BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011N18

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB30572.1|  hypothetical protein B456_005G149900                    183   2e-51   Gossypium raimondii
gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  176   2e-51   Citrus sinensis [apfelsine]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    184   7e-51   Gossypium raimondii
ref|XP_007026054.1|  MATE efflux family protein isoform 1               182   2e-50   
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    182   2e-50   
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              181   1e-49   Gossypium arboreum [tree cotton]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               180   2e-49   
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             171   5e-49   
gb|KJB69293.1|  hypothetical protein B456_011G014800                    178   9e-49   Gossypium raimondii
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-48   Solanum lycopersicum
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             177   2e-48   Citrus clementina [clementine]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   2e-48   Solanum lycopersicum
emb|CDM86696.1|  unnamed protein product                                177   3e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   3e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            177   4e-48   Nelumbo nucifera [Indian lotus]
emb|CAN73203.1|  hypothetical protein VITISV_008169                     171   4e-48   Vitis vinifera
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   6e-48   Cicer arietinum [garbanzo]
ref|XP_003596992.1|  Transparent testa 12 protein                       176   7e-48   Medicago truncatula
emb|CDM86687.1|  unnamed protein product                                176   8e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            175   9e-48   Glycine max [soybeans]
emb|CDP11780.1|  unnamed protein product                                175   9e-48   Coffea canephora [robusta coffee]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            173   9e-48   
emb|CBI28938.3|  unnamed protein product                                174   1e-47   Vitis vinifera
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-47   Populus euphratica
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            176   2e-47   
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    174   2e-47   Vitis vinifera
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   2e-47   Solanum tuberosum [potatoes]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            173   3e-47   Triticum urartu
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            174   3e-47   Vitis vinifera
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            174   4e-47   Vitis vinifera
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   4e-47   
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-47   Camelina sativa [gold-of-pleasure]
emb|CBI28937.3|  unnamed protein product                                173   9e-47   Vitis vinifera
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Sesamum indicum [beniseed]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-46   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            172   1e-46   Glycine soja [wild soybean]
emb|CDM86680.1|  unnamed protein product                                170   1e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             172   1e-46   Phaseolus vulgaris [French bean]
ref|XP_007026056.1|  MATE efflux family protein                         172   1e-46   
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   1e-46   Nelumbo nucifera [Indian lotus]
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    163   2e-46   Nicotiana alata [flowering tobacco]
emb|CDM86692.1|  unnamed protein product                                171   2e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-46   Eucalyptus grandis [rose gum]
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            169   3e-46   Triticum urartu
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Oryza brachyantha
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Nicotiana sylvestris
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            171   3e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   3e-46   Brachypodium distachyon [annual false brome]
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            169   3e-46   
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   3e-46   Cucumis melo [Oriental melon]
ref|XP_002883313.1|  mate efflux family protein                         171   4e-46   
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            171   4e-46   Phoenix dactylifera
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             169   4e-46   
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   5e-46   Nicotiana tomentosiformis
emb|CDP11781.1|  unnamed protein product                                169   5e-46   Coffea canephora [robusta coffee]
ref|NP_188806.1|  MATE efflux family protein                            171   5e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CDM86677.1|  unnamed protein product                                170   6e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   6e-46   Cicer arietinum [garbanzo]
gb|AAM20595.1|  integral membrane protein, putative                     171   6e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAR00628.1|  putative MATE family protein                            168   7e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   7e-46   Brachypodium distachyon [annual false brome]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            170   8e-46   Glycine soja [wild soybean]
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   8e-46   Cicer arietinum [garbanzo]
dbj|BAJ34540.1|  unnamed protein product                                170   1e-45   Eutrema halophilum
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                170   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          169   2e-45   
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   2e-45   Populus euphratica
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Solanum lycopersicum
gb|EEC75604.1|  hypothetical protein OsI_12313                          169   2e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   2e-45   Populus euphratica
gb|ACL53378.1|  unknown                                                 168   3e-45   Zea mays [maize]
ref|NP_001050520.1|  Os03g0570800                                       168   3e-45   
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   3e-45   Setaria italica
emb|CDP04390.1|  unnamed protein product                                167   3e-45   Coffea canephora [robusta coffee]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   4e-45   Populus euphratica
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    168   4e-45   
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     166   4e-45   Eucalyptus grandis [rose gum]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   5e-45   
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   5e-45   Camelina sativa [gold-of-pleasure]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    168   6e-45   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                    167   7e-45   Gossypium raimondii
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             167   7e-45   Capsella rubella
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   7e-45   
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   7e-45   Nicotiana sylvestris
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             167   8e-45   Phaseolus vulgaris [French bean]
gb|AHI48506.1|  multidrug and toxic extrusion transporter               168   8e-45   Vaccinium corymbosum [American blueberry]
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   1e-44   
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              167   1e-44   Gossypium arboreum [tree cotton]
emb|CBI23253.3|  unnamed protein product                                160   1e-44   Vitis vinifera
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   1e-44   Populus euphratica
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-44   Elaeis guineensis
ref|XP_002518492.1|  multidrug resistance pump, putative                166   2e-44   Ricinus communis
dbj|BAH20308.1|  AT1G61890                                              162   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-44   Cucumis melo [Oriental melon]
ref|XP_006389638.1|  MATE efflux family protein                         166   2e-44   
gb|KEH36840.1|  MATE efflux family protein                              166   2e-44   Medicago truncatula
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            166   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   3e-44   Cucumis melo [Oriental melon]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           166   3e-44   Nicotiana tabacum [American tobacco]
emb|CBI23254.3|  unnamed protein product                                164   3e-44   Vitis vinifera
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-44   Elaeis guineensis
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            165   6e-44   
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   6e-44   Populus euphratica
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   6e-44   
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          165   6e-44   Sorghum bicolor [broomcorn]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             165   7e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   7e-44   Solanum tuberosum [potatoes]
emb|CAN82750.1|  hypothetical protein VITISV_014577                     163   7e-44   Vitis vinifera
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             165   8e-44   
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   8e-44   
emb|CDP17486.1|  unnamed protein product                                165   8e-44   Coffea canephora [robusta coffee]
ref|XP_003605914.1|  Transparent testa 12 protein                       165   9e-44   Medicago truncatula
gb|EEC75610.1|  hypothetical protein OsI_12322                          164   9e-44   Oryza sativa Indica Group [Indian rice]
ref|NP_001050524.1|  Os03g0572900                                       164   9e-44   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             164   9e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    164   9e-44   Nicotiana sylvestris
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            164   1e-43   Vitis vinifera
ref|NP_001142368.1|  uncharacterized protein LOC100274540               163   1e-43   Zea mays [maize]
ref|NP_564787.1|  MATE efflux family protein                            164   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   1e-43   Solanum lycopersicum
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             164   2e-43   
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Prunus mume [ume]
emb|CDY47166.1|  BnaA01g22920D                                          164   2e-43   Brassica napus [oilseed rape]
gb|AAK82541.1|  At1g61890/F8K4_9                                        164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Brassica rapa
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   2e-43   Zea mays [maize]
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-43   Cucumis sativus [cucumbers]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-43   Prunus mume [ume]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            163   3e-43   Triticum urartu
emb|CDY25329.1|  BnaC01g29980D                                          163   3e-43   Brassica napus [oilseed rape]
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   3e-43   Cicer arietinum [garbanzo]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    163   3e-43   Populus euphratica
emb|CBI23251.3|  unnamed protein product                                162   4e-43   Vitis vinifera
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   4e-43   Elaeis guineensis
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             162   4e-43   Eutrema salsugineum [saltwater cress]
gb|ACZ55931.1|  MATE transporter 2                                      162   5e-43   Zea mays [maize]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   5e-43   Nicotiana tomentosiformis
gb|ACZ55932.1|  MATE transporter 2                                      162   5e-43   Zea mays [maize]
ref|XP_002886501.1|  mate efflux family protein                         162   5e-43   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         162   5e-43   Jatropha curcas
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   6e-43   Zea mays [maize]
ref|NP_001147791.1|  transparent testa 12 protein                       162   6e-43   Zea mays [maize]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   6e-43   Solanum tuberosum [potatoes]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   7e-43   Elaeis guineensis
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    162   8e-43   Solanum tuberosum [potatoes]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    162   8e-43   Arabis alpina [alpine rockcress]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            162   8e-43   Vitis vinifera
emb|CDY07257.1|  BnaC04g19140D                                          158   9e-43   
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            162   1e-42   
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       161   1e-42   Cucumis sativus [cucumbers]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             161   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   1e-42   Setaria italica
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   Pyrus x bretschneideri [bai li]
dbj|BAD95082.1|  hypothetical protein                                   155   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   Vitis vinifera
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             161   2e-42   Capsella rubella
emb|CDY34833.1|  BnaA09g47590D                                          160   2e-42   Brassica napus [oilseed rape]
ref|NP_001148084.1|  transparent testa 12 protein                       160   2e-42   Zea mays [maize]
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   3e-42   Nicotiana sylvestris
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    160   3e-42   Arabis alpina [alpine rockcress]
gb|ABF97209.1|  MATE efflux family protein, expressed                   160   3e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CDY19507.1|  BnaC09g13960D                                          160   4e-42   Brassica napus [oilseed rape]
emb|CDY12916.1|  BnaA09g13580D                                          160   4e-42   Brassica napus [oilseed rape]
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Brassica rapa
gb|EEC75606.1|  hypothetical protein OsI_12318                          160   4e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Sesamum indicum [beniseed]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Brassica rapa
ref|XP_002518495.1|  multidrug resistance pump, putative                160   5e-42   Ricinus communis
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   5e-42   Glycine max [soybeans]
emb|CDX76391.1|  BnaA08g10090D                                          159   6e-42   
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            159   6e-42   Glycine soja [wild soybean]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   6e-42   Malus domestica [apple tree]
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   6e-42   Brassica rapa
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             159   8e-42   Eutrema salsugineum [saltwater cress]
emb|CDY71092.1|  BnaAnng36070D                                          150   8e-42   Brassica napus [oilseed rape]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   8e-42   Prunus mume [ume]
gb|ACF85024.1|  unknown                                                 152   9e-42   Zea mays [maize]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   9e-42   Brassica rapa
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Fragaria vesca subsp. vesca
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Prunus mume [ume]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   1e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW68307.1|  putative MATE efflux family protein                     157   1e-41   
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    159   1e-41   Nicotiana tomentosiformis
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    159   1e-41   Arabis alpina [alpine rockcress]
emb|CDY34637.1|  BnaC08g41960D                                          157   2e-41   Brassica napus [oilseed rape]
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   Elaeis guineensis
emb|CDX98711.1|  BnaA03g44960D                                          158   2e-41   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002867813.1|  mate efflux family protein                         158   2e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   Citrus sinensis [apfelsine]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   2e-41   Brassica rapa
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   158   2e-41   Citrus sinensis [apfelsine]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             158   3e-41   Citrus clementina [clementine]
gb|ACF85423.1|  unknown                                                 158   3e-41   Zea mays [maize]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             158   3e-41   Prunus persica
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   3e-41   
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             157   3e-41   
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   3e-41   Fragaria vesca subsp. vesca
emb|CDX94061.1|  BnaC07g36950D                                          157   4e-41   
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   5e-41   Prunus mume [ume]
gb|AAM62936.1|  unknown                                                 157   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   5e-41   Brassica rapa
ref|NP_567640.1|  MATE efflux family protein                            157   5e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19969.1|  AT4G21910                                              157   6e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            157   6e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94063.1|  BnaC07g36970D                                          156   8e-41   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   9e-41   Camelina sativa [gold-of-pleasure]
emb|CDY27431.1|  BnaC03g64710D                                          156   1e-40   Brassica napus [oilseed rape]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Populus euphratica
gb|KGN43522.1|  Mate efflux family protein                              156   1e-40   Cucumis sativus [cucumbers]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   1e-40   Brassica rapa
emb|CDY27434.1|  BnaC03g64740D                                          156   1e-40   Brassica napus [oilseed rape]
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   1e-40   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    156   1e-40   Arabis alpina [alpine rockcress]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             155   1e-40   Capsella rubella
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   1e-40   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   2e-40   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   2e-40   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             155   2e-40   
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          155   2e-40   Sorghum bicolor [broomcorn]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Populus euphratica
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Brassica rapa
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Fragaria vesca subsp. vesca
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Brassica rapa
