BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF012G12

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF09256.1|AF202179_1  disease resistance protein BS2              73.6    2e-11   Capsicum chacoense
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   Nicotiana sylvestris
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  71.6    7e-11   Nicotiana sylvestris
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...  69.7    2e-10   
ref|XP_009764213.1|  PREDICTED: putative late blight resistance p...  66.6    2e-10   Nicotiana sylvestris
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  69.7    2e-10   Nicotiana tomentosiformis
emb|CDP12547.1|  unnamed protein product                              68.9    5e-10   Coffea canephora [robusta coffee]
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...  68.6    5e-10   Nicotiana tomentosiformis
ref|XP_006349899.1|  PREDICTED: putative late blight resistance p...  68.2    6e-10   
emb|CDP16510.1|  unnamed protein product                              67.4    2e-09   Coffea canephora [robusta coffee]
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  67.4    2e-09   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  66.6    2e-09   Solanum lycopersicum
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  66.6    3e-09   Sesamum indicum [beniseed]
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              66.6    3e-09   Erythranthe guttata [common monkey flower]
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  66.6    3e-09   Solanum lycopersicum
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  66.2    3e-09   Nicotiana sylvestris
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  66.2    4e-09   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  65.5    7e-09   
emb|CDP16515.1|  unnamed protein product                              65.1    7e-09   Coffea canephora [robusta coffee]
ref|XP_006367913.1|  PREDICTED: putative late blight resistance p...  63.2    9e-09   Solanum tuberosum [potatoes]
emb|CDP21316.1|  unnamed protein product                              62.0    9e-09   Coffea canephora [robusta coffee]
emb|CDP04753.1|  unnamed protein product                              64.7    1e-08   Coffea canephora [robusta coffee]
ref|XP_006367912.1|  PREDICTED: putative late blight resistance p...  63.2    1e-08   
emb|CDP17919.1|  unnamed protein product                              64.3    2e-08   Coffea canephora [robusta coffee]
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   Nicotiana sylvestris
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  63.5    2e-08   Nicotiana sylvestris
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
emb|CDP12774.1|  unnamed protein product                              63.9    2e-08   Coffea canephora [robusta coffee]
emb|CDP19634.1|  unnamed protein product                              63.9    2e-08   Coffea canephora [robusta coffee]
ref|XP_009618209.1|  PREDICTED: late blight resistance protein R1...  63.9    2e-08   Nicotiana tomentosiformis
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana sylvestris
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   Nicotiana tomentosiformis
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana sylvestris
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana tomentosiformis
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana tomentosiformis
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  63.2    3e-08   Nicotiana tomentosiformis
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  63.2    4e-08   Nicotiana tomentosiformis
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  63.2    4e-08   Nicotiana tomentosiformis
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              62.8    4e-08   Erythranthe guttata [common monkey flower]
emb|CDP20463.1|  unnamed protein product                              63.2    4e-08   Coffea canephora [robusta coffee]
ref|XP_006367977.1|  PREDICTED: putative late blight resistance p...  61.2    5e-08   Solanum tuberosum [potatoes]
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  62.8    5e-08   Nicotiana sylvestris
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  62.8    5e-08   Nicotiana tomentosiformis
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...  62.4    6e-08   Solanum tuberosum [potatoes]
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              62.4    6e-08   Erythranthe guttata [common monkey flower]
emb|CDP15581.1|  unnamed protein product                              62.4    6e-08   Coffea canephora [robusta coffee]
emb|CDP11974.1|  unnamed protein product                              62.4    7e-08   Coffea canephora [robusta coffee]
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  62.0    9e-08   Solanum tuberosum [potatoes]
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  62.0    9e-08   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  61.6    1e-07   
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg             61.6    1e-07   Erythranthe guttata [common monkey flower]
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  61.6    1e-07   Nicotiana tomentosiformis
emb|CDP20153.1|  unnamed protein product                              61.6    1e-07   Coffea canephora [robusta coffee]
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...  61.6    1e-07   Nicotiana sylvestris
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...  61.6    1e-07   Nicotiana sylvestris
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...  61.6    1e-07   Solanum tuberosum [potatoes]
emb|CDP19994.1|  unnamed protein product                              61.2    1e-07   Coffea canephora [robusta coffee]
ref|XP_010677240.1|  PREDICTED: putative late blight resistance p...  61.2    1e-07   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP20519.1|  unnamed protein product                              61.6    1e-07   Coffea canephora [robusta coffee]
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  61.2    2e-07   Sesamum indicum [beniseed]
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     60.5    2e-07   Nicotiana sylvestris
ref|XP_009776048.1|  PREDICTED: putative late blight resistance p...  60.8    2e-07   Nicotiana sylvestris
emb|CDP15718.1|  unnamed protein product                              60.8    2e-07   Coffea canephora [robusta coffee]
gb|AEW48217.1|  disease resistance protein RX5                        60.8    2e-07   Solanum stenotomum
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  60.8    2e-07   Sesamum indicum [beniseed]
gb|AEW48218.1|  disease resistance protein RX6                        60.8    2e-07   Solanum hondelmannii
emb|CAB50786.1|  Rx protein                                           60.8    2e-07   Solanum tuberosum [potatoes]
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  60.5    2e-07   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  60.5    2e-07   
gb|AEW48216.1|  disease resistance protein RX3                        60.5    2e-07   Solanum leptophyes x Solanum sparsipilum
emb|CDP11548.1|  unnamed protein product                              60.5    3e-07   Coffea canephora [robusta coffee]
ref|XP_009797581.1|  PREDICTED: putative late blight resistance p...  60.5    3e-07   Nicotiana sylvestris
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  60.5    3e-07   Nicotiana tomentosiformis
emb|CDP21622.1|  unnamed protein product                              60.5    3e-07   Coffea canephora [robusta coffee]
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  60.5    3e-07   Solanum tuberosum [potatoes]
gb|AEW48190.1|  disease resistance protein RX4                        60.5    3e-07   Solanum albicans
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  60.5    3e-07   Sesamum indicum [beniseed]
emb|CAB56299.1|  NBS-LRR protein                                      60.5    3e-07   Solanum acaule
ref|XP_009766585.1|  PREDICTED: late blight resistance protein R1...  60.5    3e-07   Nicotiana sylvestris
gb|AEW48201.1|  disease resistance protein RGH9                       60.5    3e-07   Solanum x edinense
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   Nicotiana sylvestris
emb|CDP18676.1|  unnamed protein product                              60.5    3e-07   Coffea canephora [robusta coffee]
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   
emb|CDO99208.1|  unnamed protein product                              60.1    3e-07   Coffea canephora [robusta coffee]
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   Nicotiana tomentosiformis
ref|XP_006346788.1|  PREDICTED: putative late blight resistance p...  60.1    3e-07   
emb|CDP15268.1|  unnamed protein product                              60.1    4e-07   Coffea canephora [robusta coffee]
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  60.1    4e-07   Nicotiana sylvestris
emb|CDP17914.1|  unnamed protein product                              60.1    4e-07   Coffea canephora [robusta coffee]
emb|CDP20159.1|  unnamed protein product                              60.1    4e-07   Coffea canephora [robusta coffee]
gb|AEW48199.1|  disease resistance protein RGH6                       60.1    4e-07   Solanum x edinense
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  59.7    4e-07   Solanum lycopersicum
ref|XP_009762295.1|  PREDICTED: putative late blight resistance p...  57.4    4e-07   Nicotiana sylvestris
emb|CDP12798.1|  unnamed protein product                              59.7    4e-07   Coffea canephora [robusta coffee]
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              59.7    4e-07   Erythranthe guttata [common monkey flower]
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  59.7    5e-07   Nicotiana sylvestris
emb|CDP17943.1|  unnamed protein product                              59.7    5e-07   Coffea canephora [robusta coffee]
ref|XP_004246080.2|  PREDICTED: putative late blight resistance p...  59.7    5e-07   Solanum lycopersicum
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  59.7    5e-07   Nicotiana tomentosiformis
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  59.7    5e-07   
emb|CDP16512.1|  unnamed protein product                              59.7    5e-07   Coffea canephora [robusta coffee]
gb|EYU21836.1|  hypothetical protein MIMGU_mgv1a023326mg              59.7    5e-07   Erythranthe guttata [common monkey flower]
ref|XP_006345615.1|  PREDICTED: putative late blight resistance p...  57.8    5e-07   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  59.7    5e-07   
gb|EYU31552.1|  hypothetical protein MIMGU_mgv1a025226mg              59.3    6e-07   Erythranthe guttata [common monkey flower]
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  59.3    6e-07   
gb|EYU21837.1|  hypothetical protein MIMGU_mgv1a021514mg              59.3    6e-07   Erythranthe guttata [common monkey flower]
gb|AEW48196.1|  disease resistance protein RGH7                       59.3    6e-07   Solanum chacoense
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  59.3    6e-07   
ref|XP_010319427.1|  PREDICTED: putative late blight resistance p...  58.9    6e-07   Solanum lycopersicum
ref|XP_009778512.1|  PREDICTED: putative late blight resistance p...  59.3    6e-07   Nicotiana sylvestris
ref|XP_009596161.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  59.3    6e-07   Nicotiana tomentosiformis
ref|XP_009778311.1|  PREDICTED: putative late blight resistance p...  59.3    6e-07   Nicotiana sylvestris
ref|XP_009778636.1|  PREDICTED: putative late blight resistance p...  59.3    6e-07   Nicotiana sylvestris
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  59.3    7e-07   Nicotiana sylvestris
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  59.3    7e-07   
ref|XP_006349898.1|  PREDICTED: putative late blight resistance p...  58.5    7e-07   Solanum tuberosum [potatoes]
gb|AEW48214.1|  disease resistance protein RGH4                       58.9    8e-07   Solanum leptophyes x Solanum sparsipilum
gb|EYU21833.1|  hypothetical protein MIMGU_mgv1a009417mg              58.5    8e-07   Erythranthe guttata [common monkey flower]
gb|EYU20573.1|  hypothetical protein MIMGU_mgv1a000577mg              58.9    8e-07   Erythranthe guttata [common monkey flower]
ref|XP_011072183.1|  PREDICTED: putative late blight resistance p...  58.5    8e-07   
emb|CDP19489.1|  unnamed protein product                              58.9    9e-07   Coffea canephora [robusta coffee]
gb|ABO93001.1|  putative disease resistance protein                   58.9    9e-07   Solanum tuberosum [potatoes]
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  58.9    9e-07   
gb|AAU93590.2|  Late blight resistance protein, putative              58.9    9e-07   Solanum demissum
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  58.9    9e-07   Sesamum indicum [beniseed]
ref|XP_009624787.1|  PREDICTED: putative late blight resistance p...  58.9    1e-06   Nicotiana tomentosiformis
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              58.5    1e-06   Erythranthe guttata [common monkey flower]
gb|EYU21175.1|  hypothetical protein MIMGU_mgv1a021134mg              58.5    1e-06   Erythranthe guttata [common monkey flower]
ref|XP_006367044.1|  PREDICTED: putative late blight resistance p...  55.5    1e-06   
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  58.5    1e-06   Sesamum indicum [beniseed]
ref|XP_009609967.1|  PREDICTED: late blight resistance protein R1...  58.2    1e-06   Nicotiana tomentosiformis
emb|CDP12770.1|  unnamed protein product                              58.5    1e-06   Coffea canephora [robusta coffee]
gb|AEW48210.1|  disease resistance protein RGH5                       58.5    1e-06   Solanum huancabambense
emb|CDP12821.1|  unnamed protein product                              58.5    1e-06   Coffea canephora [robusta coffee]
ref|XP_009758684.1|  PREDICTED: late blight resistance protein R1...  58.5    1e-06   Nicotiana sylvestris
emb|CDP18040.1|  unnamed protein product                              58.5    1e-06   Coffea canephora [robusta coffee]
emb|CDP18680.1|  unnamed protein product                              58.5    1e-06   Coffea canephora [robusta coffee]
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  58.5    1e-06   Nicotiana sylvestris
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  58.2    1e-06   Nicotiana tomentosiformis
gb|AAV31175.1|  Putative disease resistance protein, identical        58.2    1e-06   Solanum tuberosum [potatoes]
ref|XP_011071886.1|  PREDICTED: uncharacterized protein LOC105157233  57.8    1e-06   Sesamum indicum [beniseed]
ref|XP_010677242.1|  PREDICTED: putative late blight resistance p...  58.2    1e-06   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP04755.1|  unnamed protein product                              58.2    2e-06   Coffea canephora [robusta coffee]
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  58.2    2e-06   Sesamum indicum [beniseed]
emb|CDP17703.1|  unnamed protein product                              58.2    2e-06   Coffea canephora [robusta coffee]
emb|CDP04880.1|  unnamed protein product                              57.8    2e-06   Coffea canephora [robusta coffee]
emb|CDP19728.1|  unnamed protein product                              57.8    2e-06   Coffea canephora [robusta coffee]
gb|AEW48207.1|  disease resistance protein RGH5                       57.8    2e-06   Solanum fernandezianum
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   
ref|XP_006355133.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   Solanum tuberosum [potatoes]
gb|AEW48195.1|  disease resistance protein RGH6                       57.8    2e-06   Solanum chacoense
gb|AEW48202.1|  disease resistance protein RGH4                       57.8    2e-06   Solanum ehrenbergii
gb|AEW48189.1|  disease resistance protein RGH9                       57.8    2e-06   Solanum albicans
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   
emb|CDP04756.1|  unnamed protein product                              57.8    2e-06   Coffea canephora [robusta coffee]
gb|AEW48193.1|  disease resistance protein RGH4                       57.8    2e-06   Solanum chacoense
ref|XP_009592131.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   Nicotiana tomentosiformis
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  57.4    2e-06   Sesamum indicum [beniseed]
gb|AEW48194.1|  disease resistance protein RGH5                       57.4    2e-06   Solanum chacoense
ref|XP_010319426.1|  PREDICTED: putative late blight resistance p...  57.0    2e-06   Solanum lycopersicum
gb|AEW48188.1|  disease resistance protein RGH7                       57.4    2e-06   Solanum albicans
gb|AEW48186.1|  disease resistance protein RGH2                       57.4    3e-06   Solanum albicans
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...  57.4    3e-06   Nicotiana sylvestris
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Solanum lycopersicum
ref|XP_009791056.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Nicotiana sylvestris
ref|XP_009791054.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Nicotiana sylvestris
ref|XP_009782925.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Nicotiana sylvestris
ref|XP_006357456.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...  57.4    3e-06   Nicotiana sylvestris
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Nicotiana tomentosiformis
gb|EYU31599.1|  hypothetical protein MIMGU_mgv1a025745mg              57.4    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Solanum tuberosum [potatoes]
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...  57.4    3e-06   Nicotiana sylvestris
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Solanum lycopersicum
gb|AEW48205.1|  disease resistance protein RGH2                       57.4    3e-06   Solanum fernandezianum
ref|XP_009784309.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   Nicotiana sylvestris
ref|XP_009602410.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   Nicotiana tomentosiformis
ref|XP_009798058.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  57.4    3e-06   Nicotiana sylvestris
ref|XP_009602412.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              57.0    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_009608834.1|  PREDICTED: late blight resistance protein R1...  57.0    4e-06   Nicotiana tomentosiformis
ref|XP_009796668.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   Nicotiana sylvestris
ref|XP_009796670.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   Nicotiana sylvestris
emb|CDP05594.1|  unnamed protein product                              57.0    4e-06   Coffea canephora [robusta coffee]
ref|XP_009796664.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   Nicotiana sylvestris
ref|XP_009796665.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   Nicotiana sylvestris
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              57.0    4e-06   Erythranthe guttata [common monkey flower]
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   Nicotiana tomentosiformis
gb|AAT38775.2|  NB-ARC domain containing protein                      56.6    4e-06   Solanum demissum
gb|AEW48197.1|  disease resistance protein RGH3                       57.0    4e-06   Solanum x edinense
emb|CDP00737.1|  unnamed protein product                              57.0    4e-06   Coffea canephora [robusta coffee]
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...  57.0    4e-06   
emb|CDP08032.1|  unnamed protein product                              56.6    4e-06   Coffea canephora [robusta coffee]
emb|CDP20547.1|  unnamed protein product                              56.6    4e-06   Coffea canephora [robusta coffee]
ref|XP_009796671.1|  PREDICTED: putative late blight resistance p...  56.6    4e-06   Nicotiana sylvestris
