp|P59049.1|OMT1_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 1; AltName: Full=Flavonol 
3-O-methyltransferase 1 [Chrysosplenium americanum]
Length=343

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  ++ Y+G  P  N +  + MS  S   MK     Y GF+G+T LVDVGG  G
Sbjct  129  PFNKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQAYQGFQGLTSLVDVGGGTG  188

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I + INFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+   W
Sbjct  189  ATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDW  247

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY ALP  GK++  E +LP   D +  T+ ++  D+  +  +   GK R
Sbjct  248  SDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVA-HNPGGKER  306

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  307  TEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>ref|XP_006441468.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
 gb|ESR54708.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
Length=352

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 135/215 (63%), Gaps = 6/215 (3%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF + +G  A+ Y G  P  N +   AMS  +   ++  L+ Y GFE + +LVDVGGS G
Sbjct  142  PFDRVHGTNAFEYLGLDPRFNEVFSTAMSNHTTLVLQKILEAYKGFEHIKQLVDVGGSLG  201

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
            + L+ I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+L  W
Sbjct  202  NTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWILHDW  260

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY ++P+ GK++  E VLP   + +  +++    D+ VMT Y   GK R
Sbjct  261  SDEHCLKLLKNCYKSIPEDGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-GKER  319

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  108
            T+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  320  TKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>ref|XP_009757562.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=363

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTMSMKKILEDYKGFEGLNSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI +GINFDLP V+  AP  PG+ HVGGDMF S+P  DAIFMKW+   W
Sbjct  213  ATVNMIVSKYPSI-KGINFDLPHVIGDAPTYPGVEHVGGDMFASVPKADAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP   D +  T+  +  DI VM  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPANGKVIIAECILPEAPDTSLATKNTVHVDI-VMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF+ FR     +   V+EF K
Sbjct  331  TEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  LD Y GF+G+  LVDVGG  G
Sbjct  175  PFNKAYGMTAFEYHGTDPRFNKVFNRGMSDHSTITMKKILDTYDGFQGLKTLVDVGGGTG  234

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  235  ATLSMIVSKYPTI-KGINFDLPHVIEDAPSCPGVEHVGGDMFVSVPKGDAIFMKWICHDW  293

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP   D +  T+L++  D  +M  +   GK R
Sbjct  294  SDEHCAKFLKNCYEALPDNGKVIVAECILPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  352

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T +E+  L++  GF  F+     F   ++EF K
Sbjct  353  TAKEFEALAKGAGFQGFQITCSAFGTNIMEFLK  385



>gb|AAD48913.1|AF139533_1 caffeate O-methyltransferase [Liquidambar styraciflua]
Length=367

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +    MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  155  PFNKAYGMTAFEYHGTDPRFNTVFNNGMSNHSTITMKKILETYKGFEGLGSVVDVGGGTG  214

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P I +GINFDLP V+++AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  215  AHLNMIIAKYPMI-KGINFDLPHVIEEAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  273

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + +  CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  274  SDEHCLKFLKKCYEALPTNGKVILAECILPVAPDASLPTKAVVHIDV-IMLAHNPGGKER  332

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     +   ++EF K
Sbjct  333  TEKEFEALAKGAGFEGFRVALCAYNTWIIEFLK  365



>gb|AGS49183.1| O-methyltransferase [Zea mays]
Length=364

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +    + +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFH-VVMIMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYADAWAIEFIK  364



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   S+   K  L+ Y GFE V  LVDVGG  G
Sbjct  157  PFNKAYGMTAFEYHGTDPRFNKVFNEGMKNHSIIITKKLLEFYKGFEDVNVLVDVGGGIG  216

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+P I +GINFDLP V+ +AP  PG+ H+GGDMF S+P+GDAI MKW++  W
Sbjct  217  ATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEHIGGDMFASVPSGDAILMKWIMHDW  275

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +I+ +C+ ALP  GK++ CE +LP+  +     + +   D+ +M  +   GK R
Sbjct  276  SDEHCAKILENCHKALPNNGKVILCECILPVAPEPIPSAQGVFHVDM-IMLAHNPGGKER  334