emb|CDX98713.1|  BnaA03g44980D                                          154   4e-40   
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   4e-40   
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   4e-40   Pyrus x bretschneideri [bai li]
emb|CDX98712.1|  BnaA03g44970D                                          154   4e-40   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   4e-40   Sesamum indicum [beniseed]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          154   4e-40   Sorghum bicolor [broomcorn]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             154   4e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       154   5e-40   
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   6e-40   Brassica rapa
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             152   7e-40   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   7e-40   Brassica rapa
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   7e-40   Camelina sativa [gold-of-pleasure]
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            152   7e-40   
emb|CDX79109.1|  BnaA01g11760D                                          154   7e-40   
emb|CDY64933.1|  BnaCnng45550D                                          154   8e-40   Brassica napus [oilseed rape]
gb|AGT17221.1|  transparent testa 12 protein                            154   8e-40   Saccharum hybrid cultivar R570
ref|NP_001149176.1|  transparent testa 12 protein                       154   8e-40   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               154   9e-40   
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   1e-39   Nicotiana tomentosiformis
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   1e-39   Populus euphratica
ref|XP_007026057.1|  MATE efflux family protein                         153   1e-39   
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   1e-39   Brachypodium distachyon [annual false brome]
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            152   1e-39   
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   1e-39   Nicotiana tomentosiformis
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             153   1e-39   Capsella rubella
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             153   1e-39   Capsella rubella
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             153   2e-39   Citrus clementina [clementine]
emb|CAN69304.1|  hypothetical protein VITISV_021604                     156   2e-39   Vitis vinifera
ref|NP_172632.1|  MATE efflux family protein                            152   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   2e-39   Pyrus x bretschneideri [bai li]
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-39   Brassica rapa
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   2e-39   Citrus sinensis [apfelsine]
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   2e-39   Populus euphratica
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-39   Eucalyptus grandis [rose gum]
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                152   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   2e-39   Brassica rapa
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   150   3e-39   Citrus sinensis [apfelsine]
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             152   4e-39   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   4e-39   Tarenaya hassleriana [spider flower]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             152   4e-39   Eutrema salsugineum [saltwater cress]
ref|XP_002892653.1|  mate efflux family protein                         151   6e-39   
emb|CDY33129.1|  BnaCnng07000D                                          151   6e-39   
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   6e-39   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             151   7e-39   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   151   8e-39   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             150   1e-38   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   1e-38   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   1e-38   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   1e-38   
dbj|BAJ90668.1|  predicted protein                                      150   2e-38   
gb|AAM98160.1|  unknown protein                                         150   2e-38   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-38   
emb|CDY39494.1|  BnaA01g24940D                                          150   2e-38   
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-38   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   4e-38   
emb|CDY19294.1|  BnaC01g31860D                                          149   4e-38   
ref|NP_001119025.1|  mate efflux domain-containing protein              149   4e-38   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   6e-38   
gb|EEE67272.1|  hypothetical protein OsJ_24453                          147   7e-38   
emb|CDY24252.1|  BnaC03g42250D                                          142   9e-38   
gb|EEC82143.1|  hypothetical protein OsI_26198                          147   1e-37   
ref|NP_001059785.1|  Os07g0516600                                       147   1e-37   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     147   1e-37   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-37   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   1e-37   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-37   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-37   
ref|XP_002867814.1|  mate efflux family protein                         147   2e-37   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    147   2e-37   
ref|XP_002518493.1|  multidrug resistance pump, putative                147   3e-37   
gb|AGT17223.1|  MATE efflux family protein                              147   3e-37   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   4e-37   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   4e-37   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    150   4e-37   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      145   6e-37   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            145   6e-37   
emb|CDY33131.1|  BnaCnng07020D                                          138   1e-36   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   1e-36   
emb|CDY38631.1|  BnaA05g19560D                                          144   2e-36   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    144   2e-36   
emb|CDY39493.1|  BnaA01g24950D                                          144   2e-36   
emb|CDM85992.1|  unnamed protein product                                144   2e-36   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       143   5e-36   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                143   5e-36   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   7e-36   
emb|CDX92916.1|  BnaA03g36380D                                          142   9e-36   
emb|CDY65669.1|  BnaCnng48120D                                          142   1e-35   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   2e-35   
gb|ABF97208.1|  MATE efflux family protein, expressed                   139   2e-35   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       141   2e-35   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             141   3e-35   
gb|AAS01962.1|  putative MATE efflux family protein                     141   3e-35   
gb|ADE77677.1|  unknown                                                 141   3e-35   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   3e-35   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          139   4e-35   
ref|NP_001050521.1|  Os03g0571700                                       139   4e-35   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    140   4e-35   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   4e-35   
emb|CDP20703.1|  unnamed protein product                                139   5e-35   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             140   5e-35   
gb|ABF97220.1|  MATE efflux family protein, expressed                   140   6e-35   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         143   6e-35   
emb|CDX94064.1|  BnaC07g36980D                                          139   9e-35   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   9e-35   
emb|CDP04391.1|  unnamed protein product                                139   2e-34   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   2e-34   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                138   3e-34   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   4e-34   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   5e-34   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                137   5e-34   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       133   6e-34   
ref|NP_001190793.1|  MATE efflux family protein                         137   1e-33   
gb|EPS59093.1|  hypothetical protein M569_15717                         130   1e-33   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       136   1e-33   
gb|ABK24492.1|  unknown                                                 135   2e-33   
gb|EPS67796.1|  hypothetical protein M569_06975                         135   3e-33   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          135   3e-33   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            135   1e-32   
gb|AGT17222.1|  MATE efflux family protein                              132   3e-32   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            134   3e-32   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    126   3e-32   
emb|CBI28940.3|  unnamed protein product                                123   8e-32   
ref|NP_001190792.1|  mate efflux domain-containing protein              131   8e-32   
ref|NP_001065641.2|  Os11g0129000                                       124   4e-31   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    128   5e-31   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    128   5e-31   
gb|EEC68782.1|  hypothetical protein OsI_37323                          123   6e-31   
emb|CAA17157.1|  putative protein                                       129   3e-30   
emb|CDY19296.1|  BnaC01g31840D                                          121   3e-30   
gb|EEC68785.1|  hypothetical protein OsI_37326                          125   2e-29   
ref|NP_001066047.1|  Os12g0126000                                       125   2e-29   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            124   3e-29   
ref|NP_001176768.1|  Os12g0125800                                       121   3e-29   
gb|EEC68781.1|  hypothetical protein OsI_37322                          123   5e-29   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          122   7e-29   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   8e-29   
ref|NP_001176328.1|  Os11g0128900                                       121   1e-28   
ref|NP_001065623.1|  Os11g0126100                                       121   3e-28   
gb|ABA91295.1|  MATE efflux family protein, expressed                   121   3e-28   
ref|NP_001141051.1|  putative MATE efflux family protein                121   3e-28   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   3e-28   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               120   3e-28   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   5e-28   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   1e-27   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          118   2e-27   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-27   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     114   3e-27   
gb|EEC73528.1|  hypothetical protein OsI_07920                          118   3e-27   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          118   4e-27   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   5e-27   
emb|CBI31189.3|  unnamed protein product                                117   5e-27   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    117   5e-27   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            117   6e-27   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          117   7e-27   
emb|CAN63841.1|  hypothetical protein VITISV_021179                     116   1e-26   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            116   1e-26   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   2e-26   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg             112   2e-26   
dbj|BAJ90744.1|  predicted protein                                      116   2e-26   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            117   2e-26   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   3e-26   
gb|ACG27773.1|  transparent testa 12 protein                            115   3e-26   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     115   3e-26   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg             112   3e-26   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   4e-26   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   4e-26   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   4e-26   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   4e-26   
gb|AFW55870.1|  putative MATE efflux family protein                     114   5e-26   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            115   6e-26   
gb|ACF87410.1|  unknown                                                 114   6e-26   
gb|KCW66477.1|  hypothetical protein EUGRSUZ_F00278                     114   6e-26   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   6e-26   
gb|ABR16195.1|  unknown                                                 114   6e-26   
emb|CDY01227.1|  BnaC05g25050D                                          109   8e-26   
ref|XP_002530955.1|  multidrug resistance pump, putative                114   9e-26   
emb|CBI31190.3|  unnamed protein product                                113   1e-25   
ref|NP_001130797.1|  putative MATE efflux family protein                114   1e-25   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   2e-25   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          112   2e-25   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   3e-25   
emb|CAN73356.1|  hypothetical protein VITISV_040100                     111   4e-25   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   5e-25   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    111   5e-25   
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    111   6e-25   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    111   6e-25   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                          111   8e-25   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     110   9e-25   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    111   9e-25   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340          111   9e-25   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   1e-24   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     111   1e-24   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              111   1e-24   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_006349556.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
dbj|BAJ95959.1|  predicted protein                                      110   2e-24   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   2e-24   
ref|NP_174584.2|  MATE efflux family protein                            110   2e-24   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   2e-24   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             110   2e-24   
ref|XP_007161849.1|  hypothetical protein PHAVU_001G103200g             110   2e-24   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             110   3e-24   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            109   3e-24   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            109   3e-24   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    109   4e-24   
ref|XP_006375947.1|  hypothetical protein POPTR_0013s06650g             108   4e-24   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
ref|XP_003520899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   4e-24   
gb|AAN64140.1|  Putative ripening regulated protein                     108   5e-24   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                            110   5e-24   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_009353041.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    109   5e-24   
ref|XP_009123743.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   5e-24   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          109   6e-24   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   6e-24   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                            108   6e-24   
ref|XP_002319744.1|  MATE efflux family protein                         108   6e-24   
ref|XP_010542192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   6e-24   
ref|XP_007029906.1|  MATE efflux family protein                         108   7e-24   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   7e-24   
ref|XP_008391733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   7e-24   
ref|XP_010317921.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    108   8e-24   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-24   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   8e-24   
ref|XP_006604281.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   8e-24   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   9e-24   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130          108   1e-23   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
gb|EEC74654.1|  hypothetical protein OsI_10313                          108   1e-23   
gb|KDP39623.1|  hypothetical protein JCGZ_02643                         108   1e-23   
ref|XP_006827534.1|  hypothetical protein AMTR_s00009p00209720          104   1e-23   
emb|CDY68535.1|  BnaCnng59430D                                          104   1e-23   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          108   1e-23   
ref|XP_003624779.1|  Transparent testa 12 protein                       108   1e-23   
ref|XP_009594771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_007161850.1|  hypothetical protein PHAVU_001G103300g             108   1e-23   
gb|AFK47801.1|  unknown                                                 103   1e-23   
ref|XP_002891027.1|  mate efflux family protein                         108   1e-23   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
gb|KHN42169.1|  Protein TRANSPARENT TESTA 12                            107   1e-23   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   107   2e-23   
ref|XP_009123739.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   2e-23   
ref|XP_006307307.1|  hypothetical protein CARUB_v10008925mg             107   2e-23   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               108   2e-23   
ref|XP_009123740.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   2e-23   
gb|KHN34612.1|  Protein TRANSPARENT TESTA 12                            107   2e-23   
emb|CDY01224.1|  BnaC05g25080D                                          106   2e-23   
gb|KHN42163.1|  Protein TRANSPARENT TESTA 12                            107   2e-23   
ref|XP_010528775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   2e-23   
ref|XP_007051759.1|  MATE efflux family protein                         107   2e-23   
ref|XP_003520904.1|  PREDICTED: protein TRANSPARENT TESTA 12            107   2e-23   
ref|XP_006604282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   2e-23   
gb|EYU20852.1|  hypothetical protein MIMGU_mgv1a005530mg                107   2e-23   
ref|XP_006576297.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    107   2e-23   
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g             107   2e-23   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   2e-23   
ref|XP_006484862.1|  PREDICTED: uncharacterized protein LOC102631182    106   3e-23   