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  56.6    5e-06   Nicotiana tomentosiformis
gb|AEW48192.1|  disease resistance protein RGH3                       56.6    5e-06   Solanum chacoense
gb|AEW48187.1|  disease resistance protein RGH5                       56.6    5e-06   Solanum albicans
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              56.6    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  56.6    5e-06   Sesamum indicum [beniseed]
gb|EYU21173.1|  hypothetical protein MIMGU_mgv1a002728mg              56.6    5e-06   Erythranthe guttata [common monkey flower]
gb|AEW48191.1|  disease resistance protein RGH2                       56.6    5e-06   Solanum chacoense
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              56.6    5e-06   Erythranthe guttata [common monkey flower]
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...  56.6    5e-06   Solanum tuberosum [potatoes]
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  56.6    6e-06   Solanum tuberosum [potatoes]
ref|XP_011072130.1|  PREDICTED: putative late blight resistance p...  56.6    6e-06   Sesamum indicum [beniseed]
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   Sesamum indicum [beniseed]
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   Nicotiana tomentosiformis
emb|CDP20607.1|  unnamed protein product                              56.2    6e-06   Coffea canephora [robusta coffee]
ref|XP_010319247.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   Nicotiana sylvestris
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   Sesamum indicum [beniseed]
gb|AEW48198.1|  disease resistance protein RGH4                       56.2    6e-06   Solanum x edinense
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...  56.2    6e-06   Nicotiana sylvestris
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...  56.2    7e-06   Solanum tuberosum [potatoes]
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  56.2    7e-06   
ref|XP_004241950.1|  PREDICTED: putative late blight resistance p...  56.2    7e-06   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  56.2    7e-06   Nicotiana sylvestris
gb|AAF76163.1|AF266747_1  RGC1                                        56.2    7e-06   Solanum tuberosum [potatoes]
gb|AEW48215.1|  disease resistance protein RGH7                       56.2    7e-06   Solanum leptophyes x Solanum sparsipilum
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  56.2    7e-06   Nicotiana sylvestris
ref|XP_009796331.1|  PREDICTED: late blight resistance protein R1...  55.8    8e-06   Nicotiana sylvestris
ref|XP_009772243.1|  PREDICTED: putative late blight resistance p...  56.2    8e-06   Nicotiana sylvestris
gb|AEW48206.1|  disease resistance protein RGH4                       56.2    8e-06   Solanum fernandezianum
emb|CDP10671.1|  unnamed protein product                              55.8    8e-06   Coffea canephora [robusta coffee]
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  55.8    8e-06   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  55.8    8e-06   
emb|CDP05558.1|  unnamed protein product                              55.8    8e-06   Coffea canephora [robusta coffee]
ref|XP_009608248.1|  PREDICTED: putative late blight resistance p...  55.8    8e-06   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg              55.8    8e-06   Erythranthe guttata [common monkey flower]
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  55.8    8e-06   Solanum lycopersicum
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  55.8    9e-06   Sesamum indicum [beniseed]
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  55.8    9e-06   Nicotiana sylvestris
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  55.8    9e-06   Nicotiana sylvestris
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana tomentosiformis
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
ref|XP_009777062.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
ref|XP_009777064.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
gb|AEW48212.1|  disease resistance protein RGH1                       55.8    1e-05   Solanum leptophyes x Solanum sparsipilum
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
gb|AAT66772.2|  NB-ARC domain containing protein                      55.8    1e-05   Solanum demissum
ref|XP_009777063.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   Nicotiana sylvestris
ref|XP_004233876.2|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Solanum lycopersicum
ref|XP_006365681.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_006367619.1|  PREDICTED: putative late blight resistance p...  52.0    1e-05   
emb|CDP11161.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Nicotiana tomentosiformis
gb|AEW48209.1|  disease resistance protein RGH5                       55.5    1e-05   Solanum huancabambense
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Sesamum indicum [beniseed]
ref|XP_009589795.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Nicotiana tomentosiformis
gb|ABO93011.1|  putative disease resistance protein                   55.5    1e-05   Solanum tuberosum [potatoes]
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Nicotiana sylvestris
emb|CDP17260.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
emb|CDP08033.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Nicotiana sylvestris
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   Nicotiana sylvestris
ref|XP_009785354.1|  PREDICTED: putative late blight resistance p...  55.1    1e-05   Nicotiana sylvestris
emb|CDP11157.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
emb|CDP19488.1|  unnamed protein product                              55.5    1e-05   Coffea canephora [robusta coffee]
gb|AEW48211.1|  disease resistance protein RGH1                       55.1    1e-05   Solanum hougasii
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  55.1    1e-05   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              55.1    1e-05   
gb|EYU31247.1|  hypothetical protein MIMGU_mgv1a017756mg              55.1    1e-05   
ref|XP_009779957.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  55.1    2e-05   
gb|EYU20585.1|  hypothetical protein MIMGU_mgv1a019584mg              55.1    2e-05   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
emb|CDP21728.1|  unnamed protein product                              55.1    2e-05   
emb|CDP04858.1|  unnamed protein product                              55.1    2e-05   
ref|XP_009778434.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
ref|XP_006365678.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             55.1    2e-05   
ref|XP_006357457.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              54.7    2e-05   
emb|CDP19132.1|  unnamed protein product                              54.7    2e-05   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
gb|ABY61745.1|  resistance protein PSH-RGH6                           54.7    2e-05   
ref|XP_009629405.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
gb|AAT39932.2|  NB-ARC domain containing protein                      54.7    2e-05   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
emb|CDP11160.1|  unnamed protein product                              54.7    2e-05   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              54.7    2e-05   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_009764269.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
sp|Q6L400.1|R1B16_SOLDE  RecName: Full=Putative late blight resis...  54.7    2e-05   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  54.7    2e-05   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              54.3    3e-05   
emb|CDP20176.1|  unnamed protein product                              54.7    3e-05   
gb|AAT39957.1|  Putative late blight resistance protein, identical    54.7    3e-05   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              54.3    3e-05   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              54.3    3e-05   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              54.3    3e-05   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              54.3    3e-05   
ref|XP_009625968.1|  PREDICTED: putative late blight resistance p...  53.9    3e-05   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
emb|CDP15122.1|  unnamed protein product                              54.7    3e-05   
ref|XP_006367616.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
emb|CDP05538.1|  unnamed protein product                              54.3    3e-05   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
emb|CDP18675.1|  unnamed protein product                              54.3    3e-05   
emb|CDP00589.1|  unnamed protein product                              54.3    3e-05   
gb|AEW48200.1|  disease resistance protein RGH7                       54.3    3e-05   
ref|XP_009601897.1|  PREDICTED: putative late blight resistance p...  53.9    3e-05   
emb|CDP18682.1|  unnamed protein product                              54.3    3e-05   
ref|XP_009779606.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_011070823.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_009778116.1|  PREDICTED: putative late blight resistance p...  53.9    3e-05   
ref|XP_009782798.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  54.3    3e-05   
gb|AGX27500.1|  NBS-LRR class resistance protein Fy2-Ry2              53.9    4e-05   
ref|XP_010320671.1|  PREDICTED: uncharacterized protein LOC101257665  54.3    4e-05   
ref|XP_009616092.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...  53.9    4e-05   
ref|XP_009616093.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
gb|EYU34208.1|  hypothetical protein MIMGU_mgv1a026654mg              53.9    4e-05   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              53.9    4e-05   
ref|XP_009760597.1|  PREDICTED: late blight resistance protein R1...  53.9    4e-05   
ref|XP_009616094.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...  53.9    4e-05   
gb|AEW48204.1|  disease resistance protein RGH1                       53.9    4e-05   
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...  53.9    4e-05   
ref|XP_009760596.1|  PREDICTED: late blight resistance protein R1...  53.9    4e-05   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  53.9    4e-05   
emb|CDP12797.1|  unnamed protein product                              53.9    5e-05   
ref|XP_009764259.1|  PREDICTED: late blight resistance protein R1...  53.9    5e-05   
ref|XP_009764457.1|  PREDICTED: putative late blight resistance p...  53.5    5e-05   
emb|CDP21300.1|  unnamed protein product                              53.9    5e-05   
gb|EYU29923.1|  hypothetical protein MIMGU_mgv1a026346mg              53.1    5e-05   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  53.5    5e-05   
sp|Q6L3Y2.1|R1B11_SOLDE  RecName: Full=Putative late blight resis...  53.5    6e-05   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
gb|AAT38780.1|  Putative late blight resistance protein, identical    53.5    6e-05   
ref|XP_011072172.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
sp|Q6L439.2|R1A4_SOLDE  RecName: Full=Putative late blight resist...  53.5    6e-05   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...  53.5    6e-05   
ref|XP_006367617.1|  PREDICTED: putative late blight resistance p...  53.1    6e-05   
sp|Q60CZ8.1|R1A10_SOLDE  RecName: Full=Putative late blight resis...  53.5    6e-05   
gb|ABY61746.1|  resistance protein PSH-RGH7                           53.1    7e-05   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              53.1    7e-05   
gb|ABO93000.1|  putative disease resistance protein                   53.5    7e-05   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  53.1    7e-05   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...  53.1    7e-05   
ref|XP_009772626.1|  PREDICTED: putative late blight resistance p...  53.1    7e-05   
gb|ABO92985.1|  putative disease resistance protein                   53.1    7e-05   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  53.1    7e-05   
ref|XP_004239390.2|  PREDICTED: putative late blight resistance p...  53.1    8e-05   
emb|CDP00696.1|  unnamed protein product                              50.1    8e-05   
emb|CDP11186.1|  unnamed protein product                              53.1    9e-05   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
ref|XP_010320686.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
ref|XP_004239389.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg              52.8    9e-05   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              52.8    9e-05   
gb|AAT66777.2|  Late blight resistance protein, putative              52.8    9e-05   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
gb|AAT39961.1|  Putative late blight resistance protein, identical    52.8    1e-04   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
ref|XP_006365952.1|  PREDICTED: putative late blight resistance p...  51.6    1e-04   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
ref|XP_009761713.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              52.8    1e-04   
emb|CDP05441.1|  unnamed protein product                              52.8    1e-04   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
ref|NP_001234273.1|  JJH-R-like protein                               51.2    1e-04   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
ref|XP_009608832.1|  PREDICTED: late blight resistance protein R1...  52.4    1e-04   
emb|CDP15579.1|  unnamed protein product                              52.4    1e-04   
gb|AAT39283.2|  Late blight resistance protein, putative              52.4    1e-04   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              52.0    1e-04   
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
gb|ABO92983.1|  putative disease resistance protein                   52.4    1e-04   
gb|EYU24187.1|  hypothetical protein MIMGU_mgv1a001243mg              52.4    1e-04   
sp|Q6L440.2|R1A3_SOLDE  RecName: Full=Putative late blight resist...  52.4    1e-04   
emb|CDP11611.1|  unnamed protein product                              52.4    1e-04   
ref|XP_009794266.1|  PREDICTED: late blight resistance protein R1...  52.4    1e-04   
emb|CDP12799.1|  unnamed protein product                              52.4    1e-04   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              52.4    1e-04   
gb|AAL17826.1|  GPA2-like NBS-LRR protein                             52.0    1e-04   
gb|AAT39281.2|  Integrase core domain containing protein              52.4    2e-04   
emb|CDP19443.1|  unnamed protein product                              52.0    2e-04   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              52.0    2e-04   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
emb|CDP21195.1|  unnamed protein product                              52.0    2e-04   
gb|ABO93013.1|  putative disease resistance protein                   52.4    2e-04   
sp|Q6L3N7.1|R1C3_SOLDE  RecName: Full=Putative late blight resist...  52.0    2e-04   
gb|EYU33968.1|  hypothetical protein MIMGU_mgv1a026820mg              52.0    2e-04   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg              52.0    2e-04   
ref|XP_009776290.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  52.0    2e-04   
ref|XP_009596953.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
ref|XP_011072180.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  51.2    2e-04   
sp|Q6L3L0.1|R1B23_SOLDE  RecName: Full=Putative late blight resis...  52.0    2e-04   
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg              52.0    2e-04   
gb|AAT39951.2|  Disease resistance protein, putative                  52.0    2e-04   
ref|XP_011072135.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
gb|AAT40519.2|  hypothetical protein SDM1_22t00007                    52.0    2e-04   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  52.0    2e-04   
emb|CDP15705.1|  unnamed protein product                              52.0    2e-04   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              51.6    2e-04   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
gb|AAT40487.1|  putative disease resistance protein                   52.0    2e-04   
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
emb|CDP08038.1|  unnamed protein product                              51.6    2e-04   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              51.6    2e-04   
gb|EYU17661.1|  hypothetical protein MIMGU_mgv1a025742mg              51.6    3e-04   
ref|XP_009599401.1|  PREDICTED: putative late blight resistance p...  50.8    3e-04   
ref|XP_009610033.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009610032.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_011072143.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
gb|ADH94052.1|  putative disease resistance protein R1                50.8    3e-04   
ref|XP_011072147.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP17920.1|  unnamed protein product                              51.6    3e-04   
emb|CDP05506.1|  unnamed protein product                              50.8    3e-04   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP16976.1|  unnamed protein product                              51.2    3e-04   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP17701.1|  unnamed protein product                              51.2    3e-04   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  51.6    3e-04   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP17263.1|  unnamed protein product                              51.2    3e-04   
ref|XP_011072128.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|NP_001234202.1|  NRC1                                             50.8    4e-04   
gb|EYU39490.1|  hypothetical protein MIMGU_mgv1a0204861mg             50.8    4e-04   
emb|CDP00592.1|  unnamed protein product                              50.8    4e-04   
ref|XP_006347943.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
ref|XP_009787579.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
emb|CDP08019.1|  unnamed protein product                              50.8    4e-04   
ref|XP_009787580.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
emb|CDP05499.1|  unnamed protein product                              50.8    4e-04   
gb|AEW70440.1|  disease resistance protein R1                         50.4    4e-04   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  49.3    5e-04   
gb|ADH94053.1|  putative disease resistance protein R1                50.4    5e-04   
emb|CDP08024.1|  unnamed protein product                              50.8    5e-04   
gb|AEW70444.1|  disease resistance protein R1                         50.4    5e-04   
emb|CDP11636.1|  unnamed protein product                              50.8    5e-04   
ref|XP_006347944.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
gb|ADH94054.1|  putative disease resistance protein R1                50.4    5e-04   
emb|CDP13440.1|  unnamed protein product                              50.4    5e-04   
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
ref|XP_004248798.1|  PREDICTED: putative late blight resistance p...  50.4    5e-04   
gb|EYU21829.1|  hypothetical protein MIMGU_mgv1a001470mg              50.4    5e-04   
gb|EYU21838.1|  hypothetical protein MIMGU_mgv1a001107mg              50.4    5e-04   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
ref|XP_009604647.1|  PREDICTED: putative late blight resistance p...  50.1    6e-04   
ref|XP_010320900.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  ++LK WKAT+D+FP LE + + SCK LKEIP  FA+I  L  I+ R C P +  S
Sbjct  812  LLIKYSFLKFWKATNDNFPVLERLMIRSCKNLKEIPIEFADIHTLQLIELRECPPKLGES  871