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  335  TEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>gb|EYU31472.1| hypothetical protein MIMGU_mgv1a019059mg, partial [Erythranthe 
guttata]
Length=242

 Score =   189 bits (479),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 129/198 (65%), Gaps = 2/198 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G   + Y    P  N +  +AMS  S   +K  L+ Y GFEG+  +VDVGG  G
Sbjct  32   PFAKAYGMNVFEYGDTDPRFNKVFDQAMSNYSTIVVKKILEIYDGFEGIESVVDVGGGTG  91

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V+Q AP+ PG+ H+GGDMF S+P GDAIFMKW++  W
Sbjct  92   AILNMIISKYPSI-KGINFDLPHVIQHAPSYPGVEHIGGDMFVSVPKGDAIFMKWIVHDW  150

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE+C +++ +C+ +L + GK++  E ++P + D +  T+ +L  D+ ++T +   G+ R
Sbjct  151  SDEQCLKLLKNCHNSLQENGKVILAELIMPEEPDKSVATKTVLHSDVLMLT-HNPGGRER  209

Query  206  TEEEYRQLSRSVGFSSFR  153
            TE+E+  L+++ GF  FR
Sbjct  210  TEKEFHTLAKAAGFREFR  227



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYAALPDNGKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T +E+  L++  GF   R     F   V+EF K
Sbjct  331  TGQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>gb|AGS49184.1| O-methyltransferase [Zea mays]
Length=364

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP ++ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHVS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E  LP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECALPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006441599.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 ref|XP_006441601.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
 gb|ESR54839.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 gb|ESR54841.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
Length=352

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 135/215 (63%), Gaps = 6/215 (3%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF + +G  A+ Y G  P  N +   AM   +   ++  L+ Y GFE + +LVDVGGS G
Sbjct  142  PFDRVHGTNAFEYLGLDPRFNEVFSTAMFNHTTLVLQKILEAYKGFEHIKQLVDVGGSLG  201

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
            + L+ I  K+P I +GINFDLP V+Q +P  PG+ HVGGDMF+S+PNGDAI +KW+L  W
Sbjct  202  NTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVKHVGGDMFQSVPNGDAILIKWILHDW  260

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY ++P+GGK++  E VLP   + +  +++    D+ VMT Y   GK R
Sbjct  261  SDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPETSTHSKINSLADVLVMTQYPG-GKER  319

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  108
            T+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  320  TKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>ref|XP_010061962.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 135/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  A+ Y G  P  N +  +AMS  S   MK  L+ Y+GFEG+  +VDVGG  G
Sbjct  154  PFHKAHGMTAFDYPGIDPRFNKIFNRAMSDHSTIMMKKILETYNGFEGLKTVVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+  G+ HVGGDMF +IPNGDA+FMKW+   W
Sbjct  214  AMLNMIVAKYPSI-KGINFDLPHVIEDAPSYRGVEHVGGDMFVNIPNGDAVFMKWICHNW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY  LP  G+++  E +LP+  D +  T+  +  D  ++T + + GK R
Sbjct  273  SDEHCAKLLKNCYDVLPVNGRVIVAEYILPVYPDRSLSTKGAIHMDCIMLTHF-SGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F  +++EF K
Sbjct  332  TEKEFEALAKGAGFQDFQVTCHAFNTSIMEFLK  364



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M+  S   M+  L+ Y GFEGV  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNRGMNDHSTTTMRKILETYDGFEGVKTLVDVGGGIG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  ASLSMIISKHPSI-KGINFDLPHVIEDAPAYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E  LP   D +  T+L++  D  +M  +   GK R
Sbjct  272  SDEHCSKFLKNCYQALPDNGKVIVAECNLPDYPDPSLATKLVVHIDC-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T +E+  L++  GF  F+     F   ++EF K
Sbjct  331  TAKEFEALAKGAGFQGFQVKCCAFGTYIMEFLK  363



>gb|KCW90804.1| hypothetical protein EUGRSUZ_A02870 [Eucalyptus grandis]
Length=357

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 134/213 (63%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA+G  A+ Y G  P  N +  +AMS  S   MK  L+ Y+GFEG+  +VDVGG  G
Sbjct  145  PFHKAHGMTAFDYPGIDPRFNKIFNRAMSDHSTIMMKKILETYNGFEGLKTVVDVGGGTG  204