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  269  RDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+
Sbjct  329  FVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWE  388

Query  305  AKREPLL  285
             K EPLL
Sbjct  389  VKEEPLL  395



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  41   RDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  100

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+
Sbjct  101  VVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWE  160

Query  305  AKREPLL  285
             K++PLL
Sbjct  161  DKKKPLL  167



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  378  RDVISYAFTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+
Sbjct  438  FVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWE  497

Query  305  AKREPLL  285
             K EPLL
Sbjct  498  VKEEPLL  504



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  387  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  447  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  506

Query  305  AKREPLL  285
             K+EPLL
Sbjct  507  DKKEPLL  513



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  388  RHVISYAFTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  447

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+
Sbjct  448  VVGIPLGCLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWE  507

Query  305  AKREPLL  285
             K+EPLL
Sbjct  508  DKKEPLL  514



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA+AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  378  RDVISYAFTEGEVVAEAVSDLCPLLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP+G++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W 
Sbjct  438  FVGVPLGSLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWQ  497

Query  305  AKR-EPLL  285
             K+ EPLL
Sbjct  498  VKKEEPLL  505



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SY FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  377  RHVLSYAFTGGEVVAEAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G++LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE A+KRL  W+
Sbjct  437  VVGIPLGSLLGFYFKLGAKGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLVTWE  496

Query  305  AKREPLL  285
             K+EPLL
Sbjct  497  DKKEPLL  503



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   171 bits (432),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  67   RDVISYAFTGGETVAKAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  126

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G++ GFYFNLGAKGIW GMI G V+QT+ILLWVTIRTDW KEV+ A KRL  W+
Sbjct  127  VVGIPLGSLFGFYFNLGAKGIWSGMIAGIVLQTVILLWVTIRTDWNKEVQEALKRLETWE  186

Query  305  AKREPLL  285
             K EPL+
Sbjct  187  GKEEPLV  193



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  394  RHVISYVFTEGETVAEAVSELCPFLAVTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  453

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+
Sbjct  454  VVGIPLGCLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWE  513

Query  305  AKREPLL  285
             KRE LL
Sbjct  514  DKRETLL  520



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQTFVAYVN+GCYY
Sbjct  384  RNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQTFVAYVNIGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD
Sbjct  444  IVGVPLGALLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVEAAQSRLKKWD  503

Query  305  AKREPLLPK  279
             K+E +L +
Sbjct  504  DKKESILEE  512



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  393  RDVISYAFTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVPVG++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+
Sbjct  453  VVGVPVGSLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWE  512

Query  305  AKREPLL  285
             K++PLL
Sbjct  513  DKKKPLL  519



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT GEVVA+AVSDLCPLLALTL LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  375  RDVLSYAFTGGEVVAEAVSDLCPLLALTLALNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGFYF LGAKGIW GM+GGTVMQT+IL+W+TIRTDW KEVE A+ RLN+W 
Sbjct  435  IVGVPLGALLGFYFKLGAKGIWLGMMGGTVMQTVILIWITIRTDWNKEVEAAQGRLNKWG  494

Query  305  AKREPLLPK  279
             K+EP L +
Sbjct  495  DKKEPELKE  503



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   177 bits (448),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  365  RNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYY  424

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVT+RTDW KEVE A+KRLN+WD
Sbjct  425  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTMRTDWTKEVEEAQKRLNKWD  484

Query  305  AKREPLL  285
             K+EPLL
Sbjct  485  EKKEPLL  491



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY FTDGEVVA AVSDLCPLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  359  RDYISYAFTDGEVVARAVSDLCPLLATTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  418

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP G++LGF F LGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE AKKRLN+W+
Sbjct  419  IIGVPFGSLLGFKFGLGAKGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLNKWE  478

Query  305  AKREPLL  285
             K+EPLL
Sbjct  479  DKKEPLL  485



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA+AVSDLCPLL++TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  384  RHVISYAFTSGEAVANAVSDLCPLLSITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+LGF F+LGAKGIW GMIGGT+MQT+ILLWVT RT+W KEVE A KRLN+W+
Sbjct  444  ILGIPLGALLGFKFDLGAKGIWSGMIGGTMMQTLILLWVTYRTNWNKEVEEATKRLNKWE  503

Query  305  AKREPLL  285
             K EPLL
Sbjct  504  DKPEPLL  510



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   171 bits (432),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  137  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  196

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R  +WD
Sbjct  197  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERXEKWD  256

Query  305  AKREPLL  285
             K++PLL
Sbjct  257  DKKQPLL  263



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GE VA AVSDLCPLL+L+++LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  379  RDVISYVFTEGETVAAAVSDLCPLLSLSILLNGIQPVLSGVAVGCGWQAFVAYVNVACYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+GAVLGFYF  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD
Sbjct  439  GVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTIILIWVTFRTDWNKEVEESAKRLNKWD  498

Query  305  AKREPLL  285
             K+EPLL
Sbjct  499  DKKEPLL  505



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   176 bits (445),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GEVVA AVSDLCPLL+L+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RDVISYVFTEGEVVAAAVSDLCPLLSLSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VG+P+GAVLGFYFN GAKGIW GM+GGT MQTIIL+WVT RTDW KEV+ A KRLN+W 
Sbjct  439  IVGIPLGAVLGFYFNFGAKGIWLGMLGGTTMQTIILMWVTFRTDWNKEVKEAAKRLNKWE  498

Query  308  DAKREPLL  285
            + K+EPLL
Sbjct  499  EKKKEPLL  506



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  367  RNHISYLFTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYY  426

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD
Sbjct  427  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWSKEVEEAQKRLNKWD  486

Query  305  AKREPLL  285
             K++PLL
Sbjct  487  EKKQPLL  493



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVSDLCPLLAL+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  377  RDVISYAFTGGEEVAAAVSDLCPLLALSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+GAVLGFYF  GAKGIW GM+GGTVMQTIILLWVT RTDW KEVE A KRL +W+
Sbjct  437  GVGIPLGAVLGFYFQFGAKGIWLGMLGGTVMQTIILLWVTFRTDWTKEVEEAAKRLTKWE  496

Query  305  AKREPLL  285
             K+EPLL
Sbjct  497  DKKEPLL  503



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GEVVADAVSDL PLLALTLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  372  RRVMSYAFTEGEVVADAVSDLAPLLALTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  431

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VG+P+G++LGFYF LGAKG+W GM+GGT MQTIILLWVTIRTDW KEVEVA KRL++W 
Sbjct  432  LVGIPLGSLLGFYFQLGAKGLWSGMLGGTTMQTIILLWVTIRTDWNKEVEVALKRLDKWE  491

Query  308  DAKREPLL  285
            D K+E LL
Sbjct  492  DQKKEALL  499



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  269  RNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W 
Sbjct  329  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWS  388

Query  305  AKREPLL  285
             K+EPLL
Sbjct  389  EKKEPLL  395



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  306  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  365

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  366  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  425

Query  305  AKREPLL  285
             K++PLL
Sbjct  426  DKKQPLL  432



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FTDGE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  274  RDVISYAFTDGETVAQAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQGFVAYVNVGCYY  333

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G++ GFYFNLGAKGIW GMIGG V++T+ILLWVT RTDW KEV+ A KRL  W+
Sbjct  334  VVGIPLGSLFGFYFNLGAKGIWSGMIGGVVLRTVILLWVTCRTDWNKEVQEALKRLETWE  393

Query  305  AKREPLL  285
             K+EPL+
Sbjct  394  GKKEPLV  400



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FTDG+ V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  436  RNHISYLFTDGKAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYY  495

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD
Sbjct  496  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWD  555

Query  305  AKREPLL  285
             K+EPLL
Sbjct  556  EKKEPLL  562



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+RL +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWD  498

Query  305  AKREPLL  285
             K++PLL
Sbjct  499  DKKQPLL  505



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R++ISY FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  384  RNLISYAFTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G +LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL  WD
Sbjct  444  IVGVPLGVLLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQSRLKMWD  503

Query  305  AKREPLLPK  279
             K+E +L +
Sbjct  504  DKKESILEE  512



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  304  RNHISYLFTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQKFVAYVNVGSYY  363

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT+W +EVE A+KRLN+WD
Sbjct  364  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTNWTEEVEEAQKRLNKWD  423

Query  305  AKREPLL  285
             K+EPLL
Sbjct  424  EKKEPLL  430



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWD  498

Query  305  AKREPLL  285
             K++PLL
Sbjct  499  DKKQPLL  505



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  379  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD
Sbjct  439  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWD  498

Query  305  AKREPLL  285
             K++PLL
Sbjct  499  DKKQPLL  505



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  366  RNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  425

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP+G +LGF FNLG KGIW GM+GGT MQT IL+WVT+RTDW KEVE A+KRLN+WD
Sbjct  426  IIGVPLGVLLGFVFNLGVKGIWGGMLGGTCMQTAILVWVTLRTDWKKEVEEAQKRLNKWD  485

Query  305  AKREPLL  285
             K+EPLL
Sbjct  486  DKKEPLL  492



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   165 bits (418),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  60   RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  119

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W 
Sbjct  120  VIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWS  179

Query  305  AKREPLLPK  279
             K++ L+ +
Sbjct  180  DKKQELVRE  188



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  415  RHVISYAFTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  474

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD
Sbjct  475  IVGVPLGSLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWD  534

Query  305  AKREPLL  285
             K++PLL
Sbjct  535  DKKQPLL  541



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH+ISY+FT GE VA AV+DLCPLLA+TL+LNGVQPVLSGVAVGCGWQ+FVA +NVGCYY
Sbjct  381  RHIISYIFTGGETVAKAVADLCPLLAVTLLLNGVQPVLSGVAVGCGWQSFVACINVGCYY  440

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FNLG KGIW GMIGGT+MQT+ILLWVT RTDW KEVE A+KRL++W+
Sbjct  441  MVGIPIGCLLGFKFNLGVKGIWSGMIGGTMMQTLILLWVTFRTDWNKEVEKARKRLDKWE  500

Query  305  AKREPLLPK  279
               EPLL +
Sbjct  501  EITEPLLKE  509



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY FT+GE VA AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYISYAFTEGETVARAVSDLCPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP G++LGF F LGAKGIW GMIGGT+MQT+IL+WVT RTDW KEVE AKKRLN+WD
Sbjct  453  IVGVPFGSLLGFKFGLGAKGIWGGMIGGTIMQTLILMWVTFRTDWNKEVEEAKKRLNKWD  512

Query  305  AKR-EPLL  285
             K+ EPLL
Sbjct  513  GKKEEPLL  520



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  390  RDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  449

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+
Sbjct  450  GIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWE  509

Query  305  AKREPLL  285
             K EPL+
Sbjct  510  NKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R +ISY FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  390  RDIISYAFTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  449

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+
Sbjct  450  GIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWE  509