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  NN VDV
Sbjct  872  AARIQKEQEDLGNNPVDV  889



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +L+ W+ATS HFP LEH+ L  C  L++IP  FAEI+ L  I+   C+ SV+ SAE+I+E
Sbjct  675  HLEQWEATSYHFPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQIQE  734

Query  475  EQLDYLNN  452
            EQ  + N+
Sbjct  735  EQQSFGND  742



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+AT D+FP LEH+ + +C+ LKEIP GFA+   L  I  +GC PSVV SA+ I+ EQL+
Sbjct  821  WRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKLIMLQGCSPSVVTSADRIQREQLE  880



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+AT D+FP LEH+ + +C+ LKEIP GFA+   L  I  +GC PSVV SA+ I+ EQL+
Sbjct  811  WRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKLIMLQGCSPSVVTSADRIQREQLE  870



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +L  W+ATS HFP LEH  L +C+ L++IP  FAEI+ L  I+   C+ SV+ SAE+I+E
Sbjct  325  HLMQWEATSYHFPSLEHFVLTNCRYLEKIPFDFAEIQTLQLIELHECMRSVLVSAEQIQE  384

Query  475  EQLDYLNN  452
            EQ  + N+
Sbjct  385  EQQSFGND  392



>ref|XP_009764213.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764214.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764216.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764217.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=173

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            YL  W+AT D+FP+LE I + SC  +KEIP GFA+   L  I+   C  S+V SA+ I++
Sbjct  50   YLHYWRATDDYFPRLERIIIRSCFFIKEIPEGFADSMTLQLIELHQCSSSLVNSAKRIQK  109

Query  475  EQLDYLNN  452
            EQL+ L N
Sbjct  110  EQLENLGN  117



>ref|XP_009603166.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+AT D+FP LEH+ + +C  LKEIP GFA+   L  I  +GC PSVV SAE I+ EQL+
Sbjct  833  WRATDDYFPCLEHVIIKNCSLLKEIPQGFADSMTLKLIMLQGCSPSVVTSAEWIQREQLE  892



>emb|CDP12547.1| unnamed protein product [Coffea canephora]
Length=1233

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L I  +  + W   ++ FP LE++ L  C KL+EIPS FAEI  L  I+ RGC P+V  S
Sbjct  1153  LRIYNSEFERWAVPAEPFPSLENLVLIDCTKLQEIPSSFAEISTLRMIKVRGCSPNVEKS  1212

Query  493   AEEIKEEQLDYLNNIVDVVC  434
             A+ I EEQ D  N  + ++C
Sbjct  1213  AQTIFEEQKDMGNGDLQLIC  1232



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -3

Query  661  PTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEI  482
            P Y   WKATSDHFP LEH+ L  C  L+EIP  FA+   L SI+   C  SVV SAE+I
Sbjct  779  PNY---WKATSDHFPLLEHLVLRDCYHLQEIPLDFADSLTLQSIEIENCERSVVTSAEQI  835

Query  481  KEEQ  470
            +EEQ
Sbjct  836  QEEQ  839



>ref|XP_006349899.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=413

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -3

Query  679  MXLEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVV  500
            + L  G  + ++W    D FP LEH+ L  CK LKEIPS F EI  L SI  R C  +V 
Sbjct  318  LKLHAGKAHFEEWFVADDAFPNLEHLVLRDCKFLKEIPSWFGEISSLKSIAVRNCNENVD  377

Query  499  ASAEEIKEEQL-DYLNNIVDV  440
             SA +I+E Q+ DY N+  +V
Sbjct  378  KSASDIRETQVEDYQNSKFEV  398



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++    L +W A+SDH P+L+H+ L SC++LKE+PSGF EI  L  I+ + C  SV  S
Sbjct  1333  LKLDSLNLAEWNASSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKS  1392

Query  493   AEEIKEEQLDYLNNI  449
                ++ E LD  N +
Sbjct  1393  VRRLQTESLDMGNEL  1407



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L I  T LK WKAT+DHFP LEH+ +  C  L+EIP  FA+I  L  I+ + C   +VAS
Sbjct  1788  LLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSAKLVAS  1847

Query  493   AEEIKEEQLDYLNNIVDV  440
             A  I+EEQ    +  VDV
Sbjct  1848  AGRIQEEQESLGSKAVDV  1865


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L I  T LK WKAT+DHFP LEH+ +  C  L+EIP  FA+I  L  I+ + C   +VAS
Sbjct  2595  LLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCTAKLVAS  2654

Query  493   AEEIKEEQLDYLNNIVDV  440
                I+EEQ    +  VDV
Sbjct  2655  TVLIQEEQESLGSKAVDV  2672


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +LK W  T+D+FP LE + +  C +L+EIP  F+E   L  I+ + C P + ASA  I++
Sbjct  872  HLKYWNITNDNFPVLERLMIIDCTELEEIPIEFSETSSLKLIELKDCKPHLEASATRIQQ  931

Query  475  EQLDYLNNIVDV  440
            EQ D  NN VDV
Sbjct  932  EQEDIGNNPVDV  943



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK+W A+ D FP LE + + +C+ L+EIP GF++   L  I+  GC PS+V  A+EI+EE
Sbjct  799  LKNWNASDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNFAKEIQEE  858

Query  472  QLDYLNNIVDV  440
            Q    NNI+ V
Sbjct  859  QEILGNNILQV  869



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I  T L+ W   S HFP LEH+ LFSC++L EIP    EI  L  I+      S+V S
Sbjct  793  LKIRWTNLQHWVTDSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKS  852

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++IKEEQ  + N+ ++V
Sbjct  853  AKQIKEEQQSFGNDYLEV  870



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+ATSDHFP+L+H+ L  C  L+EIP G   I  L  I+   C  SVV+SA+ I+EEQ  
Sbjct  633  WEATSDHFPRLQHLVLRLCGCLEEIPFGVGGIPTLQMIEIYSCAHSVVSSAKRIQEEQQS  692

Query  463  YLNNIVDV  440
            Y N+ ++V
Sbjct  693  YGNDDLEV  700



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I   YL+ WKAT+D+FP LE + L SC  LKEIP  FA+I     I+   C P +  S
Sbjct  818  LLIQANYLESWKATNDNFPVLERLVLGSCSYLKEIPIEFADINTSQLIELDSCPPILAES  877

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N+ +DV
Sbjct  878  AARIQQEQEDLGNDPIDV  895



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +L  W+AT D+FP LE I + +C  L+EIP GFA+   L  I+   C PS+V SAE I++
Sbjct  847  HLDYWRATDDYFPCLERIIIKNCSSLQEIPKGFADSMTLQLIELHQCSPSLVNSAELIRK  906

Query  475  EQLDYLNN  452
            EQL+ L N
Sbjct  907  EQLESLGN  914



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W+A   H P+L H+ +  C  L+EIPSG  EI  L  I+   C PSVVASA++I+E+
Sbjct  657  LVHWQADETHLPRLRHLLIRGCSALEEIPSGIGEIPTLEIIELDECSPSVVASAKQIQED  716

Query  472  QLDYLNNIVDV  440
            Q +Y N+ ++V
Sbjct  717  QREYGNDGLEV  727



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A  D+FP LEHI + +C+ LKEIP GFA+   L  IQ   C  S+V  AE+I+E    
Sbjct  827  WRAADDYFPCLEHIVIRNCRTLKEIPEGFADSLTLQQIQLHRCTSSLVTFAEQIQENHES  886

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  887  LGNNMLKV  894



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++    + +W A SDH P+LEH+ L SC++LKE+PSGF +   L  I+ + C  S+  S
Sbjct  730  LKLDSLNIAEWNACSDHLPQLEHLILRSCRELKEVPSGFGDSSTLEMIEVQFCTSSLEES  789

Query  493  AEEIKEEQLDYLNNI  449
             ++++EEQ D  N +
Sbjct  790  VKQLQEEQHDMGNEL  804



>ref|XP_006367913.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
isoform X2 [Solanum tuberosum]
Length=232

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK W+A SD+FP L+ + L  CK L+EIP+ F EI  L  I+   C  +  AS  +IK+E
Sbjct  140  LKCWEARSDNFPNLKRLVLKKCKHLQEIPTDFGEICTLELIELHDCTTTAEASVRKIKQE  199

Query  472  QLDYLNNIVDV  440
            Q D  NNI+ V
Sbjct  200  QDDLDNNILKV  210



>emb|CDP21316.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +  T L  W+ATS+HFP LEH+ L SCK LKE+P G  EI  L  I+   C  S   S
Sbjct  96   LLVEKTDLVSWEATSNHFPCLEHLVLKSCKYLKEVPYGITEISTLKRIELHNCSESAEIS  155

Query  493  AEEIKEEQLD  464
            A  I+ E LD
Sbjct  156  ALSIEVESLD  165



>emb|CDP04753.1| unnamed protein product [Coffea canephora]
Length=1258

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++     + W A SD+FP+LE + L++C++L+E+PS   E   L +I+   C  SVV+S
Sbjct  1170  LKLARLDFRRWTAASDNFPRLEQLVLYNCRELEEVPSCLGECPTLEAIEVGRCGESVVSS  1229

Query  493   AEEIKEEQLDYLNNIVDVV---CG*A  425
              E+I+EEQ+D  N  + +    CG A
Sbjct  1230  VEKIQEEQMDMGNEDLKIAIEKCGDA  1255



>ref|XP_006367912.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
isoform X1 [Solanum tuberosum]
Length=269

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK W+A SD+FP L+ + L  CK L+EIP+ F EI  L  I+   C  +  AS  +IK+E
Sbjct  177  LKCWEARSDNFPNLKRLVLKKCKHLQEIPTDFGEICTLELIELHDCTTTAEASVRKIKQE  236

Query  472  QLDYLNNIVDV  440
            Q D  NNI+ V
Sbjct  237  QDDLDNNILKV  247



>emb|CDP17919.1| unnamed protein product [Coffea canephora]
Length=1347

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             LE+    +++W ++SD+F +LE + + SC  L+E+PS   E E L  I+ +GC  SV AS
Sbjct  1178  LELSMLDIRNWSSSSDNFSRLEKLLVDSCMYLEEVPSCLGECETLEMIEVKGCRESVAAS  1237

Query  493   AEEIKEEQLDYLNNIV  446
               +I+EEQLD + N+V
Sbjct  1238  VMQIQEEQLD-MGNVV  1252



>ref|XP_009764014.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=411

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L+ WKA S +FPKL+ + L SC  L+EIP  F EI  L SI+   C  S   S
Sbjct  327  LLISVTSLRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKS  386

Query  493  AEEIKEEQLDYLNNIVDVV  437
             EE++EEQ    N+ + VV
Sbjct  387  VEELREEQESMGNDCLSVV  405



>ref|XP_009764013.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=412

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L+ WKA S +FPKL+ + L SC  L+EIP  F EI  L SI+   C  S   S
Sbjct  327  LLISVTSLRHWKAVSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSTAKS  386

Query  493  AEEIKEEQLDYLNNIVDVV  437
             EE++EEQ    N+ + VV
Sbjct  387  VEELREEQESMGNDCLSVV  405



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W+ATS HFP LEH+ L  C  L+++P  FAEI+ L  I+   C  SV+ SAE+I+EE
Sbjct  507  LMQWEATSYHFPNLEHLVLTDCYLLEQMPFDFAEIQTLQLIELHKCKCSVLVSAEQIQEE  566

Query  472  Q  470
            Q
Sbjct  567  Q  567



>emb|CDP12774.1| unnamed protein product [Coffea canephora]
Length=1253

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              + W A+SD+FP+LE + + +C  L+E+PS   E   L  I+ RGC  SVV S ++I+ E
Sbjct  1165  FRSWTASSDNFPRLEKLIVHNCWMLEEVPSCLGECPTLEMIEVRGCFESVVNSVKQIQLE  1224

Query  472   QLDYLNNIVDVV  437
             Q+D  N I+ ++
Sbjct  1225  QIDMGNEILKIL  1236



>emb|CDP19634.1| unnamed protein product [Coffea canephora]
Length=1229

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L+ W A+SD+FP+LE + +  C  L+E+PS   +   L  I+ RGC  SV +S ++I++E
Sbjct  1142  LRSWTASSDNFPRLEKLVVHGCVHLEEVPSCLGDCPTLEMIEVRGCRESVASSVKQIQQE  1201

Query  472   QLDYLNNIVDVV  437
             Q+D  N ++ ++
Sbjct  1202  QIDMGNEVLKIL  1213



>ref|XP_009618209.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
 ref|XP_009618218.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
 ref|XP_009618224.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=1219

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query  667   IGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAE  488
             +      +W  + D FP LEH++L  CK LKEIPS FAEI  L  ++   C  ++VAS E
Sbjct  1139  VNSDNFNEWNVSDDAFPCLEHLTLHKCKYLKEIPSWFAEIASLKFVRVTSCNEAIVASVE  1198

Query  487   EIKEEQL-DY  461
             EI+  Q+ DY
Sbjct  1199  EIRTMQVEDY  1208



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T+L+ W+A S +FPKL+ + L SC  L+EIP  F EI  L SI+   C  S   S
Sbjct  771  LLISVTFLRHWEAGSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  830

Query  493  AEEIKEEQLDYLNNIVDVV  437
             EE++EEQ    N+ + VV
Sbjct  831  VEELQEEQESMGNDCLSVV  849



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  TYLK W A S +FPKL+ + L  C  L+EIP  F EI  L SI+   C  S  AS
Sbjct  479  LLINETYLKHWDAGSVNFPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKCKTSAAAS  538

Query  493  AEEIKEEQLDYLNNIVDVV  437
            A+ I+EEQ    N+ + V+
Sbjct  539  AKNIQEEQESMGNDCLSVL  557



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I    +K WKAT+D FP LE + +  C+ L+EIP  FAEI  L  +  + C P + AS
Sbjct  868  LQIHHHKIKYWKATNDSFPVLERLQIQYCRYLEEIPIEFAEIYSLQLVVLKDCKPKLKAS  927

Query  493  AEEIKEEQLDYLNNIVDV  440
            A  I++EQ D  N  VDV
Sbjct  928  AARIQQEQEDLGNKPVDV  945



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T+L+ W+A S +FPKL+ + L SC  L+EIP  F EI  L SI+   C  S   S
Sbjct  770  LLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  829

Query  493  AEEIKEEQLDYLNNIVDVV  437
             EE++EEQ    N+ + VV
Sbjct  830  VEELQEEQKSMGNDCLTVV  848



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L  WKAT D+FP LE + L SC  L E+P  FA I  L  I+   C+P + AS
Sbjct  840  LLIDSTSLNYWKATDDNFPALECLVLRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEAS  899

Query  493  AEEIKEEQLDYLNNIVDV  440
            A +I++EQ D  N  +D+
Sbjct  900  AAQIQQEQEDIGNKPLDI  917



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T+L+ W+A S +FPKL+ + L SC  L+EIP  F EI  L SI+   C  S   S
Sbjct  770  LLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  829