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+  G+ HVGGDMF +IPNGDA+FMKW+   W
Sbjct  205  AMLNMIVAKYPSI-KGINFDLPHVIEDAPSYRGVEHVGGDMFVNIPNGDAVFMKWICHNW  263

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY  LP  G+++  E +LP+  D +  T+  +  D  ++T +   GK R
Sbjct  264  SDEHCAKLLKNCYDVLPVNGRVIVAEYILPVYPDRSLSTKGAIHMDCIMLTHFSG-GKER  322

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F+     F  +++EF K
Sbjct  323  TEKEFEALAKGAGFQDFQVTCHAFNTSIMEFLK  355



>ref|XP_004307899.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   192 bits (488),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  153  PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLKSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVVNMIVAKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCIKFLKNCYAALPDDGKVILGECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF   R     F   V+EF K
Sbjct  331  TEQEFEALAKGSGFQGIRVCCDAFNTYVIEFLK  363



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 133/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF + +G  A+ Y G  P  N +   AM   +   ++  L+ Y GFE + +LVDVGGS G
Sbjct  142  PFDRVHGTHAFEYLGLDPRFNEVFSTAMYNHTTLVIQKILEAYKGFEHIKQLVDVGGSLG  201

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
            + L+ I+ K+P I +GINFDLP V+Q AP  PG+ HVGGDMF+S+PNGDAI +KW+L  W
Sbjct  202  NTLKAIISKYPHI-KGINFDLPHVIQHAPEYPGVKHVGGDMFRSVPNGDAILIKWILHDW  260

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +C+ ++P+GGK++  E VLP   + +  +++   GD+ VMT Y   GK R
Sbjct  261  SDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPETSTHSKINFLGDVLVMTQYPG-GKER  319

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T+ E+  L+   GFS  R     F   V+EF K
Sbjct  320  TKHEFMTLATGAGFSGVRFDCFFFNLWVMEFHK  352



>sp|P46484.1|COMT1_EUCGU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Eucalyptus gunnii]
 emb|CAA52814.1| 0-Methyltransferase [Eucalyptus gunnii]
Length=366

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  AVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   GK R
Sbjct  273  SDDHCAKFLKNCYDALPNIGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   V+EF K
Sbjct  332  TQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|AGS49200.1| O-methyltransferase [Zea mays]
Length=364

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVIFEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF +
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIR  364



>sp|Q42653.1|OMT2_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 2; AltName: Full=Flavonol 
3-O-methyltransferase 2 [Chrysosplenium americanum]
 gb|AAA86982.1| caffeic acid O-methyl transferase [Chrysosplenium americanum]
Length=343

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  ++ Y+G  P  N +  + MS  S   MK     Y GF+G+T LVDVGG  G
Sbjct  129  PFNKAYGMSSFEYHGTDPRFNKVFNRGMSDHSTITMKKVFQTYQGFQGLTSLVDVGGGTG  188

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+P+I + INFDLP V++ AP  PGI HVGGDMF S+P GDAIFMKW+   W
Sbjct  189  ATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIEHVGGDMFVSVPKGDAIFMKWICHDW  247

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C +++ +CY ALP  GK++  E +LP   D +  T+ ++  D+  +  +   GK R
Sbjct  248  SDEHCLKLLKNCYDALPNNGKVILAECILPEVPDSSLATKGVVHIDVITVA-HNPGGKER  306

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  307  TEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y+GFEG+T +VDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMADHSTITMKKLLEIYNGFEGLTSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI + INFDLP V++ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  213  AVLNMIVSKYPSI-KDINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E + P+  D +  T+ ++  D  +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYVALPDNGKVIVAECIFPVAPDSSLATKGVVHIDA-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  FR     F    +EF K
Sbjct  331  TEKEFEALAKGFGFQGFRVVCCAFNTYAIEFFK  363



>prf||1906376A O-methyltransferase
Length=364

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+E +K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIELRK  363



>gb|AEO14870.1| caffeic acid O-methyltransferase [Salvia miltiorrhiza]
Length=364