Query  305  AKREPLL  285
             K EPL+
Sbjct  510  NKTEPLV  516



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  269  RNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W 
Sbjct  329  IVGVPLGIVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWD  388

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  389  DTKKQPLL  396



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RDVISYAFTEGEVVATAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G++LGFYF+ GAKGIW GM+GGT MQT+IL+WVT RTDW KEVE A KRL+ W+
Sbjct  440  GVGLPLGSLLGFYFDFGAKGIWLGMLGGTAMQTVILIWVTFRTDWNKEVEEAAKRLSIWE  499

Query  305  AKREPLL  285
             K+EP+L
Sbjct  500  DKKEPVL  506



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GE VA AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+
Sbjct  451  VVGIPLGCVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWE  510

Query  305  AKREPLL  285
             K+EPLL
Sbjct  511  DKKEPLL  517



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTDGE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  385  RHVISYAFTDGERVANAVSDLCPLLAITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVPVG +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT+W KEVE A KRL  WD
Sbjct  445  VVGVPVGVLLGFKFDLGAKGIWSGMIGGTTVQTLILIWVTYRTNWNKEVEEAMKRLETWD  504

Query  305  AKREPLL  285
             K+EPLL
Sbjct  505  EKKEPLL  511



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GEVVA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  43   RNVISYAFTEGEVVAKEVSELCPYLAVTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  102

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+PVG +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEVE AKKRL++W+
Sbjct  103  GVGIPVGCLLGFKFDLGAKGIWTGMIGGTMMQTIILLWVTFRTDWNKEVESAKKRLDKWE  162



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GE V+DAV+DL PLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY
Sbjct  365  RNHISYLFTNGEAVSDAVADLSPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYY  424

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD
Sbjct  425  IVGVPLGVVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTDWTKEVEEAQKRLNKWD  484

Query  305  AKREPLL  285
             K++PLL
Sbjct  485  EKKQPLL  491



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  384  RHVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL+WVT RTDW KEVE AK RL++W+
Sbjct  444  VVGIPIGCILGFKFDLGAKGIWSGMLGGTTMQTLILIWVTYRTDWNKEVEKAKGRLDKWE  503

Query  305  AKREPLL  285
             K++PLL
Sbjct  504  DKKKPLL  510



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  269  RNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W 
Sbjct  329  IVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWD  388

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  389  DTKKQPLL  396



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE V+ AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  366  RDYISYIFTDGETVSRAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKTVAYINVGCYY  425

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQWD
Sbjct  426  FVGVPLGFLLGFKFHLGAKGIWSGMLGGTCMQTLILFWITFRTDWNKEVEQAKKRLNQWD  485

Query  305  AKREPLLPKT  276
             K++PLL  T
Sbjct  486  DKKQPLLAST  495



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  385  RNLISYAFTGGEVVAQAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD
Sbjct  445  IVGVPLGALLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWD  504

Query  305  AKREPLLPK  279
             K+E +L +
Sbjct  505  DKKESILEE  513



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT+GE VADAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  376  RHVISYAFTEGEYVADAVSDLCPLLAITVVLNGIQPVLSGVAVGCGWQVFVAYVNVGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+GA+LGF F+LGAKGIW GMIGGT+MQTIILLWV  RTDW +EVE A KRLN+W+
Sbjct  436  FVGIPLGALLGFKFDLGAKGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRLNKWE  495

Query  305  AKRE  294
             K +
Sbjct  496  DKHK  499



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  269  RNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+
Sbjct  329  VVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWE  388

Query  305  AKREPLL  285
              +EPLL
Sbjct  389  GSKEPLL  395



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  269  RNHISYLFTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W 
Sbjct  329  IVGVPLGIVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWD  388

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  389  DTKKQPLL  396



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/124 (81%), Positives = 111/124 (90%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  382  RSVISYTFTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  441

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+GA+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+WD
Sbjct  442  VVGIPLGALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWD  501

Query  305  AKRE  294
             K+E
Sbjct  502  DKQE  505



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W 
Sbjct  438  IIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWS  497

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  498  NKKQEVVPE  506



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  392  RDYLSYIFTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  451

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W+
Sbjct  452  IVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWE  511

Query  305  AKREPLL  285
             K++PLL
Sbjct  512  GKKQPLL  518



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   169 bits (427),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  269  RNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W 
Sbjct  329  FIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWS  388

Query  305  AKR  297
             K+
Sbjct  389  NKK  391



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R++ISY FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  385  RNLISYAFTGGEVVAAAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVPVG +LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD
Sbjct  445  IVGVPVGVLLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWD  504

Query  305  AKREPLLPK  279
             K+E +L +
Sbjct  505  DKKEAILEE  513



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 114/124 (92%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GEVVADAVSDL PLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  304  RRVMSYAFTEGEVVADAVSDLSPLLAVTVVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  363

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G+VLGFYF LGAKG+W GM+GGT+MQTIILLWVTIRTDW+KEVE A +RL++W+
Sbjct  364  LVGIPLGSVLGFYFQLGAKGLWSGMLGGTIMQTIILLWVTIRTDWIKEVEAALRRLDKWE  423

Query  305  AKRE  294
              ++
Sbjct  424  VLKD  427



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W 
Sbjct  438  IIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWS  497

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  498  NKKQEVVPE  506



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  361  RNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNVGCYY  420

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W 
Sbjct  421  IVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWD  480

Query  308  DAKREPLL  285
            D K+EPLL
Sbjct  481  DTKKEPLL  488



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  384  RDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+
Sbjct  444  GIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWE  503

Query  305  AKREPLLPK  279
             + E L+ +
Sbjct  504  DRTETLIKE  512



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W 
Sbjct  438  IIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWS  497

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  498  NKKQEVVPE  506



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  269  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  329  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  388

Query  305  AKREPLLPKT  276
             K++PLL  T
Sbjct  389  DKKQPLLAGT  398



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  361  RNYISYLFTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCYY  420

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVP+G VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+
Sbjct  421  VVGVPLGLVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWE  480

Query  305  AKREPLL  285
              +EPLL
Sbjct  481  GSKEPLL  487



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FTDGE VA AVSDLCPLLAL+++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  389  RDVISYAFTDGEEVAAAVSDLCPLLALSIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  448

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+G+VLGFYF L AKGIW GM+GGTV+QTIIL+WVT  TDW KEVE A KRLN+W+
Sbjct  449  GIGIPLGSVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFGTDWNKEVEEAAKRLNKWE  508

Query  305  AKREPLL  285
             K EPL+
Sbjct  509  DKTEPLV  515



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  382  RDVISYVFTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  441

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GAVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+
Sbjct  442  GIGIPLGAVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWE  501

Query  305  AKREPLLPK  279
             + E L+ +
Sbjct  502  DRTETLIKE  510



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+++SY FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  377  RNILSYAFTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GA+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W 
Sbjct  437  FIGIPLGALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWS  496

Query  305  AKR  297
             K+
Sbjct  497  NKK  499



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FT GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  388  RHVISYIFTGGETVANAVSDLCPFLAVTLLLNGLQPVLSGVAVGCGWQAYVAYVNIGCYY  447

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF FNLG KGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRL  WD
Sbjct  448  VVGIPIGCLLGFKFNLGVKGIWTGMIGGTAMQTLILLWVTFRTDWNKEVEKAGKRLAMWD  507

Query  305  AKREPLLPKT*KRSIHETK  249
              +EPLL     + + E K
Sbjct  508  DIKEPLLKY--HKEVEEIK  524



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W 
Sbjct  438  VIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWS  497

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  498  NKKQEVVPE  506



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/126 (78%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT GEVV++ VSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  332  RNVISYAFTGGEVVSNRVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  391

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP G +LGFYFNLGA GIW GMIGGT+MQTIIL WVT+RTDW KEVE A++RLN+W 
Sbjct  392  FVGVPFGCLLGFYFNLGAMGIWSGMIGGTLMQTIILTWVTLRTDWSKEVETAQQRLNKWG  451

Query  305  AKREPL  288
             K+  L
Sbjct  452  DKQPAL  457



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGCYY
Sbjct  387  RHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+
Sbjct  447  VVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEVEKAKSRLHKWE  506

Query  305  AKREPLL  285
             KR+P L
Sbjct  507  DKRKPSL  513



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T RTDW KEVE AK+RL++W+
Sbjct  431  GVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRTDWNKEVEKAKERLDKWE  490

Query  305  AKREPLLPK  279
              +EPL  K
Sbjct  491  NVKEPLSKK  499



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  305  AKREPLLPKT  276
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GEVVA A SDL P LA TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RDSISYIFTEGEVVAKAASDLSPFLAATLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD
Sbjct  431  LLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTWD  490

Query  305  AKREPLLPK  279
             KR+P LP+
Sbjct  491  DKRQPPLPE  499



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  334  RDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  393

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  309
            VVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++W
Sbjct  394  VVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKW  453

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  454  DDKKQPLL  461



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  368  RDYISYIFTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYY  427

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+
Sbjct  428  FVGIPLGFLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWE  487

Query  305  AKREPLLPKT  276
             K++PLL  T
Sbjct  488  DKKQPLLAGT  497



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ +SY+FT+GEVV++AV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  365  RNYVSYLFTEGEVVSNAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  424

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVGVP+GA+LGF F LG KGIW GMIGGTVMQT ILLWVT+RTDW KEVE A+KRLN+W 
Sbjct  425  VVGVPLGALLGFVFKLGVKGIWGGMIGGTVMQTAILLWVTLRTDWSKEVEEAQKRLNKWE  484

Query  308  DAKREPLL  285
            D K EPLL
Sbjct  485  DKKTEPLL  492



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ +VAYVNVGCYY
Sbjct  306  RHVISYAFTSGGTVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAYVAYVNVGCYY  365

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF + LGAKGIW GMIGGT+MQT+IL+W T RTDW KEVE A++RL  WD
Sbjct  366  VVGIPLGCLLGFKYKLGAKGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLRTWD  425

Query  305  AKREPLL  285
             K+EPLL
Sbjct  426  DKKEPLL  432



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVPVG +LGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD
Sbjct  431  LIGVPVGVLLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWD  490

Query  305  AKREPLL  285
             KR+PLL
Sbjct  491  EKRQPLL  497



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  384  RDQLSYLFTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  309
            VVGVP+G  LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++W
Sbjct  444  VVGVPLGVFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKW  503

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  504  DDKKQPLL  511



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  269  RNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+
Sbjct  329  VVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWE  388

Query  305  AKREPLL  285
             K++PLL
Sbjct  389  DKKKPLL  395



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY+FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  310  RDVLSYLFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  369

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W 
Sbjct  370  VIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWNKEVEEASKRMDKWS  429

Query  305  AKREPLLPK  279
             +++ ++P+
Sbjct  430  NQKQEVVPE  438



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R ++SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDILSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+ GFY+N GAKGIW GMIGGT+ QT IL WVT RTDW KEVE A KR+++W 
Sbjct  438  VIGIPLGALFGFYYNFGAKGIWTGMIGGTITQTFILAWVTFRTDWTKEVEEASKRMDKWS  497

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  498  NKKQEVVPE  506



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  390  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  449

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+
Sbjct  450  VVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWE  509

Query  305  AKREPL  288
             K++PL
Sbjct  510  DKKQPL  515



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+
Sbjct  431  VVGIPLGCVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWE  490

Query  305  AKREPL  288
             K++PL
Sbjct  491  DKKQPL  496



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ VADAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  379  RDVLSYAFTEGKEVADAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W 
Sbjct  439  IIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWS  498

Query  305  AKREPLLPK  279
             K++ ++ +
Sbjct  499  NKKQDVVSE  507



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  294  RNVISYVFTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  353