Query  493  AEEIKEEQLDYLNNIVDVV  437
             EE++EEQ    N+ + VV
Sbjct  830  VEELQEEQKSMGNDCLTVV  848



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W   S+HFP+LEH+ L   +KLKEIPS   EI  L SIQ   C  S V SA+EI +E
Sbjct  765  LEWWTTDSNHFPRLEHLHLQFLRKLKEIPSCIGEISTLQSIQLIWCSKSAVKSAKEILKE  824

Query  472  QLDYLN  455
            Q D+ N
Sbjct  825  QEDFGN  830



>emb|CDP20463.1| unnamed protein product [Coffea canephora]
Length=1160

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              + W A+SD+FP+LE + + SC+ LKE+PS   E   L  I+  GC  SV +S ++I++E
Sbjct  1082  FRSWTASSDNFPRLEKLVVHSCRNLKEVPSCLGECPTLEMIEVSGCHESVASSVKQIQQE  1141

Query  472   QLDYLNNIVDV  440
             Q D  N  + +
Sbjct  1142  QRDMGNEALKI  1152



>ref|XP_006367977.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=243

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD+FP L+ + L  CK L+EIP+ F EI  L SI+   C  +   SA  I++EQ D
Sbjct  168  WEASSDNFPNLKRLVLKKCKDLQEIPTDFGEICTLESIELHDCSTTSEESARNIEQEQED  227

Query  463  YLNNIVDV  440
              NNI+ V
Sbjct  228  MGNNILKV  235



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W A  D+FP LE + + +C+ L+EIP GF +   L  I+  GC+PS+V  AE+I++EQL+
Sbjct  764  WIAAEDYFPCLERVIIRNCRYLREIPRGFTDSVTLQQIELHGCIPSLVTFAEQIQKEQLE  823



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            +K W AT D FP LE + + SC  L+EIP  FA+I+ L  I+   C P ++ASA  I++E
Sbjct  802  IKCWNATCDSFPVLERLVIISCSDLEEIPFEFADIQSLQLIELDSCTPELMASAVRIQQE  861

Query  472  QLDYLNNIVDV  440
            Q +  N  VDV
Sbjct  862  QEEIGNKPVDV  872



>ref|XP_006346790.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=890

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
            T LK W+A+SD+FP L+ + L  C+ L+EIP+ F EI  L S++   C  +   SA+ I+
Sbjct  805  TNLKHWEASSDNFPILKRLVLKKCRHLQEIPADFGEICTLESVELHDCSATAEDSAKNIE  864

Query  478  EEQLDYLNNIVDV  440
             EQ D  NNI+ V
Sbjct  865  REQEDMGNNILKV  877



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S+HFP+LEH+ L    KLKEIPS   EI  L SIQ   C  S V SA+EI +EQ D
Sbjct  682  WTTGSNHFPRLEHLHLQLLDKLKEIPSCIGEISTLQSIQLIWCSKSAVISAKEILKEQQD  741

Query  463  YLN  455
            + N
Sbjct  742  FGN  744



>emb|CDP15581.1| unnamed protein product [Coffea canephora]
Length=913

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            WK +SD FP+L  + L  C +LKE+PS F E+  L +I+  GC  SVV S  EI++EQ D
Sbjct  844  WKCSSDQFPRLRKLVLVQCWRLKEVPSCFGEVSTLETIEVHGCSDSVVNSLWEIEKEQKD  903

Query  463  YLN  455
              N
Sbjct  904  SGN  906



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++   ++  WKA++DH P L H+ L  CKKL+E+PS   +I  L  I+   C  S   S
Sbjct  1397  LKLDNLWIAQWKASNDHLPCLRHLVLQRCKKLEEVPSSLGDIRTLERIEVHWCSQSAAVS  1456

Query  493   AEEIKEEQLDYLN  455
              +EI++EQ D  N
Sbjct  1457  VKEIEDEQRDIGN  1469



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = -3

Query  652  LKDWKATS---DHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEI  482
            L+ W+ T+   DHFP LE + + +CK LKEIP GFA+ ++L  I+   C PS+VA AE+I
Sbjct  796  LEKWRTTAGSHDHFPGLECVIITNCKFLKEIPQGFADSKKLELIELHKCDPSLVAFAEKI  855

Query  481  KEEQLDYLNNIVDVV  437
            +E+  D   N + V 
Sbjct  856  QEKHEDLGRNKLKVT  870



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W A + HFP LEH+ + SC  L+ IPSG  +I  L  I    C  S V S E+I EEQ D
Sbjct  809  WIAENTHFPCLEHLIIRSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTSVEQILEEQRD  868

Query  463  YLNNIVDV-VC  434
              NN++ V VC
Sbjct  869  MENNVLQVRVC  879



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            ++ W+AT D FP LE I + +C+ LKEIP  FA+   L  I+   C PS+V SAE I++E
Sbjct  849  IRYWRATDDCFPCLERIIIRNCRFLKEIPQEFADSMTLQLIELHQCSPSLVNSAELIQKE  908

Query  472  QLDYL-NNIVDV  440
            QL+ L NN++ V
Sbjct  909  QLESLGNNMLKV  920



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S+HFP+LEH+ L    KLKEIPS   EI  L SIQ   C  S V+SA++I +EQ D
Sbjct  755  WTTDSNHFPRLEHLHLEDLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKILKEQED  814

Query  463  YLN  455
            + N
Sbjct  815  FGN  817



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             W A  D+FP LE I + +C  LKEIP GFA+   L  I+ R C PS+V  AE+I+++Q +
Sbjct  1038  WVADDDYFPCLERIIIRNCTYLKEIPQGFADSTTLQQIELRRCSPSLVTLAEKIQKKQEE  1097

Query  463   YLNNIVDVVC  434
              + N +  VC
Sbjct  1098  EIGNNILKVC  1107



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++    +  WKA++DH PKL+ + L +C+ L+E+PSGFA+I  L  I+ + C  S   S
Sbjct  1368  LKLDSLNIAQWKASADHLPKLQQLVLRNCRHLEEVPSGFADIPTLVMIEMQLCRSSAEES  1427

Query  493   AEEIKEEQL  467
                +KEEQL
Sbjct  1428  VRILKEEQL  1436



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A  D+FP LEHI + +C+ LKEIP GF +   L  IQ   C  S+V  A++I+E    
Sbjct  804  WRAADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCTSSLVTFAKQIQENYES  863

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  864  LGNNMLKV  871



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A  D+FP LEHI + +C+ LKEIP GF +   L  IQ   C  S+V  A++I+E    
Sbjct  804  WRAADDYFPCLEHIVIRNCRTLKEIPEGFVDSLTLQQIQLHRCTSSLVTFAKQIQENYES  863

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  864  LGNNMLKV  871



>ref|XP_006363255.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=1261

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              K W  + D FP+LEH+ L  C+ L+ IPS F +I  L SI+ + C  S+V SA  I+E 
Sbjct  1186  FKKWNVSDDAFPRLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCKESLVKSAMVIRES  1245

Query  472   QLDYLNN  452
             Q++ + N
Sbjct  1246  QVEEMQN  1252



>emb|CDP19994.1| unnamed protein product [Coffea canephora]
Length=991

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             + W A+SD+FP+LE + +  C KL+E+PS   E   L  I+ RGC  SV +S ++I++E
Sbjct  917  FRSWTASSDNFPRLEKLVVERCLKLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQQE  976

Query  472  QLDYLNNIVDV  440
            Q D  N  + +
Sbjct  977  QRDMGNEALKI  987



>ref|XP_010677240.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -3

Query  652   LKDWK--ATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             +++W    ++D FPKLE + +  C KL++IPS F + E+L  I   GC  SV  SA +IK
Sbjct  1082  IRNWNISCSADAFPKLECLVIKYCNKLRKIPSSFVDNEKLRLILLEGCKSSVEKSANQIK  1141

Query  478   EEQLDYLNNIVDVV  437
             EEQ DY N   +VV
Sbjct  1142  EEQQDYGNKNFEVV  1155



>emb|CDP20519.1| unnamed protein product [Coffea canephora]
Length=1251

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              + W A+SD+FP+LE + +  C+ L+E+PS   E   L  I+ RGC  SV +S ++I++E
Sbjct  1170  FRRWTASSDNFPRLEKLVVQWCRHLEEVPSCLGECPTLEMIEVRGCRESVASSVKQIQQE  1229

Query  472   QLDYLNNIVDVV  437
             Q D  N ++ ++
Sbjct  1230  QRDGGNEVLRIL  1241



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W A   HFP+L+ + + SC KLKEIPSG  EI  L  I+   C  S V SAE+I+EE
Sbjct  879  LVQWVANETHFPRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEE  938

Query  472  Q  470
            Q
Sbjct  939  Q  939



>ref|XP_009773003.1| PREDICTED: protein CHUP1, chloroplastic-like [Nicotiana sylvestris]
Length=358

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L  WKATSD  P LE + +  C KLKEIP+   +I  L  I+   C  +VV S
Sbjct  38   LHILMTNLVQWKATSDSLPNLECLVIRHCYKLKEIPAEIGDIPTLKLIELHHCSQAVVTS  97

Query  493  AEEIKEEQLDYLNNIVDV  440
            AEEI EEQ    N ++ V
Sbjct  98   AEEILEEQQSMGNEVLVV  115



>ref|XP_009776048.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=886

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -3

Query  679  MXLEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVV  500
            + L I  T L  WKA++DHFP+L+H+ L  C KLKEIP G A+I     ++ +    +  
Sbjct  795  LVLWIERTDLVSWKASADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAA  854

Query  499  ASAEEIKEEQ  470
             SA EI++++
Sbjct  855  ISAREIRDKK  864



>emb|CDP15718.1| unnamed protein product [Coffea canephora]
Length=905

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++      +W A SD+F +LE + L  C+KL+++PS   E E L  IQ + C  SVV S
Sbjct  761  LKLSGLEFHNWTAFSDNFFRLEKLVLHRCRKLEKVPSCLGECETLEMIQVKWCRESVVDS  820

Query  493  AEEIKEEQLDYLNNIVDV  440
             ++I++EQ+D  N ++ +
Sbjct  821  VKQIQQEQMDMGNEVLKI  838



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV S
Sbjct  815  LFLDDVYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNS  874

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  875  AKQIQQDIQDNYGSSIEV  892



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 45/74 (61%), Gaps = 1/74 (1%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  WKA   HFP+L H+ +  C  L+EIP    +I  L  I+   C PSVVASA +I+E+
Sbjct  783  LVRWKADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVASARQIQED  842

Query  472  QLDYLNNIVDV-VC  434
            Q +  N+ ++V +C
Sbjct  843  QSENGNDGLEVRIC  856



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  821  VYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQ  880

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  881  QDIQDNYGSSIEV  893



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  821  VYIRYWRASSDHFPYLERVILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQ  880

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  881  QDIQDNYGSSIEV  893



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            +K W+AT D FP LE I + +C+ L EIP  FA+   L  I+   C PS+V SAE I++E
Sbjct  759  IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQKE  818

Query  472  QLDYLNN  452
            QL+ L N
Sbjct  819  QLESLGN  825



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            +K W+AT D FP LE I + +C+ L EIP  FA+   L  I+   C PS+V SAE I++E
Sbjct  851  IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQKE  910

Query  472  QLDYL-NNIVDV  440
            QL+ L NN++ V
Sbjct  911  QLESLGNNMLKV  922



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  822  VYIRYWRASSDHFPYLERLILRDCRNLDSIPGDFADITTLALIDIDYCQQSVVNSAKQIQ  881

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  882  QDIQDNYGSSIEV  894



>emb|CDP11548.1| unnamed protein product, partial [Coffea canephora]
Length=947

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++     ++W A SD+F  L+ + L  C+KL+++PS   E E L  I+   CL SVV S
Sbjct  805  LKLSNLEFRNWTAFSDNFSHLQKLVLHWCRKLEKVPSCLGECETLEMIEVEECLESVVDS  864

Query  493  AEEIKEEQLDYLNNIVDV  440
             E+I++EQ+D  N ++ +
Sbjct  865  VEQIQQEQIDMGNEVLRI  882



>ref|XP_009797581.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=611

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +    + DW+++   FP LE + +  C+KL+EIPS FA+I+ L  I+ RGC+ SV  S
Sbjct  509  LNLRGVDMTDWRSSDASFPMLEKLVIRRCEKLQEIPSSFADIQTLKLIRLRGCMKSVKDS  568

Query  493  AEEIKEE  473
            A  IK+E
Sbjct  569  ALNIKKE  575



>ref|XP_009624584.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana tomentosiformis]
Length=723

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            +K W+AT D FP LE I + +C+ L EIP  FA+   L  I+   C PS+V SAE I++E
Sbjct  639  IKYWRATDDCFPCLERIIIRNCRFLIEIPQEFADSMTLQLIELHQCYPSLVNSAELIQKE  698

Query  472  QLDYLNN  452
            QL+ L N
Sbjct  699  QLESLGN  705



>emb|CDP21622.1| unnamed protein product, partial [Coffea canephora]
Length=935

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             + W A+SD+FP LE + +  C++L+E+P    E   L  I+ RGC  SV +S ++I++E
Sbjct  852  FRSWTASSDNFPHLEKLVVEWCRELEEVPFCLGECPTLEMIEVRGCRESVASSVKQIQQE  911

Query  472  QLDYLNNIVDVV  437
            Q+D  N ++ ++
Sbjct  912  QIDMGNEVLKIL  923



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK WKA S +FPKL+H+ L  C  L+EIP    EI  L SI+   C  S   S
Sbjct  802  LLIDRTNLKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKS  861

Query  493  AEEIKEEQLDYLNNIVDV  440
             +EI+EEQ    N+ + V
Sbjct  862  VKEIQEEQESMGNDCLSV  879



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV S
Sbjct  817  LFLDDVYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNS  876

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  877  AKQIQQDIQDNYGSSIEV  894



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W A + HFP LEH+ + +C  L+ IPSG  +I  L  I    C  S V S E+I EE
Sbjct  806  LVRWIAENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTSVEQILEE  865

Query  472  QLDYLNNIVDV  440
            Q D  NN++ V
Sbjct  866  QRDMENNVLQV  876



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV S
Sbjct  817  LFLDDVYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNS  876

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  877  AKQIQQDIQDNYGSSIEV  894



>ref|XP_009766585.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
 ref|XP_009766586.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
 ref|XP_009766587.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1214

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -3

Query  667   IGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGC-LPSVVASA  491
             +     K+W    D FP LEH++L  C+ LKEIPS FAEI  L  ++ R C + ++VAS 
Sbjct  1134  VNSDNFKEWNVLDDAFPCLEHLTLHKCQYLKEIPSWFAEIASLKFVRVRSCNVAALVASL  1193

Query  490   EEIKEEQL-DY  461
             +EI+  Q+ DY
Sbjct  1194  KEIRTMQVEDY  1204



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C+ L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  722  VYIRYWRASSDHFPYLERLILRDCRNLDSIPRDFADITTLALIDIDYCQQSVVNSAKQIQ  781

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  782  QDIQDNYGSSIEV  794



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +LK WKAT+D+FP LE + +  C +L+E+P  FA+++ L  I+   C   + ASA  I++
Sbjct  769  HLKYWKATNDNFPVLERLVITYCTELEEMPIEFADMDSLQLIELSYCTAQLEASAARIQQ  828