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MSG S   MK  L+ Y GF+G+  +VDVGG  G
Sbjct  154  PFNKAYGMSAFEYHGTDPRFNKVFNQGMSGHSTITMKKILETYKGFDGLNSVVDVGGGIG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  214  ATLHMIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALPQ GK++  E VLP   D    ++ ++  D+ +M  +   GK R
Sbjct  273  SDEHCLKFLKNCYDALPQNGKVILAECVLPEAPDSGLASKNVVHIDV-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+++ GF         +   +LE  K
Sbjct  332  TEKEFHNLAKAAGFKHLNKACCAYNTWILELLK  364



>dbj|BAG71895.1| 5-hydroxyconiferaldehyde O-methyltransferase [Carthamus tinctorius]
Length=356

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+GK    N +    M   S   MK  LD Y GF GV  LVDVGG  G
Sbjct  146  PFNKAYGMSAFEYHGKDERFNKVFNSGMFNHSTMTMKKILDVYPGFNGVKTLVDVGGGTG  205

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ KHPSI +GINFDLP V+Q A N PGI HVGGDMF+S+P GDAIFMKW+   W
Sbjct  206  ASLSMILSKHPSI-KGINFDLPHVIQDATNYPGIEHVGGDMFESVPKGDAIFMKWICHDW  264

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP   D +  T+ ++  D+ +M  +   GK R
Sbjct  265  SDAHCLKFLKNCYKALPENGKVIVAECILPETPDSSLATKNVVHIDV-IMLAHNPGGKER  323

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E++ L+++ GF  F          ++EF K
Sbjct  324  TEKEFQALAKAAGFKGFHKPCSALNTWLMEFTK  356



>gb|AAF60951.1| O-methyltransferase [Populus trichocarpa x Populus deltoides]
Length=364

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+E +K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIELRK  363



>ref|XP_011043758.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Populus euphratica]
Length=365

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVSTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDAHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+E +K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIELRK  363



>gb|AAF28353.1|AF220491_1 O-methyltransferase [Fragaria x ananassa]
Length=365

 Score =   192 bits (487),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K M+  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  153  PFNKAYGMTAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLKSIVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              + MI+ K+PSI +GINFDLP V++ AP  PG+ HVGGDMF S+P G+AIFMKW+   W
Sbjct  213  AVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGNAIFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCIKFLKNCYAALPDDGKVILAECILPVAPDTSLATKGVVHMDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF   R     F   V+EF K
Sbjct  331  TEQEFEALAKGSGFQGIRVCCDAFNTYVIEFLK  363



>ref|XP_011003285.1| PREDICTED: caffeic acid 3-O-methyltransferase 3 [Populus euphratica]
Length=364

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  152  PFNKAYGMSAFEYHGTDPRFNKVFNKGMSDHSKIAMKKILETYKGFEGLASLVDVGGGTG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I+ K+PSI +GINFDLP V+  AP  PG+ +VGGDMF S+P  DA+FMKW+   W
Sbjct  212  AVLSTIISKYPSI-KGINFDLPHVIADAPAFPGVENVGGDMFVSVPKADAVFMKWICHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C   + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  271  SDEHCLRFLKNCYDALPENGKVILVECILPVAPDTSLATKGVMHVDVIMMA-HNPGGKER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L+R  GF  F      F   V+EF+K
Sbjct  330  TEKEFEGLARGAGFKGFEVMCCAFNTYVIEFRK  362



>gb|AGS49207.1| O-methyltransferase [Zea mays]
Length=364

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K   D Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDSRFNRVFNEGMKNHSVIITKRLQDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ67347.1| caffeic acid 3-O-methyltransferase [Saccharum hybrid cultivar]
 gb|AIX94080.1| caffeic acid-0-methyltransferase [Saccharum hybrid cultivar]
Length=362

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 127/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  L+ Y GFEGV+ LVDVGG  G
Sbjct  152  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYTGFEGVSTLVDVGGGIG  211

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I   HP I +GINFDLP V+ +AP  PG+ HVGGDMFKS+P GDAI MKW+L  W
Sbjct  212  ATLHAITSHHPQI-KGINFDLPHVISEAPPFPGVQHVGGDMFKSVPAGDAILMKWILHDW  270