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+
Sbjct  354  VVGIPIGCILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWE  413

Query  305  AKREPLL  285
             K++PLL
Sbjct  414  DKKKPLL  420



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  372  RNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  431

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW KEVE AKKRL++W+
Sbjct  432  GVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKEVECAKKRLDKWE  491

Query  305  AKREPL  288
              + PL
Sbjct  492  NLKGPL  497



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  389  RDVISYAFTEGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  448

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GAV+GFYF   AKGIW GM+GGTV+QT+IL+WVT RTDW KEV  A++RLNQW+
Sbjct  449  GIGIPLGAVMGFYFKFNAKGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLNQWE  508

Query  305  AKREPLL  285
              +EPLL
Sbjct  509  DVKEPLL  515



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  395  RDVISYAFTSGETVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  454

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G VLGF F+LGAKGIW GMIGGTV+QT IL+W T +TDW+KEVE AKKRL++WD
Sbjct  455  FVGLPIGCVLGFKFDLGAKGIWSGMIGGTVLQTAILIWTTYQTDWIKEVEKAKKRLDKWD  514

Query  305  AKREPLLPKT  276
               +PLL  +
Sbjct  515  DINQPLLKAS  524



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VN+GCYY
Sbjct  389  RDVLSYAFTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNIGCYY  448

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W 
Sbjct  449  VIGIPLGALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEEEEASKRMDKWS  508

Query  305  AKREPLLPK  279
             K++ ++P+
Sbjct  509  NKKQEVVPE  517



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  390  RDVISYAFTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  449

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF  +LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+
Sbjct  450  VVGIPLGCVLGFKNDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWE  509

Query  305  AKREPLL  285
             K++PLL
Sbjct  510  DKKQPLL  516



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYY
Sbjct  92   RHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYY  151

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W 
Sbjct  152  VVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWE  211

Query  308  DAKREPLL  285
            D + EPLL
Sbjct  212  DKEDEPLL  219



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  277  RDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  336

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD
Sbjct  337  LIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWD  396

Query  305  AKREPLL  285
             +R+PLL
Sbjct  397  DRRQPLL  403



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  393  RDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGF FNLGAKGIW GMIGGT+MQT+IL+WVT RTDW KEV  A KRLN+W+
Sbjct  453  IVGVPLGALLGFKFNLGAKGIWSGMIGGTLMQTLILIWVTFRTDWNKEVNEAIKRLNKWE  512

Query  305  AKREPLL  285
             K++PLL
Sbjct  513  DKKKPLL  519



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FTDGEVV+ AVS+L P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  369  RDVLSYAFTDGEVVSKAVSELSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  428

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP+G +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEVE A++RLN W+
Sbjct  429  LIGVPLGVLLGFKFDLGAKGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLNSWE  488

Query  305  AKREPLL  285
             K+EPLL
Sbjct  489  DKKEPLL  495



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  166  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  225

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  226  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  285

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  286  ESREPLLKQ  294



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY+FTDGE VA AVSDLCPLLALTLVLNGVQPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  386  RDVISYIFTDGEAVAAAVSDLCPLLALTLVLNGVQPVLTGVAVGCGWQAFVAYVNIGCYY  445

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEV+ A KRL++WD
Sbjct  446  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTVILVWVTWRTDWNKEVDEAIKRLSKWD  505

Query  305  AKREPLL  285
               +P++
Sbjct  506  DTAKPVV  512



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT GE VA+AVS+LCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  382  RHVISYVFTGGETVANAVSELCPLLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  441

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+
Sbjct  442  VVGIPFGCLIGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWKKEVEKAKSRLHKWE  501

Query  305  AKR  297
             KR
Sbjct  502  DKR  504



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT+GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY
Sbjct  375  RHVISYVFTEGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYINVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVPVG VLGF FNLG KGIW GMIGGTV+QT+ILLW+T RTDW+KEV  AKKRL++W+
Sbjct  435  GVGVPVGCVLGFKFNLGVKGIWSGMIGGTVLQTLILLWITFRTDWIKEVNTAKKRLDKWE  494



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY+FT+G+ VA AVSDLCPLLALTLVLNG+QPVLSG+AVGCGWQTFVA VNVGCYY
Sbjct  376  RDVVSYLFTEGKDVAAAVSDLCPLLALTLVLNGIQPVLSGMAVGCGWQTFVAKVNVGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+GA+ GFYF  GAKGIW GMI GTVMQTIIL WVT  TDW KEV++A KRL+QW 
Sbjct  436  IVGIPLGALFGFYFKFGAKGIWTGMICGTVMQTIILAWVTFSTDWNKEVDLATKRLDQWS  495

Query  305  AKREPL  288
             ++EPL
Sbjct  496  DRKEPL  501



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VI Y FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVIGYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWD  487

Query  305  AKREPLL  285
             K+E  L
Sbjct  488  VKQESTL  494



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  372  RNVISYAFTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  431

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW K+VE AKKRL++W+
Sbjct  432  GVGIPLGCLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKKVECAKKRLDKWE  491

Query  305  AKREPL  288
              + PL
Sbjct  492  NLKGPL  497



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  306  RHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  365

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W+
Sbjct  366  VVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWE  425

Query  305  AKR-EPLL  285
             K  +PLL
Sbjct  426  DKEDQPLL  433



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY+FT+G+ V+DAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQT+VA VN+GCYY
Sbjct  378  RDVLSYLFTEGKEVSDAVSDLCPLLAVTIVLNGIQPVLSGVAVGCGWQTYVAKVNIGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+GA+LGFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W 
Sbjct  438  VIGIPLGALLGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWSKEAEEASKRMDKWS  497

Query  305  AKREPLLPK  279
             +++ ++P+
Sbjct  498  NQKQEVVPE  506



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDYLSYTFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+
Sbjct  452  IVGIPLGVLLGFKFNLGAKGIWSGMIGGTFMQTLILIWVTFRTDWNKEVDEAIKRLNKWE  511

Query  305  AKREPLL  285
             K++PLL
Sbjct  512  DKKQPLL  518



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnvg  495
            R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNVG
Sbjct  361  RNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNVG  420

Query  494  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  315
            CYY+VGVP+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN
Sbjct  421  CYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLN  480

Query  314  QW-DAKREPLL  285
            +W D K+EPLL
Sbjct  481  KWDDTKKEPLL  491



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  372  RDSISYIFTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  431

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP+G +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD
Sbjct  432  LIGVPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWD  491

Query  305  AKREPLL  285
             +R+PLL
Sbjct  492  DRRQPLL  498



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  362  RDYLSYIFTEGETVAHAVSELTPLLAITIILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  421

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+GA+LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+
Sbjct  422  IVGIPLGALLGFKFNLGAKGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLNKWE  481

Query  305  AKREPLL  285
             +++PLL
Sbjct  482  DEKQPLL  488



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 116/129 (90%), Gaps = 2/129 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  427

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGF F LG KGIW GMIGGT MQT ILLWVT+RTDW KEVE A+KRL++W+
Sbjct  428  IVGVPLGAILGFVFKLGVKGIWGGMIGGTCMQTAILLWVTLRTDWNKEVEEAQKRLHKWE  487

Query  305  AKR--EPLL  285
             K+  EPLL
Sbjct  488  DKKTTEPLL  496



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RDSISYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVPVG VLGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD
Sbjct  431  LIGVPVGVVLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWD  490

Query  305  AKREPLL  285
             K +PLL
Sbjct  491  EKGQPLL  497



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SY FT G+V+A+A SDL PLLA++L+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RHVMSYAFTGGQVIAEAASDLAPLLAISLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVG+P+G VLGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W 
Sbjct  431  VVGIPLGIVLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQ  490

Query  308  DAKREPLL  285
            +  ++PL 
Sbjct  491  NNSKKPLF  498



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYY
Sbjct  269  RHVISYAFTGGATVAKEVSDLCPFLAITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W 
Sbjct  329  VVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWE  388

Query  308  DAKREPLL  285
            D + EPLL
Sbjct  389  DXEDEPLL  396



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RDSMSYIFTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD
Sbjct  431  LLGIPLGVLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTWD  490

Query  305  AKREPLLPK  279
             KR+P L +
Sbjct  491  DKRQPPLQE  499



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  271  RDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYY  330

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD
Sbjct  331  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWD  390

Query  305  AKREPLL  285
               +P++
Sbjct  391  DTAKPIV  397



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FT+GE VADAVS+L P LA +LVLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  384  RHVISYIFTEGETVADAVSELTPYLAASLVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  443

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYF  GAKGIW G+I G  +QT+ILLW T RTDW KEVE+A+KRL  WD
Sbjct  444  LIGIPLGALFGFYFKYGAKGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRLATWD  503

Query  305  AKREPLL  285
             +++PLL
Sbjct  504  DQKQPLL  510



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GE VA AVSDL PLLAL +VLNGVQPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  391  RDVISYVFTEGEEVAAAVSDLSPLLALAIVLNGVQPVLSGVAVGCGWQTFVAYVNVGCYY  450

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GAVLGFYF  GAKGIW GM+GGTV+QTIIL+WVT RTDW  EV  + KRLN+W+
Sbjct  451  GLGIPLGAVLGFYFKFGAKGIWLGMLGGTVLQTIILMWVTFRTDWNNEVVESNKRLNKWE  510

Query  305  AKREPLL  285
             K E LL
Sbjct  511  GKTESLL  517



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  366  RNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  425

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W 
Sbjct  426  IVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWE  485

Query  308  DAKREPLL  285
            D K+EPLL
Sbjct  486  DKKKEPLL  493



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 114/128 (89%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  366  RNYISYLFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  425

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+G +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W 
Sbjct  426  IVGVPLGVLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWE  485

Query  308  DAKREPLL  285
            D K+EPLL
Sbjct  486  DKKKEPLL  493



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  387  RDVLSYAFTEGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+ GFYF   AKGIW GMI GTVMQT+IL WVT RTDWVKEVE A KRL++W 
Sbjct  447  IVGVPLGALFGFYFKFDAKGIWTGMICGTVMQTVILAWVTFRTDWVKEVEEASKRLDKWS  506

Query  305  AKREPLLPK  279
             K+  ++P+
Sbjct  507  NKKLEVVPE  515



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE VA+AVSDLCP LA+TL+L+GVQP+ SGVAVGCGWQ FVAYVNVGC Y
Sbjct  376  RNVISYAFTEGETVANAVSDLCPFLAVTLILSGVQPIFSGVAVGCGWQAFVAYVNVGCNY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W 
Sbjct  436  AVGIPVGCLLGFRFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWG  495

Query  305  AKREPL  288
              +EPL
Sbjct  496  NVKEPL  501



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RHVISYAFTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W+
Sbjct  440  VVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWE  499

Query  305  AKR-EPLL  285
             K  +PLL
Sbjct  500  DKEDQPLL  507



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  313  RNYISYLFTEGEVVSNAVADLCPLLAVTLVLNGIQPVLSGVAVGCGWQQFVAYVNIGCYY  372

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GAVLGF F LG KGIW GMIGGT MQT IL+WVT+RTDW KEVE A+ RL++W+
Sbjct  373  IVGVPLGAVLGFVFKLGVKGIWAGMIGGTCMQTAILVWVTLRTDWNKEVEEAQNRLHKWE  432

Query  305  AKR--EPLL  285
            A +  EPLL
Sbjct  433  ANKTTEPLL  441



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 2/126 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SY FT G+V+A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RHVMSYAFTGGQVIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVG+P+G +LGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W 
Sbjct  435  VVGIPLGILLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQ  494