Query  475  EQLDYLNNIVDV  440
            EQ D  N  VDV
Sbjct  829  EQEDLGNKPVDV  840



>emb|CDP18676.1| unnamed protein product [Coffea canephora]
Length=1199

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             W A+ D+FP+LE + + SC KL+E+PS   E   L  I+  GC  SV +S ++I++EQ+D
Sbjct  1124  WTASFDNFPRLEKLVVRSCPKLEEVPSCLGECANLEMIEVSGCRESVASSVQQIQQEQID  1183

Query  463   YLNNIVDV  440
               N  + +
Sbjct  1184  MGNEALKI  1191



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I  T L  W ATSD  P LE++ L  C KLKEIP+   +I  L  ++   C  S V S
Sbjct  791  LDIVQTELVHWHATSDSLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTS  850

Query  493  AEEIKEEQLDYLNNIVDV  440
            AEEI EEQ    N I+ V
Sbjct  851  AEEILEEQQCLGNEILAV  868



>emb|CDO99208.1| unnamed protein product [Coffea canephora]
Length=542

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            LE+    +++W ATSD+F  LE + + +C KL+E+P+  AE   L  I+ + C  SV  S
Sbjct  456  LELSRLSIRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEVKWCRESVANS  515

Query  493  AEEIKEEQLDYLNNIVDVV  437
             ++I++EQ+D  N ++ ++
Sbjct  516  VKQIQQEQMDSGNEVLKII  534



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L+I  T L  W ATSD  P LE++ L  C KLKEIP+   +I  L  ++   C  S V S
Sbjct  733  LDIVQTELVHWHATSDSLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTS  792

Query  493  AEEIKEEQLDYLNNIVDV  440
            AEEI EEQ    N I+ V
Sbjct  793  AEEILEEQQCLGNEILAV  810



>ref|XP_006346788.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=676

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+++SD+FP L+ + L +C  L+EIP  F EI  L SI+   C  +   SA EI +EQ D
Sbjct  601  WESSSDNFPNLKRLVLKNCTDLQEIPGDFGEIGTLESIELHDCSTTTEDSAREIVQEQED  660

Query  463  YLNNIVDV  440
              NNI+ V
Sbjct  661  MGNNILKV  668



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++    +  W A+SDH P+L+H+ L SC++LKE+PSGFAE   L  I+ + C  +V  S
Sbjct  1399  LKLDSLNVAQWNASSDHLPQLQHLILRSCRQLKEVPSGFAESCTLEMIEVQLCTHTVEES  1458

Query  493   AEEIKEEQL  467
              + +++ QL
Sbjct  1459  VKSLQDGQL  1467



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            ++ W+A+SDHFP+LE + L  C  +  IP  F EI  L  I  R C  SVV SA++I++E
Sbjct  793  IRHWRASSDHFPRLERLFLVECANMISIPEDFVEITTLQLIDIRMCKESVVNSAKKIQQE  852

Query  472  QLDYLNNIVDV  440
              D     ++V
Sbjct  853  IEDNYGGSIEV  863



>emb|CDP17914.1| unnamed protein product [Coffea canephora]
Length=743

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            LE+    +++W ATSD+F  LE + + +C KL+E+P+  AE   L  I+ + C  SV  S
Sbjct  657  LELSRLSIRNWTATSDNFCHLEKLVVCNCLKLEEVPACLAECLTLEMIEVKWCRESVANS  716

Query  493  AEEIKEEQLDYLNNIVDVV  437
             ++I++EQ+D  N ++ ++
Sbjct  717  VKQIQQEQMDSGNEVLKII  735



>emb|CDP20159.1| unnamed protein product [Coffea canephora]
Length=1261

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++     ++W A SD+F +LE + L SC++L+++PS   E E L  I+ + C  SVV S
Sbjct  1171  LKLSELEFRNWTAFSDNFSRLEKLVLHSCEELEKVPSCLGECETLEMIEVKECPESVVDS  1230

Query  493   AEEIKEEQLDYLNNIVDV  440
              ++I++EQ+D  N ++ +
Sbjct  1231  VKQIQQEQIDMGNEVLKI  1248



>gb|AEW48199.1| disease resistance protein RGH6 [Solanum x edinense]
Length=913

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SVV SA++I++
Sbjct  828  YIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVVNSAKQIQQ  887

Query  475  EQLDYLNNIVDV  440
            +  D   + ++V
Sbjct  888  DIQDNYGSSIEV  899



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W+ATSD+FP LE + L     L+EIP    EI  L SI+ RGC  +V+ SA++I+E 
Sbjct  783  LERWEATSDNFPMLEELYLSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITSAKQIREN  842

Query  472  QLDYLN  455
            Q  Y N
Sbjct  843  QEIYGN  848



>ref|XP_009762295.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=169

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +L+ W+A+SD FP L  + L +C  LKEIP+ F E   L SI+   C      SA  I++
Sbjct  90   HLERWEASSDSFPNLRRLVLKNCNYLKEIPTNFGEFCTLESIEFHNCSSLAEDSARNIEQ  149

Query  475  EQLDYLNNIVDV  440
            EQ D  NN + V
Sbjct  150  EQEDMGNNSLKV  161



>emb|CDP12798.1| unnamed protein product [Coffea canephora]
Length=1266

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             LE+    L+ W ATSD+F +LE + + SC KL+E+PS   E   L  I+ + C  S V S
Sbjct  1182  LELSQLDLRSWTATSDNFSRLEKLVVQSCWKLEEVPSCLGECLNLEMIELKWCRESAVTS  1241

Query  493   AEEIKEEQLDYLNNIVDVV  437
              ++I+ EQ+D  N  + ++
Sbjct  1242  VKQIQREQMDAGNEGLRII  1260



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S HFP+LEH+ L    KLKEIPS   EI  L SIQ   C    V SA+EI +EQ D
Sbjct  715  WTTDSSHFPRLEHLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSNEAVISAKEILKEQED  774

Query  463  YLN  455
            + N
Sbjct  775  FGN  777



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = -3

Query  655  YLKDWKAT--SDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEI  482
            YL++W+ T  +DHF  LE + +  C  LKEIP GFA  + L  I+   C PSVVA A++I
Sbjct  796  YLRNWRTTDSNDHFSSLERVIIKGCNFLKEIPEGFAGSKNLELIELHKCTPSVVAIAQKI  855

Query  481  KEEQLDY  461
            +E+   Y
Sbjct  856  QEKHEYY  862



>emb|CDP17943.1| unnamed protein product [Coffea canephora]
Length=1143

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L+ W A+SD F  LE + + +C +LKE+PS   E   L  I+ + C  SVV S ++I++E
Sbjct  1065  LRSWTASSDSFLLLEKLVVHNCPRLKEVPSCLGECPTLEMIEVKWCDESVVRSVKQIQQE  1124

Query  472   QLDYLNNIVDVV---CG*A  425
             Q+D  N++++++   CG A
Sbjct  1125  QMDMGNDVLEIIIEYCGHA  1143



>ref|XP_004246080.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=871

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD+FP L+ + L  C+KLKEIP  F EI  L SI+   C      SA +I++EQ D
Sbjct  800  WEASSDNFPNLKRLVLKECRKLKEIPIDFGEICSLESIELHNCSTLAEESARKIEQEQED  859

Query  463  YLNNIVDV  440
              NN + V
Sbjct  860  MGNNCLKV  867



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK W A S +FPKL+ + L  C  L+EIP    EI  L SI+   C  SV  S
Sbjct  799  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  858

Query  493  AEEIKEEQLDYLNNIVDV  440
             +EI+EEQ    N+I+ V
Sbjct  859  VKEIQEEQESMANDILSV  876



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK W A S +FPKL+ + L  C  L+EIP    EI  L SI+   C  SV  S
Sbjct  799  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  858

Query  493  AEEIKEEQLDYLNNIVDV  440
             +EI+EEQ    N+I+ V
Sbjct  859  VKEIQEEQESMANDILSV  876



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++    + +WK++SDH P+L+H+ L +C++LKE+PSGF +   L  I+ + C  SV  S
Sbjct  808  LKLDTLSIAEWKSSSDHLPQLQHLILRNCRQLKEVPSGFGDSSSLEMIEVQLCTRSVEES  867

Query  493  AEEIKEEQ  470
               +++EQ
Sbjct  868  VRLLQKEQ  875



>gb|EYU21836.1| hypothetical protein MIMGU_mgv1a023326mg [Erythranthe guttata]
Length=923

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W   ++HFP+LEH+ L    KLKEIPS   EI  L SIQ   C    V SA++I +E
Sbjct  850  LQWWTTDNNHFPRLEHLHLQGLHKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKQILKE  909

Query  472  QLDYLN  455
            Q D+ N
Sbjct  910  QEDFGN  915



>ref|XP_006345615.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=202

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK W+A SD+FP LE + L   + L+EIP    EI  L  I+ + C P+VV+SA +I+++
Sbjct  71   LKRWEAHSDNFPMLEQLILHRFRVLQEIPDSIGEIMTLKFIEIKNCGPTVVSSANKIQQD  130

Query  472  QLDYLN  455
            Q  + N
Sbjct  131  QESWGN  136



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK W A S +FPKL+ + L  C  L+EIP    EI  L SI+   C  SV  S
Sbjct  783  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  842

Query  493  AEEIKEEQLDYLNNIVDV  440
             +EI+EEQ    N+I+ V
Sbjct  843  VKEIQEEQESMANDILSV  860



>gb|EYU31552.1| hypothetical protein MIMGU_mgv1a025226mg [Erythranthe guttata]
Length=1038

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++    ++ W  + DHFP+L+ + +  C KLK+ P    +I  L  +    C  SV  S
Sbjct  954   LKLDALKIRRWNTSDDHFPRLQRLVMHKCWKLKKFPRSLGDIPTLQVVDIHSCSKSVANS  1013

Query  493   AEEIKEEQLDYLNNIVDVVCG*ATW  419
             A +++ EQL+Y N+ + ++   + W
Sbjct  1014  ALDVQREQLEYGNDELKIIISGSLW  1038



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W A  D FP LE + + +C  L++IP GFA+   L  I+ RGC  S+V  A EI+EE
Sbjct  765  LEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNFAREIQEE  824

Query  472  QLDYL-NNIVDV  440
            Q   L NNI+ V
Sbjct  825  QQQRLGNNILQV  836



>gb|EYU21837.1| hypothetical protein MIMGU_mgv1a021514mg [Erythranthe guttata]
Length=745

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S HFP+LEH+ L    KLKEIPS   EI  L SIQ   C    V SA+EI +EQ D
Sbjct  653  WATDSSHFPRLEHLQLQFLDKLKEIPSCIGEISTLQSIQLLRCSDEAVISAKEILKEQED  712

Query  463  YLN  455
            + N
Sbjct  713  FGN  715



>gb|AEW48196.1| disease resistance protein RGH7 [Solanum chacoense]
Length=914

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVVNSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + + V
Sbjct  886  QDIQDNYGSSIKV  898



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W A  D FP LE + + +C  L++IP GFA+   L  I+ RGC  S+V  A EI+EE
Sbjct  898  LEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNFAREIQEE  957

Query  472  QLDYL-NNIVDV  440
            Q   L NNI+ V
Sbjct  958  QQQRLGNNILQV  969



>ref|XP_010319427.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD+FP L+ + L  C  L+EIP+ F EI  L SI+   C  +   SA  I++EQ D
Sbjct  231  WEASSDNFPNLKRLVLKKCPDLQEIPTDFGEICTLESIELHDCSATSEVSARNIEQEQED  290

Query  463  YLNNIVDV  440
              NNI+ V
Sbjct  291  MENNILKV  298



>ref|XP_009778512.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009778577.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=795

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y+ +W+++   FP LE + +  C+KL+EIPS FA+I+ L  I+  GC+ SV  S
Sbjct  693  LNLKVVYMTEWRSSEASFPVLEKLVIRRCEKLQEIPSSFADIQTLKLIRLTGCMKSVEDS  752

Query  493  AEEIKEE  473
            A  IK+E
Sbjct  753  ALNIKKE  759



>ref|XP_009596161.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Nicotiana tomentosiformis]
Length=1286

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L++W  + D FP LE + L   + LKEIPS F +I  L SI+ R C   VV SA +I+E 
Sbjct  1197  LEEWTISKDAFPNLERLFLRGLENLKEIPSCFGDISSLKSIEVRECNEYVVMSARDIREI  1256

Query  472   QL-DYLNN  452
             Q+ DYLN+
Sbjct  1257  QVEDYLNS  1264



>ref|XP_009778311.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009778377.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009778441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=796

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y+ +W+++   FP LE + +  C+KL+EIPS FA+I+ L  I+  GC+ SV  S
Sbjct  694  LNLKVVYMTEWRSSEASFPVLEKLVIRRCEKLQEIPSSFADIQTLKLIRLTGCMKSVEDS  753

Query  493  AEEIKEE  473
            A  IK+E
Sbjct  754  ALNIKKE  760



>ref|XP_009778636.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=780

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y+ +W+++   FP LE + +  C+KL+EIPS FA+I+ L  I+  GC+ SV  S
Sbjct  678  LNLKVVYMTEWRSSEASFPVLEKLVIRRCEKLQEIPSSFADIQTLKLIRLTGCMKSVEDS  737

Query  493  AEEIKEE  473
            A  IK+E
Sbjct  738  ALNIKKE  744



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I    LK W+A+S +FP+LE + L  C  L+EIP    EI  L SI+   C  S   S
Sbjct  799  LLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  493  AEEIKEEQLDYLNNIVDVVCG*ATW  419
              EI+EEQ    NN + V+     W
Sbjct  859  VNEIQEEQASMGNNCLSVITDNCRW  883



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L  WKAT+DHFP LEH+ +  C  L +IP  FA+I  L  I+ + C   ++AS
Sbjct  821  LLIEGTNLTRWKATNDHFPALEHLVIKHCFHLVKIPIEFADIYSLQLIELQNCKAKLMAS  880

Query  493  AEEIKEEQLDYL  458
               I+EEQ +YL
Sbjct  881  TVRIQEEQ-EYL  891



>ref|XP_006349898.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=386

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (56%), Gaps = 1/77 (1%)
 Frame = -3

Query  679  MXLEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVV  500
            + L  G  + ++W    D F  LE + L  C  LKEIPS F +I  L SI+ R C  +V 
Sbjct  287  LKLHAGQAHFEEWTVAEDSFANLERLVLSDCVFLKEIPSCFGDISSLKSIEVRNCNENVD  346

Query  499  ASAEEIKEEQL-DYLNN  452
             SA +I+E Q+ DY N+
Sbjct  347  KSARDIRETQVEDYQNS  363



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SVV SA++I+
Sbjct  791  VYIRYWRASSDHFPYLERLFLRDCYFLDSIPRDFADITTLALIDISSCRQSVVNSAKQIQ  850

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  851  QDIQDNYGSSIEV  863



>gb|EYU21833.1| hypothetical protein MIMGU_mgv1a009417mg [Erythranthe guttata]
Length=342

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQ  470
            W   S+HFP+LEH+ L    KLKEIPS   EI  L SIQ   C    V SAE+I +EQ
Sbjct  285  WTTDSNHFPRLEHLHLEDLDKLKEIPSCIGEISTLQSIQLLSCSDEAVISAEQILKEQ  342



>gb|EYU20573.1| hypothetical protein MIMGU_mgv1a000577mg [Erythranthe guttata]
Length=1062

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -3

Query  652   LKDWKA-TSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRG-CLPSVVASAEEIK  479
             L +W   +S+HFPKL+ + LF C  L+E+PS   +I  L  I+ RG CL ++V SA  I+
Sbjct  987   LDEWNVESSEHFPKLQRLVLFECYNLEEVPSEIGDIGTLQFIEIRGWCLKTLVESAVRIE  1046