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+   + + +   D+ +M  +   G+ R
Sbjct  271  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAVPKAQGVFHVDM-IMLAHNPGGRER  329

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+  L++  GFS F+A Y+      +EF K
Sbjct  330  YEREFHDLAKGAGFSGFKATYIYANAWAIEFIK  362



>gb|AGS49188.1| O-methyltransferase [Zea mays]
Length=364

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G     N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDARFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
                C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SGAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49217.1| O-methyltransferase [Zea mays]
Length=364

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  LD Y G EG + LVDVGG  G
Sbjct  154  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKPLDFYTGVEGASTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEHEFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>dbj|BAO79382.1| hypothetical plant O-methyltransferase [Anthriscus sylvestris]
Length=365

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 127/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+GK P  N +    MS  S   MK  L+ Y+GF G+  +VDVGG  G
Sbjct  155  PFNKAYGMTAFEYHGKDPRFNKVFNLGMSNHSTITMKKILETYNGFAGLKTVVDVGGGTG  214

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI  K+PSI +GINFDLP VV+ AP  PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  215  ATLHMITSKYPSI-KGINFDLPHVVEDAPAYPGVEHVGGDMFVSVPEGDAIFMKWICHDW  273

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C   + +CY ALPQ GK++  E +LP   D    T+ ++  D+ +M  +   GK R
Sbjct  274  SDEHCLSFLKNCYKALPQNGKVILAECILPEAPDSKLTTKNVIHIDV-IMLAHNPGGKER  332

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L +  GF SF      +   V+E+ K
Sbjct  333  TEKEFEALGKEAGFKSFNKACCAYNTWVIEYLK  365



>gb|AGS49213.1| O-methyltransferase [Zea mays]
Length=364

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 128/212 (60%), Gaps = 2/212 (1%)
 Frame = -2

Query  743  FVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAGD  564
            F KA G  A+ Y+G  P  N +  + M   SV   K  LD Y  FEGV+ LVDVGG  G 
Sbjct  155  FNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLDFYPDFEGVSTLVDVGGGVGA  214

Query  563  CLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWM  384
             L  I  +HP I+ G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W 
Sbjct  215  TLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDWS  273

Query  383  DEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRT  204
            D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R 
Sbjct  274  DAHCATLLKNCYDALPENGKVIVVECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKERY  332

Query  203  EEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            E E+R+L++  GFS F+A Y+      +EF K
Sbjct  333  EREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ADR31603.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=203

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 126/204 (62%), Gaps = 2/204 (1%)
 Frame = -2

Query  719  AYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEK  540
            A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G  +  I+ K
Sbjct  1    AFEYHGTDPRFNKVFNKGMSDHSTITMKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSK  60

Query  539  HPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIM  360
            +PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W D  C + +
Sbjct  61   YPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFL  119

Query  359  SSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLS  180
             +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK RTE+E+  L+
Sbjct  120  KNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLA  178

Query  179  RSVGFSSFRAFYVDFFYTVLEFQK  108
            +  GF  F      F   V+EF+K
Sbjct  179  KGAGFQGFEVMCCAFNTHVIEFRK  202



>gb|ADX98508.1| caffeic acid 3-O-methyltransferase [Panicum virgatum]
Length=361

 Score =   191 bits (486),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + M   SV   K  L+ Y GFEGV  LVDVGG  G
Sbjct  151  PFNKAYGMTAFEYHGTDPRFNRVFNEGMKNHSVIITKKLLEFYAGFEGVGTLVDVGGGVG  210

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  ++P I +G+NFDLP V+ +AP  PG+ HVGGDMFK++P GDAI MKW+L  W
Sbjct  211  ATLHAITSRYPGI-RGVNFDLPHVISEAPPFPGVEHVGGDMFKAVPAGDAILMKWILHDW  269

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  I+ +CY ALP GGK++A E +LP+  + T + + +   D+ +M  +   GK R
Sbjct  270  SDAHCAAILKNCYDALPAGGKVIAVECILPVNPEATPKAQGVFHVDM-IMLAHNPGGKER  328

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+ +L++  GF+ F+A Y+      +EF K
Sbjct  329  YEREFEELAKGAGFTGFKATYIYANAWAIEFTK  361