Query  308  -DAKRE  294
             ++K++
Sbjct  495  NNSKKQ  500



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  373  RDSISYIFTEGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++GVP+G +LGF F+LG KGIW GM+GGTV+QT+ILLWVT RTDW  EVEVAK RL+ WD
Sbjct  433  LIGVPLGVLLGFTFDLGVKGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLSSWD  492

Query  305  AKREPLL  285
             KR+PLL
Sbjct  493  DKRQPLL  499



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWG  511

Query  305  AKREPL  288
              +EPL
Sbjct  512  KVKEPL  517



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 115/129 (89%), Gaps = 2/129 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  358  RNYISYIFTEGEVVSNAVADLCPLLAITLVLNGIQPVLSGVAVGCGWQEFVAYVNVGCYY  417

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            +VGVP+GA+LGF F LG KGIW GMIGGT MQT IL+W T+RTDW KEVE A+KRLN+W 
Sbjct  418  IVGVPLGAILGFVFKLGVKGIWSGMIGGTFMQTAILVWATLRTDWNKEVEEAQKRLNKWA  477

Query  308  DAK-REPLL  285
            D+K  EPLL
Sbjct  478  DSKTTEPLL  486



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE VA AVSDLCPLLA ++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  397  RDYISYIFTEGETVARAVSDLCPLLAASIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  456

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP G +LGF F LG KGIWCG+I GTV QT+ILL VT RTDW KEVE AKKRL++W+
Sbjct  457  IVGVPAGCLLGFKFGLGVKGIWCGLIAGTVNQTLILLVVTFRTDWNKEVEEAKKRLDKWE  516

Query  305  AKREPLL  285
             K EPLL
Sbjct  517  EKEEPLL  523



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY
Sbjct  386  RDNISYIFTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYY  445

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD
Sbjct  446  IVGVPLGSLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWD  505

Query  305  AKREPLL  285
               +P++
Sbjct  506  DTAKPIV  512



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R +ISY FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDIISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQAFVAYVNVGCYY  450

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP G +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+
Sbjct  451  LVGVPFGVLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWE  510

Query  305  AKREPL  288
              +E L
Sbjct  511  EVKEQL  516



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnvg  495
            R+ ISY+FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNVG
Sbjct  361  RNYISYIFTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNVG  420

Query  494  cyyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLN  315
            CYY+VGVP+G +LGF FN G KG+W GMIGGT +QT ILLWVTIRTDW KEVE A+KRLN
Sbjct  421  CYYIVGVPLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWVTIRTDWSKEVEEAQKRLN  480

Query  314  QW-DAKREPLL  285
            +W D K+EPLL
Sbjct  481  KWDDTKKEPLL  491



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYVFTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFT+GE VA AVSDLCPLL+L+L+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  375  RDVISYVFTEGEAVAAAVSDLCPLLSLSLLLNGIQPVLSGVAVGCGWQAFVAYVNVACYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+GAVLGFYF  GAKGIW GM+GGT MQT+IL+WVT RTDW KEV+ A KRLN+W+
Sbjct  435  GVGIPLGAVLGFYFQFGAKGIWLGMLGGTTMQTVILMWVTFRTDWNKEVQEADKRLNKWE  494

Query  305  AKREPLL  285
             K+EPLL
Sbjct  495  DKKEPLL  501



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 112/132 (85%), Gaps = 5/132 (4%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGCYY
Sbjct  387  RHVISYVFTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE-----VEVAKKR  321
            VVG+P G ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE     VE AK R
Sbjct  447  VVGIPFGCLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEMFQFQVEKAKSR  506

Query  320  LNQWDAKREPLL  285
            L++W+ KR+P L
Sbjct  507  LHKWEDKRKPSL  518



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  304  RHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  363

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD
Sbjct  364  VVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWD  423

Query  305  AKREPLL  285
                  L
Sbjct  424  TNNSASL  430



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  392  RDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACYY  451

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+GA+LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEV  A KRLN+W+
Sbjct  452  IVGIPLGALLGFKFDLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKWE  511

Query  305  AKREPLL  285
             K++PLL
Sbjct  512  DKKQPLL  518



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAKAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  381  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  440

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD
Sbjct  441  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWD  500

Query  305  AKREPLL  285
              + PLL
Sbjct  501  DGKAPLL  507



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GEVVA  VS LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  372  RNVISYAFTEGEVVAKEVSSLCPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  431

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+ GAKGIW GMIGGTVMQTIILLWVT  TDW KEVE A+KRL++W+
Sbjct  432  GVGIPLGCLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKEVESARKRLDKWE  491

Query  305  AKREPL  288
              + PL
Sbjct  492  NLKGPL  497



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD
Sbjct  443  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWD  502

Query  305  AKREPLL  285
              + PLL
Sbjct  503  DGKAPLL  509



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE VA AVS+L PLLA+ L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  378  RNVISYAFTEGETVAKAVSELSPLLAVALLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG VLGF F+ GAKGIW GMIGGTVMQTIILLWVT RTDW+KEVE AK RL++WD
Sbjct  438  LVGIPVGCVLGFKFDFGAKGIWSGMIGGTVMQTIILLWVTFRTDWIKEVEKAKMRLDKWD  497

Query  305  AKREPL  288
              ++ L
Sbjct  498  DDKQTL  503



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ ISY+FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  360  RNYISYIFTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQEFVAYVNIGCYY  419

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+GA+LGF F  G KGIW GMIGGT MQT ILLW T+RTDW KEVE A+KRL++W+
Sbjct  420  IVGVPLGAILGFVFKFGVKGIWSGMIGGTFMQTAILLWATLRTDWNKEVEEAQKRLHKWE  479

Query  305  AKR----EPLL  285
             ++    EPLL
Sbjct  480  DQKTTTTEPLL  490



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY FT GE VA AVSDLCPLLA TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RDQLSYFFTGGEAVARAVSDLCPLLAATLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW  309
            VVGVP+G  LGFY +LGAKG+W GM IGGT+ QT+ILLWVT+RTDW KEVE AK RL++W
Sbjct  443  VVGVPLGVFLGFYLDLGAKGVWSGMVIGGTLTQTLILLWVTVRTDWNKEVENAKARLDKW  502

Query  308  DAKREPLL  285
            D K++PLL
Sbjct  503  DDKKQPLL  510



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF ++LGAKGIW GMIGGTVMQT IL+W T R DW KEVE AKK L++W+
Sbjct  431  GVGIPLGCLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRADWNKEVEKAKKHLDKWE  490

Query  305  AKREPL  288
              +E L
Sbjct  491  NVKETL  496



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLL+LT++LNG+QPVLSGVAVGCGWQTFVAYVNV CYY
Sbjct  393  RDYLSYIFTEGETVAHAVSELAPLLSLTIILNGIQPVLSGVAVGCGWQTFVAYVNVTCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G +LGF FN GAKGIW GMIGGT+MQT+ILLWVT RTDW KEV+ A KRL++W+
Sbjct  453  LVGVPLGILLGFKFNFGAKGIWSGMIGGTLMQTVILLWVTFRTDWNKEVDQALKRLDKWE  512

Query  305  AKREPLL  285
             K++ LL
Sbjct  513  DKKQHLL  519



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  371  RNVISYAFTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  430

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF ++LGAKGIW GMIGGT+MQT IL+W T R DW KEVE AKK L++W+
Sbjct  431  GVGIPLGCLLGFKYDLGAKGIWTGMIGGTIMQTFILIWFTFRADWNKEVEKAKKHLDKWE  490

Query  305  AKREPL  288
              +E L
Sbjct  491  NVKETL  496



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPYLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SYVFT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  377  RHVVSYVFTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+GA+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD
Sbjct  437  VVGIPLGALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWD  496

Query  305  AKREPLL  285
                  L
Sbjct  497  TNNSASL  503



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  199  RNVISYAFTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  258

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+
Sbjct  259  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWE  318

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  319  ESREPLLKQ  327



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT GE VA AVS LCPLLA++L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  387  RNVISYAFTGGEAVAQAVSGLCPLLAISLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G++LGFYF  GAKGIW G++GGT+MQTIIL+ V +RTDW KEVE A +RL+QW+
Sbjct  447  IVGVPLGSLLGFYFKHGAKGIWLGLLGGTLMQTIILIVVMVRTDWNKEVEKALERLDQWE  506

Query  305  AKREPLLPK  279
             K+EPLL +
Sbjct  507  DKKEPLLKE  515



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH ISY FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  365  RHYISYAFTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  424

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W+
Sbjct  425  FVGIPLGILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWE  484

Query  305  AKREPLLPK  279
              ++PLL  
Sbjct  485  DNKQPLLSN  493



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  368  RNVISYAFTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  427

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KEVE + KRLN+WD
Sbjct  428  IVGVPLGVLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNKWD  487

Query  305  AKRE  294
             K+E
Sbjct  488  DKQE  491



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GEVVA A SDL P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  373  RDSISYIFTEGEVVAKAASDLSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G +LGF F+LGAKGIW GM+GGTV+QT+ILL VT RTDW KEVE AK RL+ WD
Sbjct  433  LIGIPLGVLLGFTFDLGAKGIWSGMLGGTVLQTLILLGVTWRTDWNKEVEGAKNRLSTWD  492

Query  305  AKREPLLPK  279
             K EPLL K
Sbjct  493  DKSEPLLQK  501



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  385  RDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+WVKEVE A+KRLN+W+
Sbjct  445  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWVKEVEEAQKRLNKWE  504

Query  305  AKREPLL  285
             ++ PLL
Sbjct  505  -EKSPLL  510



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEVE AK R+ +WD
Sbjct  440  VVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVENAKSRVEKWD  499

Query  305  AKREPLL  285
             K++PLL
Sbjct  500  DKKQPLL  506



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  92   RHVISYIFTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  151

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKEVE A +RL+QW+
Sbjct  152  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE  211

Query  305  AKREPLLPK  279
                PLL +
Sbjct  212  -DTSPLLKQ  219



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 109/128 (85%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYY
Sbjct  379  RHVISYAFTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W+
Sbjct  439  VVGIPLGCVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWE  498

Query  305  AKR-EPLL  285
             K  EPLL
Sbjct  499  DKEDEPLL  506



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RHVISYAFTDSPAVAEAVADLSPFLAVTIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPVGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  391  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  450

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  451  GSQAPLLKQ  459



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  656  ISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvg  477
            ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG
Sbjct  384  ISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVG  443

Query  476  vpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  297
            +P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  +
Sbjct  444  IPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGK  503

Query  296  EPLL  285
             PLL
Sbjct  504  APLL  507



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHV+SY FT GE +A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RHVMSYAFTSGETIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-  309
            VVG+P+G +LGF F L AKGIW GM+GGT MQTIILLWVT RT+W +EVE AK RLN W 
Sbjct  440  VVGIPLGVILGFNFKLEAKGIWLGMLGGTAMQTIILLWVTFRTNWEQEVEKAKSRLNMWQ  499

Query  308  DAKREPLL  285
            D  ++PLL
Sbjct  500  DQSKKPLL  507



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FTDGE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  380  RDVLSYAFTDGETVSAAVSDLCPLLAITLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W 
Sbjct  440  IIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWS  499

Query  305  AKREPLLPK  279
             K+  ++P+
Sbjct  500  NKKLEVVPE  508



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYISYIFTDGEDVATAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  453  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWE  512

Query  305  AKREPLLPK  279
             K  PLL +
Sbjct  513  DK-TPLLSE  520



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+
Sbjct  433  VVGIPIGFILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYISYIFTDGEDVAAAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  453  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWE  512