Query  478   EEQLDYLNNIVDVV  437
             EEQ D  N  + VV
Sbjct  1047  EEQRDMGNEELRVV  1060



>ref|XP_011072183.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=416

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQ  470
            W+A S H P L H+++ +C +L+ +PSG  EI +L SI+     PS V SAEEI EEQ
Sbjct  339  WRADSIHLPILRHLTIENCLRLEAVPSGIGEIPKLQSIELDKSSPSAVTSAEEILEEQ  396



>emb|CDP19489.1| unnamed protein product [Coffea canephora]
Length=1247

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              + W A+SD+FP+LE + +  C++L+E+P    E + L  I+ RGC  SV  S ++I++E
Sbjct  1175  FRRWTASSDNFPRLEKLVVHWCRELEEVPFCLGECQALEMIEVRGCRESVANSVKQIQQE  1234

Query  472   QLDYLN  455
             Q D  N
Sbjct  1235  QRDMGN  1240



>gb|ABO93001.1| putative disease resistance protein [Solanum tuberosum]
Length=1208

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              K W  + D FP LEH+ L  C+ L+ IPS F +I  L SI+ + C  S+V SA  I+E 
Sbjct  1133  FKKWSVSDDAFPCLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCKESLVESAMVIRES  1192

Query  472   QLDYLNN  452
             Q++ + N
Sbjct  1193  QVEEMQN  1199



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W A   HFP L+ + + SC KLKEIPSG  EI  L  I+   C  S V SAE+I+EE
Sbjct  650  LVQWVANETHFPCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTSAEKIQEE  709

Query  472  Q  470
            Q
Sbjct  710  Q  710



>gb|AAU93590.2| Late blight resistance protein, putative [Solanum demissum]
Length=1151

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
              K W  + D FP LEH+ L  C+ L+ IPS F +I  L SI+ + C  S+V SA  I+E 
Sbjct  1076  FKKWSVSDDAFPCLEHLVLRRCRYLEAIPSRFGDITSLISIEVKSCKESLVESAMVIRES  1135

Query  472   QLDYLNN  452
             Q++ + N
Sbjct  1136  QVEEMQN  1142



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ WKATS H+P L+H+ L  C  L EIP G  EI  L  I+   C  S V SA+ I EE
Sbjct  835  LEIWKATSTHYPSLQHLVLRLCDALIEIPCGIGEIPTLQIIELYSCGHSAVRSAKRIHEE  894

Query  472  QLDYLNNIVDV  440
            Q    N+ ++V
Sbjct  895  QQSIGNDDLEV  905



>ref|XP_009624787.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=888

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -3

Query  679  MXLEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVV  500
            + L I  T L  WKA++DHFP+L+H+ L  C KLKEIP G A+I     ++ +    +  
Sbjct  796  LVLWIERTDLVSWKASADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAA  855

Query  499  ASAEEIKEEQ  470
             SA +I+ ++
Sbjct  856  ISARDIRAKK  865



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  + LK W   S+HFPKLE + L  C  L EI  G  EI  L  I+ + C  S+   
Sbjct  734  LMIEYSKLKYWVTESNHFPKLERVLLHDCSYLIEISDGVGEIPTLELIEVKFCTESIAGW  793

Query  493  AEEIKEEQLDYLNN  452
            A+ ++EEQ DY N+
Sbjct  794  AKRMREEQQDYRND  807



>gb|EYU21175.1| hypothetical protein MIMGU_mgv1a021134mg [Erythranthe guttata]
Length=766

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IGPT L  WKA+  HFPKL  + L++C++L ++P G A+I+ L  ++   C     AS
Sbjct  676  LHIGPTNLVVWKASGHHFPKLRRLELYNCEELIQVPIGLADIQSLQFLEL-NCSNFAAAS  734

Query  493  AEEIKE  476
            A+EI+ 
Sbjct  735  AKEIRN  740



>ref|XP_006367044.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=119

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD+FP L+ + L  CK L++IP+ F EI  L SI+   C  +   S   I++E+ D
Sbjct  44   WEASSDNFPNLKRLVLKKCKDLQKIPTDFVEICTLESIELHDCTTTAEDSVRNIEQERED  103

Query  463  YLNNIVDV  440
               NIV V
Sbjct  104  MGYNIVKV  111



>ref|XP_011071935.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=888

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 43/81 (53%), Gaps = 0/81 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I    L  W+  S+HFPKLE + L     LKEIPS   +I  L SI    C  SV+ S
Sbjct  784  LSISGCKLVSWRVESNHFPKLERLFLEDMHDLKEIPSSIGDIATLVSIHLDTCGNSVLHS  843

Query  493  AEEIKEEQLDYLNNIVDVVCG  431
            A ++  EQ+DY N    ++ G
Sbjct  844  AMQMLNEQVDYGNEFELLING  864



>ref|XP_009609967.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=468

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
            T+   W+A+SD+FP L+ + L +C  LK+IP+ F EI  L SI+   C  +   SA +IK
Sbjct  403  TFFHHWEASSDNFPNLKRLVLNNCHYLKQIPTDFGEICSLESIELHYCNTTAEDSARKIK  462

Query  478  EEQLD  464
            +EQ D
Sbjct  463  QEQQD  467



>emb|CDP12770.1| unnamed protein product [Coffea canephora]
Length=811

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 45/71 (63%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             + W A+SD+FP+L+ + + +C+ L+E+PS   E   L  I+ + C  SV  S ++I++E
Sbjct  733  FRSWTASSDNFPRLQKLVVHNCENLEEVPSCLGECPTLEMIEVKWCRTSVANSVKQIQQE  792

Query  472  QLDYLNNIVDV  440
            Q+D  N ++ +
Sbjct  793  QIDMGNEVLKI  803



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SVV S
Sbjct  810  LFLNNVYIRYWRASSDHFPYLERLFLRKCCYLDSIPRDFADITTLALIDISYCRQSVVNS  869

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  870  AKQIQQDIQDNYGSSIEV  887



>emb|CDP12821.1| unnamed protein product [Coffea canephora]
Length=1248

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             LE+     + W A+SD+F  LE + L SC+ L+E+PS   E   L  I+  GC  SVV S
Sbjct  1121  LELSELDFRWWTASSDNFCCLEKLVLSSCESLEEVPSCLGEALTLDMIELEGCRASVVTS  1180

Query  493   AEEIKEEQLDYLNN  452
              ++I+ +Q+D  NN
Sbjct  1181  VKQIQHQQMDMGNN  1194



>ref|XP_009758684.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1275

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L++W A    FPKLE +SL   + LKEIPS F +I+ L SI+ R C  SVV SA  I+E 
Sbjct  1190  LEEWDAVEYSFPKLERLSLRGLENLKEIPSCFVDIQFLQSIEVRECNESVVKSARFIQEF  1249

Query  472   QL-DYLN  455
             Q  DY N
Sbjct  1250  QFEDYQN  1256



>emb|CDP18040.1| unnamed protein product [Coffea canephora]
Length=1243

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L+ W A+SD+FP LE + + +C+ L+E+PS   E   L  I+ + C  SV +S +++++E
Sbjct  1162  LRSWTASSDNFPCLEKLVVRNCENLEEVPSCLGECPTLEMIEVKRCRESVASSVKQVQQE  1221

Query  472   QLDYLNNIVDVV  437
             Q+D  N ++ ++
Sbjct  1222  QIDMGNEVLKIL  1233



>emb|CDP18680.1| unnamed protein product [Coffea canephora]
Length=1268

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             W A+ D+FP+LE + + SC  L+E+PS   E   L  I+  GC  SV +S ++I++EQ+D
Sbjct  1181  WTASFDNFPRLEKLVVHSCLMLEEVPSCLGECPALEVIEVSGCSESVASSVKQIQQEQID  1240

Query  463   YLNNIVDVV  437
               N ++ ++
Sbjct  1241  MGNEVLKIL  1249



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I    LK W+A+S +FP+LE + L  C  L+EIP    EI  L SI+   C  S   S
Sbjct  799  LLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  493  AEEIKEEQLDYLNNIVDVV  437
              EI+EEQ    NN + V+
Sbjct  859  VNEIQEEQASMGNNCLSVI  877



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L  W+ATSD  P LE++ L  C +L+EIP    +I  L  I    C  + V S
Sbjct  792  LHIHQTRLVHWQATSDSLPVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTS  851

Query  493  AEEIKEEQLDYLNNIVDVV  437
            AEEI+EEQ    N ++ V 
Sbjct  852  AEEIQEEQKSIGNEVLVVT  870



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -3

Query  652  LKDWKATS---DHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEI  482
            L  W  T+   DHFP LE + +  C  LKEIP GFA+ ++L  I+   C PS+VA AE+I
Sbjct  714  LDKWTITTVSHDHFPSLERVLITDCIYLKEIPQGFADSKKLELIELHRCDPSLVAFAEKI  773

Query  481  KEEQLDYLNNIVDVV  437
            +E+  D   N + V 
Sbjct  774  QEKHEDLGRNKLKVT  788



>ref|XP_011071886.1| PREDICTED: uncharacterized protein LOC105157233 [Sesamum indicum]
Length=336

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W+A S HFP LE + L S + L+EIPSG  +I  L SI    C  S V SA++I EE
Sbjct  263  LVRWRAESIHFPNLERLHLSSMQCLEEIPSGIGDIPTLLSIDLYDCSDSCVNSAKQILEE  322

Query  472  QLDYLNNIVDVVCG  431
            Q  + N  + +  G
Sbjct  323  QQSFGNETLQLYVG  336



>ref|XP_010677242.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010677243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Beta vulgaris subsp. vulgaris]
Length=1165

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  634   TSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLDYLN  455
             ++D FPKLE + +  C KL++IPS F + ++L  I   GC  SV  SA +IKEEQ DY N
Sbjct  1090  SADAFPKLECLVIKYCDKLRKIPSSFVDNKKLRLILLEGCKSSVEKSANQIKEEQQDYGN  1149

Query  454   NIVDVV  437
                +VV
Sbjct  1150  KNFEVV  1155



>emb|CDP04755.1| unnamed protein product [Coffea canephora]
Length=679

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++   + + W A+S+ F +LE + +  C+KL+E+PS   E   L  I+ +GC  SVV+S
Sbjct  591  LKLIDLHFRSWTASSESFRRLEKLVVHECQKLEEVPSYLGECATLEMIEVKGCGESVVSS  650

Query  493  AEEIKEEQLD  464
             ++I++EQ+D
Sbjct  651  VKQIQQEQMD  660



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IG T L+ W A   HFP L+ + L  CK LKEIP G +E   L  I+   C  S V S
Sbjct  821  LLIGSTNLEIWDADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLLEKIELHCCKDSAVIS  880

Query  493  AEEIKEEQ  470
            A  ++EEQ
Sbjct  881  ARHLQEEQ  888



>emb|CDP17703.1| unnamed protein product [Coffea canephora]
Length=1247

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQ  470
             W  + DHFP+L+ + L  C KLKEIPS       L  I+ R C PSVV+ AEE+KE Q
Sbjct  1173  WTGSGDHFPRLQKLILEQCWKLKEIPSCLGSNSPLEMIEIRWCPPSVVSLAEEVKEGQ  1230



>emb|CDP04880.1| unnamed protein product [Coffea canephora]
Length=1012

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             W A+ +H P LE + + SC++L+EIPS F EI  L  I+ + C  S   S ++I ++Q D
Sbjct  935   WSASGEHLPCLEQLVVLSCQQLEEIPSCFGEISTLQLIELKCCSASAKDSVKQILDDQRD  994

Query  463   YLNNIVDVV  437
             Y N+ ++V 
Sbjct  995   YGNHQLNVT  1003



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L++    L +W A+SDH P+L+H+ L SC +LKE+P GF +   L  I+ + C  S+  S
Sbjct  1014  LKLDSLNLSEWNASSDHLPQLQHLILQSCWQLKEVPPGFGDSFTLEIIEVQMCTSSLEES  1073

Query  493   AEEIKEEQLDYLNNI  449
              + ++EEQ +  N +
Sbjct  1074  VKRLEEEQQEMGNEL  1088



>gb|AEW48207.1| disease resistance protein RGH5 [Solanum fernandezianum]
Length=912

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I++
Sbjct  827  YIRYWRASSDHFPYLERLFLRNCYDLDSIPRDFADITTLALIDISSCRQSVGKSAKQIQQ  886

Query  475  EQLDYLNNIVDV  440
            +  D   + ++V
Sbjct  887  DIQDNYGSSIEV  898



>ref|XP_010319246.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=879

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+ATSD+FP L+ + L +C +L+EIP+ F EI  L SI+   C  +   SA EI +EQ +
Sbjct  804  WEATSDNFPNLKRLVLKNCYRLQEIPADFGEIGTLESIELHNCSTTADDSAREIVQEQEE  863

Query  463  YLNNIVDV  440
              N  + V
Sbjct  864  MGNYFLKV  871



>ref|XP_006355133.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006355134.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X2 [Solanum tuberosum]
Length=1190

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -3

Query  667   IGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAE  488
             +  +  K+W    D FPKLEH+ L  C+ L EIPS FAE+  L  I+   C  SVV SA 
Sbjct  1109  VNCSSFKEWTVYDDAFPKLEHMVLHCCQLLVEIPSWFAEVSSLKYIEVDNCNGSVVESAR  1168

Query  487   EIKEEQL-DYLNNIVDVV  437
              I+  ++ +Y N+ +++V
Sbjct  1169  IIQRTKVEEYANDDLELV  1186



>gb|AEW48195.1| disease resistance protein RGH6 [Solanum chacoense]
Length=912

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLTLIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>gb|AEW48202.1| disease resistance protein RGH4 [Solanum ehrenbergii]
 gb|AEW48203.1| disease resistance protein RGH7 [Solanum ehrenbergii]
Length=914

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLTLIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>gb|AEW48189.1| disease resistance protein RGH9 [Solanum albicans]
Length=912

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>ref|XP_006348578.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=915

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK W+A+SD+FP L  + L  C KL EIP  F EI  L SI+   C      SA +I++E
Sbjct  761  LKYWEASSDNFPNLRRLVLKKCTKLNEIPIDFGEICTLESIELYQCGVGAEESARKIEQE  820

Query  472  QLDYLNNIVDV  440
            Q D  NN + +
Sbjct  821  QEDMGNNFLKI  831


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W+A+SD FP L+ ++L  C  L EIP+ F EI    SI+   C      SA +I++E
Sbjct  847  LSIWEASSDSFPNLKRLALKKCNYLNEIPTDFGEICTFESIELYQCSIGAEESARKIEQE  906

Query  472  QLDYLNN  452
            Q D  NN
Sbjct  907  QEDMGNN  913



>emb|CDP04756.1| unnamed protein product [Coffea canephora]
Length=1312

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             W A+S  FP+LE + +  C KL+E+PS   E   L  I  R C  SV +S E+I++EQ+D
Sbjct  1170  WIASSAIFPRLEKLVVHDCTKLEEVPSCLGECPTLEMINVRRCSESVESSVEQIQQEQMD  1229

Query  463   YLNNIVDVV  437
               N ++ +V
Sbjct  1230  MGNEVLRIV  1238



>gb|AEW48193.1| disease resistance protein RGH4 [Solanum chacoense]
Length=914

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLTLIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>ref|XP_009592131.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
 ref|XP_009592132.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana tomentosiformis]
Length=1287