>gb|AGS49198.1| O-methyltransferase [Zea mays]
Length=364

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 128/213 (60%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF +A G  A+ Y G  P  N +  + M   SV   K  LD Y GFEGV+ LVDVGG  G
Sbjct  154  PFNEAYGMTAFEYLGTDPRFNRVFNEGMKNHSVIITKKLLDFYTGFEGVSTLVDVGGGVG  213

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L  I  +HP I  G+NFDLP V+ +AP  PG+ HVGGDMF S+P GDAI MKW+L  W
Sbjct  214  ATLLAITSRHPHI-PGVNFDLPHVISEAPPFPGVRHVGGDMFASVPAGDAILMKWILHDW  272

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C  ++ +CY ALP+ GK++  E VLP+ T+ T + + +   D+ +M  +   GK R
Sbjct  273  SDAHCATLLKNCYDALPENGKVIVDECVLPVNTEATPKAQGVFHVDM-IMLAHNPGGKER  331

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
             E E+R+L++  GFS F+A Y+      +EF K
Sbjct  332  YEREFRELAKGAGFSRFKATYIYANAWAIEFIK  364



>gb|KCW89068.1| hypothetical protein EUGRSUZ_A01397 [Eucalyptus grandis]
Length=429

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  + MS  S   MK  L+ Y GFEG+  +VDVGG  G
Sbjct  217  PFNKAYGMTAFEYHGTDPRFNKIFNRGMSDHSTITMKKILETYKGFEGLETVVDVGGGTG  276

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              L MI+ K+PS+ +GINFDLP V++ AP +PG+ HVGGDMF S+P GDAIFMKW+   W
Sbjct  277  AVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVKHVGGDMFVSVPKGDAIFMKWICHDW  335

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D+ C + + +CY ALP  GK++  E VLP+  D +  T+ ++  D  +M  +   GK R
Sbjct  336  SDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDTSLATKNVIHIDC-IMLAHNPGGKER  394

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   V+EF K
Sbjct  395  TQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  427



>gb|ABU53653.1| caffeic acid O-3-methyltransferase [Populus deltoides]
Length=364

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+T LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+PSI +GINFDLP V++ AP+ PG+ HVGGDMF S+P  DA+FMKW+   W
Sbjct  213  AVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             D  C + + +CY ALP+ GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDVHCLKFLKNCYDALPENGKVILVECILPVAPDTSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            TE+E+  L++  GF  F      F   V+E +K
Sbjct  331  TEKEFEGLAKGAGFQGFEVMCCAFNTHVIELRK  363



>gb|ACY06328.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  213  AVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   ++EF K
Sbjct  331  TQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  363



>sp|P28002.1|COMT1_MEDSA RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Medicago sativa]
 pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYW|F Chain F, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde
 pdb|1KYZ|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|C Chain C, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 pdb|1KYZ|E Chain E, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic 
Acid 35-O-Methyltransferase Ferulic Acid Complex
 gb|AAB46623.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Medicago 
sativa]
Length=365

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 130/213 (61%), Gaps = 2/213 (1%)
 Frame = -2

Query  746  PFVKANGEPAYSYYGKKPEMNGLMLKAMSGVSVPFMKAFLDGYHGFEGVTRLVDVGGSAG  567
            PF KA G  A+ Y+G  P  N +  K MS  S   MK  L+ Y GFEG+  LVDVGG  G
Sbjct  153  PFNKAYGMTAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYTGFEGLKSLVDVGGGTG  212

Query  566  DCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTW  387
              +  I+ K+P+I +GINFDLP V++ AP+ PG+ HVGGDMF SIP  DA+FMKW+   W
Sbjct  213  AVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVEHVGGDMFVSIPKADAVFMKWICHDW  271

Query  386  MDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHR  207
             DE C + + +CY ALP  GK++  E +LP+  D +  T+ ++  D+ +M  +   GK R
Sbjct  272  SDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDSSLATKGVVHIDV-IMLAHNPGGKER  330

Query  206  TEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  108
            T++E+  L++  GF  F+     F   ++EF K
Sbjct  331  TQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840