Query  305  AKREPLLPK  279
             K  PLL +
Sbjct  513  DK-TPLLSE  520



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT G VVA+AVSDL P+LA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVG YY
Sbjct  379  RDKISYMFTGGTVVAEAVSDLAPILAISLVLNGIQPVLSGVAVGCGWQAFVAYVNVGSYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+GAVLGF F LGAKGIW GM+GGT +QTIIL+WVT+RTDW KEVE+A+ RLN+W+
Sbjct  439  FLGIPLGAVLGFVFKLGAKGIWSGMLGGTALQTIILIWVTVRTDWNKEVEIARGRLNRWE  498

Query  305  AKRE  294
             K+E
Sbjct  499  DKKE  502



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISYVFT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYVFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  305  AKREPL  288
             K+EPL
Sbjct  495  DKKEPL  500



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE VA AVS+LCPLLA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  378  RNVISYAFTEGETVAKAVSELCPLLAVSLVLNGIQPVLSGVAVGCGWQKFVAYVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+LGA+GIW GM+GGT MQTIILLWVT   DW  EVE A+ RL++W+
Sbjct  438  VVGIPIGCLLGFKFHLGAQGIWSGMLGGTTMQTIILLWVTFHADWNAEVEKARMRLDKWE  497

Query  305  AKREPL  288
              +EPL
Sbjct  498  DSKEPL  503



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  653  SYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgv  474
            SY FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+
Sbjct  381  SYAFTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGI  440

Query  473  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  294
            P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+E
Sbjct  441  PLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKE  500

Query  293  P  291
            P
Sbjct  501  P  501



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYIFTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  305  AKREPL  288
             K+EPL
Sbjct  495  DKKEPL  500



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  653  SYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgv  474
            SY FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+
Sbjct  380  SYAFTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGI  439

Query  473  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  294
            P+G VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+E
Sbjct  440  PLGCVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKE  499

Query  293  P  291
            P
Sbjct  500  P  500



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVS L P LA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RDVISYAFTSGETVAKAVSHLTPYLAVTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEV+ AK R+ +WD
Sbjct  440  VVGIPCGCVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVEKWD  499

Query  305  AKREPLL  285
             K +PLL
Sbjct  500  DKEQPLL  506



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  376  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWE  495

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  496  DSQAPLLKQ  504



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISYVFTD  VVA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  379  RHVISYVFTDSPVVAEAVAELAPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GA GIW GMIGGT+MQTIILL VT RTDW KEVE A +RL+QW+
Sbjct  439  IVGIPIGYVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWE  498

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  499  DTQAPLLKQ  507



>emb|CDY71092.1| BnaAnng36070D [Brassica napus]
Length=130

 Score =   150 bits (379),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  4    RDYLSYAFTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  63

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W 
Sbjct  64   IIGIPLGALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWS  123

Query  305  AKREPLL  285
             K+  ++
Sbjct  124  NKKAEVI  130



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT+GE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RHVISYAFTEGETVANAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +WD
Sbjct  443  VVGIPLGCLLGFKFDLGAKGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWD  502

Query  305  AKRE  294
             ++E
Sbjct  503  DRQE  506



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY
Sbjct  60   RDYISYIFTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQALVAYVNVGCYY  119

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+
Sbjct  120  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWE  179

Query  305  AKREPL  288
              + P+
Sbjct  180  DSKAPV  185



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  383  RDVLSYAFTEGEEVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL W+T RTDW KEVE + KRL++W 
Sbjct  443  IIGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWITFRTDWTKEVEESAKRLDKWS  502

Query  305  AKREPLLPK  279
             K+  ++P+
Sbjct  503  NKKPEVVPE  511



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT+GE V++AVS L P LA++++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  378  RNVISYAFTEGETVSNAVSALSPYLAVSIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G VLGF F+ GA+GIW GMIGGT +QT+ILLWVT RTDW KEVE  K RL++WD
Sbjct  438  IIGIPLGCVLGFKFDFGAQGIWSGMIGGTFIQTLILLWVTFRTDWKKEVENVKNRLDRWD  497

Query  305  AKREPLLPK  279
             K+EPLL +
Sbjct  498  DKKEPLLTE  506



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FTDGE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RDVISYAFTDGETVANAVSHLTPYLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+G +LGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW KEVE A  RL +W+
Sbjct  443  VLGIPIGCLLGFKFDLGAEGIWSGMIGGTFMQTIILLWVTFRTDWNKEVETAGNRLKKWE  502

Query  305  AKREP  291
             K+ P
Sbjct  503  DKKLP  507



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+ +SY+FT G  V++AV+DL P LA++++LNG+QPVLSGVAVGCGWQ+FVAYVNV CYY
Sbjct  381  RYELSYIFTGGTEVSEAVADLSPFLAISILLNGIQPVLSGVAVGCGWQSFVAYVNVACYY  440

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGFYF LG KGIW GMIGGTV+QT+ILLWVT RTDW KEVE A  RL++W+
Sbjct  441  VVGIPVGVLLGFYFKLGVKGIWGGMIGGTVIQTVILLWVTFRTDWQKEVEKAASRLDKWE  500

Query  305  AKREPLL  285
            A +EPLL
Sbjct  501  AVKEPLL  507



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgc  492
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGC
Sbjct  269  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGC  328

Query  491  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  312
            YY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+
Sbjct  329  YYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNK  388

Query  311  WDAKREPLL  285
            WD  + PLL
Sbjct  389  WDDGKAPLL  397



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FT GE VA+A   +CP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RNVISYAFTKGETVANAQYLICPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+PVG +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W+
Sbjct  435  GVGIPVGCLLGFKFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWE  494

Query  305  AKREPL  288
              +EPL
Sbjct  495  NVKEPL  500



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  385  RDVLSYAFTEGENVSAAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W 
Sbjct  445  IIGIPLGALFGFYFKFDAKGIWTGMICGTIIQTVILAWVTFRTDWTKEVEEASKRLDVWS  504

Query  305  AKREPLLPK  279
             K+  ++P+
Sbjct  505  NKKTEVVPE  513



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISYVFTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  331  RQVISYVFTDSPAVAEAVAELSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  390

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL++W+
Sbjct  391  FVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWE  450

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  451  DTQAPLLKQ  459



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 110/127 (87%), Gaps = 1/127 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  391  RDYISYIFTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  450

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIWCGMIGGT+MQT+IL+WVT RT+W KEVE A KRLN+W+
Sbjct  451  IVGIPLGCLLGFYFDLGAAGIWCGMIGGTLMQTLILVWVTFRTNWNKEVEEALKRLNKWE  510

Query  305  AKREPLL  285
             K  P+L
Sbjct  511  DK-SPIL  516



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  400  RDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  459

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD
Sbjct  460  VVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWD  519

Query  305  AKREPLL  285
             K++PLL
Sbjct  520  DKKQPLL  526



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 110/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  393  RDYLSYIFTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  452

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FNLGAKGIW GMIGGT +QT+IL+WVT RTDW KEV+ A KRLN+W+
Sbjct  453  IVGIPLGVLLGFKFNLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVDEAIKRLNKWE  512

Query  305  AKREPLL  285
              ++ LL
Sbjct  513  DNKKALL  519



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  305  AKREPLL  285
             K+EPLL
Sbjct  500  DKKEPLL  506



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISY FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  373  RNVISYAFTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+
Sbjct  433  VVGIPIGFVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWE  492

Query  305  AKREPLLPK  279
              REPLL +
Sbjct  493  ESREPLLKQ  501



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWD  499

Query  305  AKREPL  288
             K+EPL
Sbjct  500  DKKEPL  505



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  400  RDVISYAFTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  459

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD
Sbjct  460  VVGIPFGCILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWD  519

Query  305  AKREPLL  285
             K++PLL
Sbjct  520  DKKQPLL  526



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY
Sbjct  373  RHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+
Sbjct  433  IVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWE  492

Query  305  AKREPLL  285
             K++PLL
Sbjct  493  DKQQPLL  499



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  305  AKREPLL  285
             K+EPLL
Sbjct  500  DKKEPLL  506



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY
Sbjct  373  RHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+
Sbjct  433  IVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWE  492

Query  305  AKREPLL  285
             K++PLL
Sbjct  493  DKQQPLL  499



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY
Sbjct  373  RHVISYAFTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+
Sbjct  433  IVGIPLGCLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWE  492

Query  305  AKREPLLPK  279
             K++PLL  
Sbjct  493  DKQQPLLKN  501



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 110/129 (85%), Gaps = 2/129 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgc  492
            R  ISY+FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGC
Sbjct  381  RDYISYIFTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGC  440

Query  491  yyvvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQ  312
            YY+VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+
Sbjct  441  YYIVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNK  500

Query  311  WDAKREPLL  285
            WD  + PLL
Sbjct  501  WDDGKAPLL  509



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FTDGE VA+AVS L P LA+TL++NG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  383  RHVISYAFTDGETVANAVSHLTPYLAVTLIINGIQPVLSGVAVGCGWQAFVAYVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G +LGF F+ GA+GIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +WD
Sbjct  443  VVGIPLGCLLGFKFDFGAEGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWD  502

Query  305  AKRE  294
             ++E
Sbjct  503  DRKE  506



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FTDGE VA AVS L PLL LTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  412  RDYISYIFTDGEDVAAAVSKLTPLLGLTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  471

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+
Sbjct  472  IVGIPLGCLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWE  531

Query  305  AKREPLLPK  279
             K  PLL +
Sbjct  532  DK-TPLLSE  539



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  392  RDTISYAFTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  451

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP GA+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEV  A KRLN+W 
Sbjct  452  LVGVPFGALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVVEAAKRLNKWG  511

Query  305  AKREPL  288
              +E L
Sbjct  512  EVKETL  517



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%), Gaps = 1/126 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA AVSDL PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  60   RDVISYAFTEGEVVAAAVSDLTPLLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  119

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VGVP+G +LGFYFN GAKGIW GM+ GT+MQTIILLW+TIRTDW KEVE A +RLN WD
Sbjct  120  LVGVPLGVLLGFYFNFGAKGIWLGMMAGTLMQTIILLWITIRTDWKKEVEEAARRLNNWD  179

Query  305  AKREPL  288
             K EPL
Sbjct  180  VK-EPL  184



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  I Y+FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYIGYIFTSDVEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWD  499

Query  305  AKREPLL  285
             K+EPLL
Sbjct  500  DKKEPLL  506



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH ISYVFT+GE V++AVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  376  RHDISYVFTEGETVSNAVSDLSPYLAISIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G +LGF F+ GA+GIW GMIGGT +QTIIL+WVT RTDW KEVE A+ RLN ++
Sbjct  436  IIGIPLGCLLGFKFDFGAQGIWTGMIGGTFIQTIILVWVTYRTDWNKEVEKAQSRLNTYE  495

Query  305  AKREP  291
             K+EP
Sbjct  496  DKKEP  500



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  499

Query  305  AKREPL  288
             K+EPL
Sbjct  500  DKKEPL  505



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GE V+ AVSDLCP LA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  378  RDVLSYAFTEGEEVSAAVSDLCPFLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  437

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G + GFYF   AKGIW GMIGGT++QT+IL+WV +RTDW KEVE A KRL++W 
Sbjct  438  IIGIPIGTLFGFYFEYDAKGIWTGMIGGTLIQTVILVWVILRTDWTKEVEKASKRLDKWS  497

Query  305  AKR  297
             K+
Sbjct  498  NKK  500



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  380  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  499

Query  305  AKREPL  288
             K+EPL
Sbjct  500  DKKEPL  505



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  382  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  441

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  442  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  501

Query  305  AKREPL  288
             K+EPL
Sbjct  502  DKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  382  RDYVSYIFTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  441

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+PVG +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  442  VVGIPVGCILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWD  501

Query  305  AKREPL  288
             K+EPL
Sbjct  502  DKKEPL  507



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+G+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VIGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  499