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -3

Query  655   YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
             + K+W    D FP LEH++L  CK LKEIPS F ++  L SI+   C   V  SA +I E
Sbjct  1142  FFKEWTVADDAFPHLEHLALHDCKFLKEIPSCFGDLCSLKSIEVEYCNKFVDKSARDIWE  1201

Query  475   EQLDYLNNIVDVVCG*ATW  419
              Q++   N   VV    +W
Sbjct  1202  TQVEDYQNSSFVVSIQESW  1220



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  + L  W+A   HFP LE + L    KL+EIPSG   IE L SI    C   VV S
Sbjct  781  LFISDSDLVSWRADDFHFPHLESLFLRLMHKLEEIPSGIGHIETLRSIHLNKCSELVVNS  840

Query  493  AEEIKEEQLDYLNNI  449
            A++I EEQ  Y N +
Sbjct  841  AKQILEEQSSYGNEL  855



>gb|AEW48194.1| disease resistance protein RGH5 [Solanum chacoense]
Length=914

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>ref|XP_010319426.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=310

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD+FP L+ + L  C+ L+EIP+ F EI  L SI+   C  +   SA  I++EQ D
Sbjct  231  WEASSDNFPNLKRLVLKICEDLQEIPTDFGEICTLESIELHDCSATSEDSARNIEQEQED  290

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  291  MGNNMLKV  298



>gb|AEW48188.1| disease resistance protein RGH7 [Solanum albicans]
Length=912

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  886  QDIQDNYGSSIEV  898



>gb|AEW48186.1| disease resistance protein RGH2 [Solanum albicans]
Length=910

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  824  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRQSVGKSAKQIQ  883

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  884  QDIQDNYGSSIEV  896



>ref|XP_009758685.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1249

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L++W    D FP LEH+ L  C  L+EIPS F +I  L SI  R C  SV  SA +I E 
Sbjct  1172  LREWTVHDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDIWET  1231

Query  472   QL-DYLNN  452
             Q+ DY N+
Sbjct  1232  QVEDYQNS  1239



>ref|XP_009588135.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009588199.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1201

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L++W    D FP LEH+ L  C  L+EIPS F +I  L SI  R C  SV  SA +I E 
Sbjct  1114  LREWTVPDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDIWET  1173

Query  472   QL-DYLNN  452
             Q+ DY N+
Sbjct  1174  QVEDYQNS  1181



>ref|XP_004237148.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=881

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A SD+FP L+ + L +C +L+EIP+ F EI  L SI+   C  +   SA EI +EQ D
Sbjct  807  WEANSDNFPNLKRLVLKNCYRLQEIPADFGEIGTLESIELHNCSTTADDSAREIVQEQED  866

Query  463  YLNNIVDV  440
              N  + +
Sbjct  867  MGNYFLKI  874



>ref|XP_009791056.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1101

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             LE+    +  W    D FP L+H+ L  CK LKEIPS F +I  L SI+   C  SV  S
Sbjct  1007  LELDDLRIGGWIVEDDAFPNLQHLILLECKSLKEIPSCFGDISSLKSIKVEECNESVNKS  1066

Query  493   AEEIKEEQL-DYLN  455
             A +I   Q+ DY N
Sbjct  1067  ARDIWNTQVEDYQN  1080



>ref|XP_009791054.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009791055.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=1135

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             LE+    +  W    D FP L+H+ L  CK LKEIPS F +I  L SI+   C  SV  S
Sbjct  1041  LELDDLRIGGWIVEDDAFPNLQHLILLECKSLKEIPSCFGDISSLKSIKVEECNESVNKS  1100

Query  493   AEEIKEEQL-DYLN  455
             A +I   Q+ DY N
Sbjct  1101  ARDIWNTQVEDYQN  1114



>ref|XP_009782925.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=795

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A+SD FP L+ + L  C  L+EIP+ F EI  L SI+   C  S   SA  I++EQ D
Sbjct  719  WEASSDSFPNLKRLVLNHCPYLEEIPTDFGEICTLESIELHNCSTSAEDSARNIEQEQED  778

Query  463  YLNNIVDV  440
              NN + V
Sbjct  779  MGNNCLKV  786



>ref|XP_006357456.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=874

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK W+A+S +FPKL+ + L  C  L+EIP  F EI  L SI+   C  S   S
Sbjct  790  LLISWTGLKHWEASSVNFPKLQRLFLKRCMNLEEIPQDFGEICTLESIELHDCSISAAKS  849

Query  493  AEEIKEEQ  470
             ++IKEEQ
Sbjct  850  GKDIKEEQ  857



>ref|XP_009783244.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009783245.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
Length=1272

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  652   LKDWKATSDH-FPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
              ++W  T D  FPKLE + L  C+ LKEIPS F EI  L  I+ R C  SV  SA +I+E
Sbjct  1175  FEEWDVTDDEAFPKLERLVLRECEYLKEIPSAFGEISSLKYIEVRKCPESVDKSARDIRE  1234

Query  475   EQL-DYLN  455
              Q+ DY N
Sbjct  1235  IQVEDYQN  1242



>ref|XP_009587753.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587821.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587887.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587951.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588013.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588066.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1260

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L++W    D FP LEH+ L  C  L+EIPS F +I  L SI  R C  SV  SA +I E 
Sbjct  1173  LREWTVPDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDIWET  1232

Query  472   QL-DYLNN  452
             Q+ DY N+
Sbjct  1233  QVEDYQNS  1240



>gb|EYU31599.1| hypothetical protein MIMGU_mgv1a025745mg, partial [Erythranthe 
guttata]
Length=692

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S+HFP+LEH+ L    KLKEIPS   EI  L SI+   C    V SA++I +EQ D
Sbjct  607  WTTDSNHFPRLEHLHLQFLDKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQED  666

Query  463  YLN  455
            + N
Sbjct  667  FGN  669



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W+ATSD+FP LE ++L     L+EIP    EI  L SI+ + C  +V+ SAE+I+E 
Sbjct  785  LEIWEATSDNFPMLEELNLSWLHFLEEIPESIGEIMTLRSIEIKDCNSAVITSAEQIREN  844

Query  472  QLDYLN  455
            Q  Y N
Sbjct  845  QEIYGN  850



>ref|XP_009783246.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana sylvestris]
Length=1220

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  652   LKDWKATSDH-FPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
              ++W  T D  FPKLE + L  C+ LKEIPS F EI  L  I+ R C  SV  SA +I+E
Sbjct  1123  FEEWDVTDDEAFPKLERLVLRECEYLKEIPSAFGEISSLKYIEVRKCPESVDKSARDIRE  1182

Query  475   EQL-DYLN  455
              Q+ DY N
Sbjct  1183  IQVEDYQN  1190



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IG T L+ W A+  HFP+L+ + L  C  L EIP G  E+  L +I+     P+  AS
Sbjct  801  LHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAAS  860

Query  493  AEEIKEEQL--DYLNNIVDVV  437
            A  I++E+   D  +N+  +V
Sbjct  861  ARIIQQEKQEGDIKDNVFKLV  881



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L       C  SVV S
Sbjct  786  LFLDEVYIRYWRASSDHFPYLERLFLRDCYFLDSIPRDFADITTLALTDISSCRQSVVNS  845

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  846  AKQIQQDIQDNYGSSIEV  863



>ref|XP_009784309.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=330

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            YL+ W+A+SD FP L+ + L  C  LKEIP  F EI  L SI+   C  +   SA  I++
Sbjct  250  YLERWEASSDSFPNLKRLVLKKCFLLKEIPIDFGEICTLESIELHNCSIAAEDSATIIEQ  309

Query  475  EQLDYLNNIVDV  440
            EQ D  NN + V
Sbjct  310  EQADMGNNSLKV  321



>ref|XP_009602410.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=938

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK WKAT D+FP LE + +  C +L+EIP  FA+I  L  I+   C   + ASA  I++E
Sbjct  863  LKYWKATDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQE  922

Query  472  QLDYLNNIVDV  440
            Q D     VDV
Sbjct  923  QEDLGIKPVDV  933



>ref|XP_009798058.1| PREDICTED: LOW QUALITY PROTEIN: late blight resistance protein 
R1-A-like [Nicotiana sylvestris]
Length=1265

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             LK+W  + D FP LE + L  C  +KE PS F +I  L SI+ + C  SVV SA  I+E 
Sbjct  1191  LKEWTVSDDAFPNLERLVLRRCWNIKETPSCFGDILSLKSIEVKYCNESVVKSARVIRET  1250

Query  472   QLDYLNN  452
             Q++   N
Sbjct  1251  QVEEYQN  1257



>ref|XP_009602412.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602413.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009602414.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=895

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            LK WKAT D+FP LE + +  C +L+EIP  FA+I  L  I+   C   + ASA  I++E
Sbjct  820  LKYWKATDDNFPVLERLLIRDCHRLEEIPIEFADIYSLQLIELTDCTTELEASAARIQQE  879

Query  472  QLDYLNNIVDV  440
            Q D     VDV
Sbjct  880  QEDLGIKPVDV  890



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S HFP+LEH+ L    KLKEIPS   EI  L SI+   C    V SA++I +EQ D
Sbjct  778  WTTDSSHFPRLEHLHLRYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQILKEQED  837

Query  463  YLN  455
            + N
Sbjct  838  FGN  840



>ref|XP_009608834.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
Length=1272

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -3

Query  667   IGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAE  488
             I  + LK+W  + D FP LE + L  C  +KE PS F +I  L SI+ + C  SVV SA 
Sbjct  1193  IDCSSLKEWTVSDDAFPNLERLVLRRCWNIKETPSCFGDILSLKSIEVKYCSESVVKSAR  1252

Query  487   EIKEEQLDYLNN  452
              I+E Q++   N
Sbjct  1253  IIRETQVEEYQN  1264



>ref|XP_009796668.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009796669.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana sylvestris]
Length=898

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T  + W+A++ HFP+L H+ L  C KL+ +P+ FA+I  L  ++      +V ++
Sbjct  795  LSIDTTDFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRSA  854

Query  493  AE-EIKEEQLDYLNNI  449
             E E K++++ +LNNI
Sbjct  855  KEIERKKQEMQFLNNI  870



>ref|XP_009796670.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X4 [Nicotiana sylvestris]
Length=887

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T  + W+A++ HFP+L H+ L  C KL+ +P+ FA+I  L  ++      +V ++
Sbjct  795  LSIDTTDFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRSA  854

Query  493  AE-EIKEEQLDYLNNI  449
             E E K++++ +LNNI
Sbjct  855  KEIERKKQEMQFLNNI  870



>emb|CDP05594.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -3

Query  643   WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
             WKA+   FPKLE + +  C  L+EIP  F+EIE L  IQ R C   V  SA++I +EQ D
Sbjct  1179  WKASYTPFPKLEQLVIEDCSDLEEIPFSFSEIEGLKLIQLRRCSYDVEDSAQQILQEQRD  1238

Query  463   YLNNIVDVV  437
               N   DV+
Sbjct  1239  SGNPEFDVL  1247



>ref|XP_009796664.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=916

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T  + W+A++ HFP+L H+ L  C KL+ +P+ FA+I  L  ++      +V ++
Sbjct  795  LSIDTTDFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRSA  854

Query  493  AE-EIKEEQLDYLNNI  449
             E E K++++ +LNNI
Sbjct  855  KEIERKKQEMQFLNNI  870



>ref|XP_009796665.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009796666.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=906

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T  + W+A++ HFP+L H+ L  C KL+ +P+ FA+I  L  ++      +V ++
Sbjct  795  LSIDTTDFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRSA  854

Query  493  AE-EIKEEQLDYLNNI  449
             E E K++++ +LNNI
Sbjct  855  KEIERKKQEMQFLNNI  870



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W   SDHFP L+ + L  C+ L+EIP    EI  L  I+ +G   S+  SA+ I+EE
Sbjct  786  LRHWITESDHFPSLKWLLLRHCEHLREIPDAIGEIPTLQLIEVKGGSASLFESAKGIQEE  845

Query  472  QLDYLNNIVDVVC  434
            Q  + N  + V C
Sbjct  846  QQSWGNEALQVRC  858



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            YL+ W AT D+F  LE + +  CK LKEIP GFA+   L  I+   C   +V  A++I+E
Sbjct  794  YLRYWTATDDYFQCLERVCIRECKLLKEIPEGFADSVTLQLIELHKCRRPLVTFAKQIQE  853

Query  475  EQLDYLNNIVDV  440
            +  +  NN++ V
Sbjct  854  KHEELGNNMLKV  865



>gb|AAT38775.2| NB-ARC domain containing protein [Solanum demissum]
Length=551

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W    D FP LE + L  C+ L EIPS F +I  L  I+   C  SVV SA  I+E 
Sbjct  426  LMKWIVADDAFPNLEQLVLRGCRDLMEIPSCFMDILSLQYIKVENCNESVVKSAMNIQET  485

Query  472  QLDYLNN  452
            Q++Y  N
Sbjct  486  QVEYYQN  492



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SV  S
Sbjct  823  LSLDDVYIQYWRASSDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISKCQQSVGNS  882

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  883  AKQIQQDIQDNYGSSIEV  900



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  667  IGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAE  488
            I  T L++W+A+SD+FP LEH+ L  CK LK IP G  EI  L   +   C  S   SA+
Sbjct  932  IDSTNLENWEASSDNFPCLEHLVLRGCKFLKGIPDGIEEINTLQRFELHYCSESAEISAK  991

Query  487  EIKEEQLD  464
             I+ E LD
Sbjct  992  GIEVEGLD  999



>ref|XP_006350138.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
            ++++ W+A+ DHFP LE + L SC+ L  IP  FA+I  L  I  R C  SV  SA++I+
Sbjct  819  SHIQYWRASCDHFPCLERLFLDSCRFLDSIPQDFADITTLALIDIRNCPESVGNSAKQIQ  878

Query  478  EEQLDYLNNIVDV  440
            ++  D     ++V
Sbjct  879  QDIQDNYGGSIEV  891



>emb|CDP08032.1| unnamed protein product [Coffea canephora]
Length=419

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IG T LK W+A +  FP+L  + L  CK+L+ IP  F ++++L  I       SV++S
Sbjct  326  LFIGATDLKCWEAQATDFPELRRLILRQCKQLQRIPPDFVDMKKLEDIHLEHTTGSVISS  385

Query  493  AEEIKEEQLDYL  458
            A  I++ Q+D L
Sbjct  386  ARRIRQLQIDML  397



>emb|CDP20547.1| unnamed protein product [Coffea canephora]
Length=673

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+ +  HFP LE + L  CK+L+E+PS   E   L  I+  GCL S      +IKE+Q+D
Sbjct  589  WRGSGHHFPSLEKLVLKRCKELEELPSCLWETLTLQLIEVHGCLRSTGDFVRDIKEQQVD  648

Query  463  YLN  455
            Y N
Sbjct  649  YGN  651



>ref|XP_009796671.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
 ref|XP_009796672.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X5 [Nicotiana sylvestris]
Length=776

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T  + W+A++ HFP+L H+ L  C KL+ +P+ FA+I  L  ++      +V ++
Sbjct  655  LSIDTTDFETWEASTHHFPRLRHLVLIYCDKLEAVPATFADIPSLREMRLENTSKAVRSA  714