Query  305  AKREPL  288
             K+  L
Sbjct  500  DKKNSL  505



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  381  RDYVSYIFTSDIHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  440

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  441  IVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  500

Query  305  AKREP  291
             K+EP
Sbjct  501  EKKEP  505



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  499

Query  305  AKRE  294
             K++
Sbjct  500  DKKD  503



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV CYY
Sbjct  373  RNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+W+
Sbjct  433  FVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINKWN  492



>ref|XP_011048003.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=516

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G VV+DAVSDL P LA ++VL GVQPVLSGVAVGCGWQ FVAYVN+ CYY
Sbjct  388  RHVISYAFTSGTVVSDAVSDLSPFLAASIVLGGVQPVLSGVAVGCGWQAFVAYVNLACYY  447

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G VLGF  ++GAKGIW GM+GGT MQT++LLW T RT+W KEVE A+ RL+ WD
Sbjct  448  IIGIPLGCVLGFACDMGAKGIWTGMLGGTAMQTLVLLWATFRTNWGKEVEKAQGRLDTWD  507

Query  305  AKREPLLPK  279
            A  EPLL +
Sbjct  508  ATNEPLLKE  516



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV CYY
Sbjct  373  RNVISYVFTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCCYY  432

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+W+
Sbjct  433  FVGLPLGVLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINKWN  492



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  499

Query  305  AKRE  294
             K++
Sbjct  500  DKKD  503



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  375  RDYISYIFTSDPEVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  494

Query  305  AKREPL  288
             K+EPL
Sbjct  495  DKKEPL  500



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  400  RDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  459

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD
Sbjct  460  VVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWD  519

Query  305  AKREPLL  285
             K++PLL
Sbjct  520  DKKQPLL  526



>gb|KFK33086.1| hypothetical protein AALP_AA6G328900 [Arabis alpina]
Length=535

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  375  RHVISYIFTDSVEVAEAVADLSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEVE A +RL+QW+
Sbjct  435  IVGIPIGYVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVEKASRRLDQWE  494

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  495  -DQAPLLKQ  502



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  377  RDYVSYIFTSDVDVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGG++MQT+ILL+VT RTDW KEVE AKKRL+ WD
Sbjct  437  IVGIPVGCILGFTFNFQAKGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWD  496

Query  305  AKREP  291
             K+EP
Sbjct  497  EKKEP  501



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  403  RDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  462

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD
Sbjct  463  VVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWD  522

Query  305  AKREPLL  285
             K++PLL
Sbjct  523  DKKQPLL  529



>ref|XP_010476100.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010476101.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=503

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  376  RHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASRRLDQWE  495

Query  305  AKREPLLPK  279
                PLL +
Sbjct  496  -DSSPLLKQ  503



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  407  RDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  466

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD
Sbjct  467  VVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWD  526

Query  305  AKREPLL  285
             K++PLL
Sbjct  527  DKKQPLL  533



>ref|XP_010493132.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=503

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY+FTD E VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY
Sbjct  376  RHVISYIFTDSEAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASRRLDQWE  495

Query  305  AKREPLLPK  279
                PLL +
Sbjct  496  -DSSPLLKQ  503



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  410  RDVISYAFTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  469

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P G VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD
Sbjct  470  VVGIPFGCVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWD  529

Query  305  AKREPLL  285
             K++PLL
Sbjct  530  DKKQPLL  536



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  375  RDYVSYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT +TDW KEVE A+KRL+ WD
Sbjct  435  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWD  494

Query  305  AKREPL  288
             K+E L
Sbjct  495  DKKESL  500



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 2/127 (2%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT+GE VA AVSDLCPLLA TL+LNG+QPVLSGVAVG  WQ  VAY+NVGCYY
Sbjct  372  RDYLSYIFTEGETVARAVSDLCPLLAATLILNGIQPVLSGVAVG--WQKLVAYINVGCYY  429

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VG+P+G +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE A+KRLNQW+
Sbjct  430  FVGIPLGILLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQWE  489

Query  305  AKREPLL  285
              ++PLL
Sbjct  490  DNKQPLL  496



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G VVADAV++L P LA ++VLNGVQPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  385  RHVISYAFTSGTVVADAVTELSPFLAASIVLNGVQPVLSGVAVGCGWQAFVAYVNVACYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G VLGF  ++G KGIW GM+GGT++QT++LLW TIRT+W KEVE A+ R+++WD
Sbjct  445  IIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTMVLLWATIRTNWGKEVEKAQSRVDRWD  504

Query  305  AKREPLLPK  279
              +EPLL +
Sbjct  505  DNKEPLLRE  513



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R V+SY FT+GE V+ AVS+LCPLLALTL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY
Sbjct  377  RDVLSYAFTEGEKVSAAVSELCPLLALTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYY  436

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+GA+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++W 
Sbjct  437  IVGIPLGALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDKWS  496

Query  305  AKREPLLPK  279
              +  ++P+
Sbjct  497  NIKLEVVPE  505



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 108/131 (82%), Gaps = 4/131 (3%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RDVISYAFTSGETVAKAVSKLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW+KEV  ++ RL +WD
Sbjct  440  VVGIPLGCVLGFKFDLGAQGIWSGMIGGTFMQTIILLWVTFRTDWIKEVGTSRDRLEKWD  499

Query  305  ----AKREPLL  285
                 +++PLL
Sbjct  500  DSNKQQQQPLL  510



>ref|XP_009110708.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=504

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+VISYVFTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  376  RNVISYVFTDSPAVAEAVAELTPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  435

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+P+G VLGF +++GAKGIW GMI GT+MQTIILL VT RTDW KEVE A +RL+QW+
Sbjct  436  IVGIPIGYVLGFTYDMGAKGIWTGMIAGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWE  495

Query  305  AKREPLLPK  279
              + PLL +
Sbjct  496  DTQAPLLKQ  504



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  329  RDYISYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  388

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  389  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  448

Query  305  AKRE  294
             K  
Sbjct  449  DKES  452



>ref|XP_009137228.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=400

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  274  RDYISYIFTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  333

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  334  IVGIPVGCILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  393

Query  305  AKRE  294
             K  
Sbjct  394  DKES  397



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 114/126 (90%), Gaps = 1/126 (1%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH +SY FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+GCYY
Sbjct  387  RHKLSYAFTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIGCYY  446

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVGVP GA+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD
Sbjct  447  VVGVPFGALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWD  506

Query  305  AKREPL  288
             K EPL
Sbjct  507  VK-EPL  511



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  ISY+FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  380  RDYISYIFTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGCYY  439

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            VVG+P+G VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD
Sbjct  440  VVGIPIGCVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWD  499

Query  305  AKREPL  288
             K+  L
Sbjct  500  DKKNSL  505



>ref|XP_011100217.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Sesamum 
indicum]
Length=507

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH +SYVFT GEVV+DAV+DL PLLA +++LNGVQPVLSG+ VGCGWQ FVAYVNVGCYY
Sbjct  379  RHQLSYVFTSGEVVSDAVADLTPLLAASIILNGVQPVLSGIFVGCGWQAFVAYVNVGCYY  438

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            V+GVPVGAVLGF FNLGAKGIW GM+GGT+MQT+IL+W+T+RTDW  EV+ A+ R+++W+
Sbjct  439  VIGVPVGAVLGFVFNLGAKGIWTGMLGGTLMQTLILIWITVRTDWNNEVDKARNRIDKWN  498

Query  305  AKREPLL  285
              +E  L
Sbjct  499  DLKEGFL  505



>ref|XP_002460773.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
 gb|EER97294.1| hypothetical protein SORBIDRAFT_02g034720 [Sorghum bicolor]
Length=496

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH +SY+FT GEVV+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ  VAY+N+GCYY
Sbjct  366  RHKLSYIFTSGEVVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQATVAYINIGCYY  425

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +G+P+G +LGF F+ G KG+W GMIGGT++QT+IL+W+T+RTDW KEVE A+KRL++WD
Sbjct  426  FIGIPLGVLLGFKFDFGIKGLWGGMIGGTLIQTLILIWITLRTDWNKEVEEARKRLDKWD  485

Query  305  AKREPLL  285
              R+PLL
Sbjct  486  DTRQPLL  492



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RHVISY FT G VVADAV++L P LA ++VLNGVQPVLSGVAVGCGWQ FVAYVNV CYY
Sbjct  385  RHVISYAFTSGTVVADAVAELSPFLAASIVLNGVQPVLSGVAVGCGWQAFVAYVNVACYY  444

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G VLGF  ++G KGIW GM+GGT++QTI+LLW TIRT+W KEV  A+ RL++WD
Sbjct  445  IIGIPLGCVLGFVCDMGTKGIWTGMLGGTIVQTIVLLWATIRTNWGKEVGKAQSRLDKWD  504

Query  305  AKREPLL  285
              +EPLL
Sbjct  505  DNKEPLL  511



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R VISY FT+GEVVA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQT VAY+NVGCYY
Sbjct  369  RDVISYAFTEGEVVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQTLVAYINVGCYY  428

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             VGVP+G++LGFYF LG KGIW GMIGGTVMQT+IL W+T RTDW KEVE A KRL++WD
Sbjct  429  AVGVPLGSLLGFYFKLGVKGIWLGMIGGTVMQTLILFWITFRTDWNKEVEEATKRLSKWD  488

Query  305  AKREPLL  285
            A +EP+L
Sbjct  489  ASKEPIL  495



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 106/129 (82%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY FT+G+ V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQ FVA VNVGCYY
Sbjct  383  RDFLSYAFTEGKKVSVAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQAFVAKVNVGCYY  442

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G + GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++W 
Sbjct  443  IIGIPLGVIFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDKWS  502

Query  305  AKREPLLPK  279
             K+  ++P+
Sbjct  503  NKKLEVVPE  511



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R+V+SY FT G  VAD+V++L P LA +++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY
Sbjct  269  RNVLSYAFTGGSTVADSVAELSPFLAFSVILNGVQPVLSGVAVGCGWQAFVAYVNVGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            ++G+P+G +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W 
Sbjct  329  LIGIPIGCLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEWG  388

Query  305  AKREPLLPK  279
             K E LL +
Sbjct  389  DKTEQLLKE  397



>ref|XP_009135444.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=497

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT  + VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY
Sbjct  375  REYVSYIFTADDEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYY  434

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A KRL+ WD
Sbjct  435  IVGIPVGCLLGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKANKRLDMWD  494

Query  305  AKR  297
             K+
Sbjct  495  DKK  497



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            R  +SY+FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY
Sbjct  381  RDYVSYIFTSDVHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYY  440

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
            +VG+PVG +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT W KEVE AKKRL+ WD
Sbjct  441  IVGIPVGCILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTAWDKEVEKAKKRLDMWD  500

Query  305  AKREP  291
             K+EP
Sbjct  501  EKKEP  505



>gb|EMT14886.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=400

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -1

Query  665  RHVISYVFTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyy  486
            RH +SY+FT GE V+ AV+DLCPLL  T+VL G+QPVLSGVAVGCGWQ  VAY+N+GCYY
Sbjct  269  RHKLSYIFTGGEAVSRAVADLCPLLVGTIVLCGIQPVLSGVAVGCGWQALVAYINIGCYY  328

Query  485  vvgvpvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  306
             +GVP+GA+LGF F+ G KG+W GMIGGT++QTIILLW+T RTDW KEVE A++RL++WD
Sbjct  329  FIGVPLGALLGFKFDYGIKGLWGGMIGGTLIQTIILLWITFRTDWNKEVEEARRRLDKWD  388

Query  305  AKREPLL  285
              ++PLL
Sbjct  389  DAKQPLL  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350