Query  493  AE-EIKEEQLDYLNNI  449
             E E K++++ +LNNI
Sbjct  715  KEIERKKQEMQFLNNI  730



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I    LK W+A+S +FP+LE + L  C  L+EIP    EI  L SI+   C  S   S
Sbjct  799  LLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  493  AEEIKEEQLDYLNNIVDVVCG*ATW  419
              EI+EEQ    N+ + V+     W
Sbjct  859  VNEIQEEQESMGNDCLSVITDNCRW  883



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I++
Sbjct  828  YIRYWRASSDHFPYLERLFLRNCYNLDSIPRDFADITTLALIDIDYCQQSVGNSAKQIQQ  887

Query  475  EQLDYLNNIVDV  440
            +  D   + ++V
Sbjct  888  DIQDNYGSSIEV  899



>gb|AEW48187.1| disease resistance protein RGH5 [Solanum albicans]
Length=931

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I++
Sbjct  827  YIRYWRASSDHFPYLERLFLRNCYDLDSIPRDFADITTLALIDISDCQESVGDSAKQIQQ  886

Query  475  EQLDYLNNIVDV  440
            +  D   + ++V
Sbjct  887  DIQDNYGSSIEV  898



>gb|EYU39515.1| hypothetical protein MIMGU_mgv1a023519mg [Erythranthe guttata]
Length=817

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  + LK W   + HFP+L  + L + + L+EIP G  EI  L  I+ + C  ++  S
Sbjct  733  LLICNSNLKYWITETSHFPRLISLVLHNFRYLEEIPDGIGEIPTLELIELKNCRKTLADS  792

Query  493  AEEIKEEQLDYLNN  452
            AE I+EEQ DY N+
Sbjct  793  AERIQEEQQDYGND  806



>ref|XP_011072558.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=742

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L  W+  S HFP L  + L   +KL++IPS FAEI+ L  I+   C  S V SA++I E+
Sbjct  645  LNRWRVDSSHFPCLNILRLVELRKLQKIPSSFAEIQTLELIELYMCRDSAVLSAKDIAEQ  704

Query  472  QLDYLNNIVDVV  437
            Q ++ N+   VV
Sbjct  705  QEEFGNHDFRVV  716



>gb|EYU21173.1| hypothetical protein MIMGU_mgv1a002728mg [Erythranthe guttata]
Length=643

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IGPT L  W+A+  HFPKL  + L++C++L ++P G A+I+ L  ++   C     AS
Sbjct  560  LHIGPTNLVVWRASDRHFPKLRRLELYNCEELVQVPIGLADIQSLQFLEL-NCSNFAAAS  618

Query  493  AEEIKE  476
            A++I+ 
Sbjct  619  AKKIRN  624



>gb|AEW48191.1| disease resistance protein RGH2 [Solanum chacoense]
Length=914

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  826  VYIRYWRASSDHFPYLERLFLRNCYDLDSIPPDFADITTLALIDISSCRRSVGKSAKQIQ  885

Query  478  EEQLDYLNNIVDV  440
            ++  D   + + V
Sbjct  886  QDIQDNYGSSIKV  898



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W   S HFP+LE + L+   KLKEIPS   EI  L SI+   C  S V SA+EI +EQ D
Sbjct  820  WTTDSTHFPRLEQLKLWDLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAKEILDEQED  879

Query  463  YLN  455
              N
Sbjct  880  LGN  882



>ref|XP_006350137.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
            ++++ W+A+ DHFP LE + L SC+ L  IP  FA+I  L  I  R C  SV  SA++I+
Sbjct  819  SHIQYWRASCDHFPCLERLFLDSCRFLDSIPQDFADITTLALIYIRNCPESVGNSAKQIQ  878

Query  478  EEQLDYLNNIVDV  440
            ++  D     ++V
Sbjct  879  QDIQDNYGGSIEV  891



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            +K W A++DHFP LEH+ L SC  L  IP    +I  L  I+      S V SA+EI+EE
Sbjct  841  IKHWSASNDHFPVLEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLSAKEIQEE  900

Query  472  QLDYLNNIVDV  440
            Q    N  ++V
Sbjct  901  QQSMGNETLEV  911



>ref|XP_011072130.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=864

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+A S HFPKLE + L+    L+EIPSG  +I  L SI    C  S + SA++I EEQ  
Sbjct  785  WRAESIHFPKLERLDLYEMHCLEEIPSGIGDIPTLLSIHLWDCSDSSINSAKQILEEQQS  844

Query  463  YLNNIVDV  440
              N I+ +
Sbjct  845  SGNEILQL  852



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L +W     +FP+L+H+ +  C+ L+EIP    +I  L  I+     PSV+ASA EI++ 
Sbjct  776  LVNWVVDDTNFPRLDHLVIRGCRHLEEIPLAIGDIPTLKVIEVDNSSPSVLASAREIQQA  835

Query  472  QLDYLNNI  449
            QLD  N++
Sbjct  836  QLDSGNDL  843



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W+AT+D+FP LE + L+  +KL+EIP    EI  L  IQ   C  + V SA++I++E
Sbjct  765  LERWEATNDNFPMLEQLLLYGFRKLEEIPQSIGEIMILKLIQIERCSAAAVTSAKKIQQE  824

Query  472  QLDYLN  455
            Q  + N
Sbjct  825  QESWGN  830



>emb|CDP20607.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            LE+    +++W A+SD F  LE + +  CKKL+E+P+   E   L  IQ   C  S+  S
Sbjct  534  LELLRLDIRNWTASSDDFCHLEKLVVRHCKKLEEVPACLGECPTLEMIQVENCSESLANS  593

Query  493  AEEIKEEQLDYLNNIVDVV  437
             ++I++EQ+D  N ++ ++
Sbjct  594  IKQIQQEQMDSGNEVLKII  612



>ref|XP_010319247.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=895

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 44/75 (59%), Gaps = 8/75 (11%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            W+ATSD+FPKL+ + L +C  L+ IP+ F EI  L SI+   C  +   SA EI +EQ D
Sbjct  805  WEATSDNFPKLKRLVLKNCGDLQGIPADFGEICSLESIELYDCSTTAENSAREIVQEQED  864

Query  463  --------YLNNIVD  443
                    Y++NI D
Sbjct  865  MGNYFLKIYIHNIRD  879



>ref|XP_009774731.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009774733.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=787

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            ++++WKA+ + FP LE + + +C+ L EIP  FA+I  L  IQ   C+ SV  SA +IK 
Sbjct  712  FMEEWKASEESFPMLEKLVVLNCEDLDEIPPSFADIPTLQLIQVENCMDSVGDSAMDIKR  771

Query  475  E  473
            E
Sbjct  772  E  772



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -3

Query  652   LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
             L  W+    HFP L+ + + SC +L+EIPS   +I  L  I+   C PS V SA++I+EE
Sbjct  1007  LVQWRTNEAHFPCLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTSAKQIQEE  1066

Query  472   Q  470
             Q
Sbjct  1067  Q  1067



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  820  VYIRYWRASSDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISDCKQSVGNSAKQIQ  879

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  880  QDIQDNYGSSIEV  892



>ref|XP_009774730.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009774732.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            ++++WKA+ + FP LE + + +C+ L EIP  FA+I  L  IQ   C+ SV  SA +IK 
Sbjct  712  FMEEWKASEESFPMLEKLVVLNCEDLDEIPPSFADIPTLQLIQVENCMDSVGDSAMDIKR  771

Query  475  E  473
            E
Sbjct  772  E  772



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  820  VYIRYWRASSDHFPYLERLFLKDCYSLDSIPRDFADITTLALIDISDCKQSVGNSAKQIQ  879

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  880  QDIQDNYGSSIEV  892



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -3

Query  673   LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
             L +    +  W  ++D FPKLEH+ L  CK+L+EIPS F +   L SI+   C  SV  S
Sbjct  1596  LNLDNINISQWSLSNDAFPKLEHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNS  1655

Query  493   AEEIKEEQLDYLNN  452
             A EI+  Q + + N
Sbjct  1656  ALEIQTAQHEDMAN  1669



>ref|XP_004241950.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
 ref|XP_010322858.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Solanum lycopersicum]
Length=869

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T LK WKA S +FPKL+ + L  C  L+EIP  F +I  L SI+   C  S   S
Sbjct  786  LLISWTGLKHWKAGSVNFPKLQRLFLKRCMNLEEIPQDFGDICTLESIELHKCSISAATS  845

Query  493  AEEIKEEQ  470
             + I+EEQ
Sbjct  846  GKNIQEEQ  853



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            WKAT D+F  LEH+ +  C+ L+EIP GFA+   L  I+   C   +V  A++I+E+  +
Sbjct  795  WKATDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEKHEE  854

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  855  LGNNMLKV  862



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   Y++ W+A+SDHFP LE + L +C  L  IP  FA+I  L  I    C  SV  S
Sbjct  822  LFLDKVYIRYWRASSDHFPYLERLFLRACYFLDSIPRDFADITTLALIDITRCQQSVGNS  881

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  882  AKQIQQDIQDNYGSSIEV  899



>gb|AEW48215.1| disease resistance protein RGH7 [Solanum leptophyes x Solanum 
sparsipilum]
Length=921

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L +   +++ W+A+SDHFP LE + L  C  L  IP  FA I  L  I   GC  SV  S
Sbjct  826  LFLDQVHIRYWRASSDHFPYLERLFLRYCCHLDSIPRDFANITTLALIDITGCQQSVGNS  885

Query  493  AEEIKEEQLDYLNNIVDV  440
            A++I+++  D   + ++V
Sbjct  886  AKQIQQDIQDNYGSSIEV  903



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  643  WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEEQLD  464
            WKAT D+F  LEH+ +  C+ L+EIP GFA+   L  I+   C   +V  A++I+E+  +
Sbjct  795  WKATDDYFQCLEHVYIRECRYLQEIPEGFADSVTLQLIELHKCCHPLVTFAKQIQEKHEE  854

Query  463  YLNNIVDV  440
              NN++ V
Sbjct  855  LGNNMLKV  862



>ref|XP_009796331.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=571

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 8/81 (10%)
 Frame = -3

Query  655  YLKD-----WKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASA  491
            YL+D     W+A   HFP LE +++  C  L  IP  FA+I  L  I   GC  S   SA
Sbjct  486  YLRDVDFQYWRAGCHHFPFLERLAILYCPYLDSIPQDFADITTLARISLTGCPESFGNSA  545

Query  490  EEIKEEQLDYLNN---IVDVV  437
            ++I+++ LD   N   +V++V
Sbjct  546  KQIQQDMLDNYGNSSLVVNIV  566



>ref|XP_009772243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009772244.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=880

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -3

Query  679  MXLEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVV  500
            + L I  T L  W A++D FP+L+ + L SC +LKEIP G A+I  L +++      +  
Sbjct  790  LVLWIERTNLVSWNASADQFPRLKRLVLISCDRLKEIPIGLADIRSLQAVELYNSTKTAA  849

Query  499  ASAEEIKEEQ  470
             SA E+++++
Sbjct  850  ISARELQDKK  859



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -3

Query  658  TYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
             Y++ W+A+SDHFP LE + L  C  L  IP  FA+I  L  I    C  SV  SA++I+
Sbjct  817  VYIRYWRASSDHFPYLERLFLRHCYYLDSIPRDFADITTLALIDISDCQQSVGNSAKQIQ  876

Query  478  EEQLDYLNNIVDV  440
            ++  D   + ++V
Sbjct  877  QDIQDNYGSSIEV  889



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L  W+ATS  FP L+H+ LF C+ L+E+P  FAEI  L  I   G   + V S
Sbjct  694  LLIDKTDLVHWRATSTQFPSLKHLRLFRCRCLREVPLDFAEIPYLQIIDVYGSYDA-VRS  752

Query  493  AEEIKEEQ  470
              +IK+EQ
Sbjct  753  VMQIKQEQ  760



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T L+ W    + FP LE + L  C KLKE+PS   E+  L  ++   C PS+VAS
Sbjct  817  LLIEDTDLEYWYVDYESFPSLERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVAS  876

Query  493  AEEIKEEQLDYLNNIVDV  440
            A+ I EEQ    N+++ V
Sbjct  877  AKRIAEEQQSAGNDVLQV  894



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L IG T L+ W A+  HFP+L+ + L  C  L EIP G  E+  L +++     P+  AS
Sbjct  801  LHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAAAS  860

Query  493  AEEIKEEQL--DYLNNIVDVV  437
            A  I++E+   D  +N+  +V
Sbjct  861  ARFIQQEKQKGDIKDNVFKLV  881



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L++G + L  W A+S HFP+LE + L  C  L+EIP GF E+  L +++     P+  AS
Sbjct  801  LQLGRSDLVHWHASSHHFPRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAAAS  860

Query  493  AEEIKEEQ  470
            A  I+ ++
Sbjct  861  ARLIQHQK  868



>ref|XP_009608248.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=402

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (61%), Gaps = 1/64 (2%)
 Frame = -3

Query  664  GPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEE  485
             P++  +W A+ D FP LEH+ L  C+ LKEIPS F +   L S++   C   +V SAE 
Sbjct  273  NPSF-SEWNASDDAFPCLEHLVLKKCRYLKEIPSRFGDASSLKSVEIISCNEELVKSAEA  331

Query  484  IKEE  473
            ++EE
Sbjct  332  VREE  335



>gb|EYU31460.1| hypothetical protein MIMGU_mgv1a020657mg [Erythranthe guttata]
Length=720

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  + L+ W   S+HFPKLE + +  C +L+ I +   EI  L  I+ +  L S    
Sbjct  633  LMIKGSKLERWVTESNHFPKLERLLIHQCLELRNISNDIGEISTLELIEVKSGLKSTAEW  692

Query  493  AEEIKEEQLDYLNNIVDVVC  434
            AE I+ EQ DY  ++ +V C
Sbjct  693  AERIQREQRDYRYDVTEVRC  712



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -3

Query  673  LEIGPTYLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVAS  494
            L I  T +K WKA S +FPKL+ + L  C  L+EIP    E+  L SI+   C  S   S
Sbjct  802  LLIDRTNVKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAKS  861

Query  493  AEEIKEEQLDYLNNIVDV  440
             +EI+EEQ    N+ + V
Sbjct  862  VKEIQEEQESMGNDCLSV  879



>ref|XP_011072146.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = -3

Query  655  YLKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKE  476
            +L+ W+A + HFP LE +SL   +KL+EIP+   +I  L SI    C  SV+  A++I E
Sbjct  797  HLERWRAENIHFPNLEILSLDDMQKLEEIPTILGDITTLHSIYLTHCTDSVINLAKQIVE  856

Query  475  EQLDYLNNIVDV  440
            EQ  Y N I+ +
Sbjct  857  EQHSYGNEILQL  868



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -3

Query  652  LKDWKATSDHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIKEE  473
            L+ W A++DHFP LEH+ L  C  L  IP    +I  L  I+      S + SA+EI+EE
Sbjct  846  LEHWSASNDHFPCLEHLVLKGCLHLDSIPHELGDIPTLQIIELENSSQSALLSAKEIQEE  905

Query  472  QLDYLNNIVDV  440
            Q  Y N+ ++V
Sbjct  906  QQSYGNDALEV  916



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -3

Query  652  LKDWKATS--DHFPKLEHISLFSCKKLKEIPSGFAEIERLXSIQXRGCLPSVVASAEEIK  479
            LK W+A    D+FP LE + + +C  LK+IP  FA+   L  I+  GC PS+V  A++I+
Sbjct  798  LKYWRAADIDDNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLVTFAKKIQ  857

Query  478  EEQLDYLNNIVDV  440
            E   D  NN++ V
Sbjct  858  ENHEDLGNNMLKV  870



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060