BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011L06

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABO93008.1|  putative methyltransferase                              278   2e-86   Solanum tuberosum [potatoes]
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         279   1e-85   Solanum lycopersicum
gb|ABO92980.1|  putative methyltransferase                              278   2e-85   Solanum tuberosum [potatoes]
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    278   3e-85   Solanum tuberosum [potatoes]
ref|XP_002522425.1|  ATP binding protein, putative                      276   2e-84   
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    275   2e-84   Solanum tuberosum [potatoes]
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         275   3e-84   Jatropha curcas
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         275   5e-84   Nicotiana sylvestris
emb|CBI31965.3|  unnamed protein product                                272   6e-84   Vitis vinifera
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         273   1e-83   Nicotiana sylvestris
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         273   2e-83   Nicotiana tomentosiformis
gb|KHN06856.1|  Putative methyltransferase PMT2                         261   3e-83   Glycine soja [wild soybean]
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         273   3e-83   Sesamum indicum [beniseed]
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                272   3e-83   Erythranthe guttata [common monkey flower]
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         272   5e-83   Vitis vinifera
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2         271   1e-82   Fragaria vesca subsp. vesca
ref|XP_010089758.1|  putative methyltransferase PMT2                    271   2e-82   Morus notabilis
emb|CDP00327.1|  unnamed protein product                                270   3e-82   Coffea canephora [robusta coffee]
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             270   5e-82   Populus trichocarpa [western balsam poplar]
ref|XP_003628359.1|  hypothetical protein MTR_8g055840                  263   7e-82   
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         269   7e-82   Solanum lycopersicum
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         268   1e-81   Populus euphratica
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                268   1e-81   Erythranthe guttata [common monkey flower]
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         268   2e-81   Nicotiana tomentosiformis
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         267   3e-81   Populus euphratica
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         267   4e-81   Nelumbo nucifera [Indian lotus]
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  262   2e-80   
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             265   2e-80   Prunus persica
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         265   3e-80   Prunus mume [ume]
gb|KDO43766.1|  hypothetical protein CISIN_1g026623mg                   253   3e-80   Citrus sinensis [apfelsine]
gb|KDO82912.1|  hypothetical protein CISIN_1g0105922mg                  256   4e-80   Citrus sinensis [apfelsine]
ref|XP_002511570.1|  ATP binding protein, putative                      265   4e-80   Ricinus communis
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         264   5e-80   Eucalyptus grandis [rose gum]
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  264   5e-80   Medicago truncatula
ref|XP_004160003.1|  PREDICTED: probable methyltransferase PMT2-like    259   5e-80   
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    264   6e-80   Cicer arietinum [garbanzo]
ref|NP_001280936.1|  uncharacterized protein LOC103402903               264   7e-80   Malus domestica [apple tree]
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         264   7e-80   
gb|ACJ85858.1|  unknown                                                 263   1e-79   Medicago truncatula
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  263   1e-79   Medicago truncatula
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    263   2e-79   
gb|KHG10506.1|  hypothetical protein F383_11349                         263   2e-79   Gossypium arboreum [tree cotton]
gb|KJB60757.1|  hypothetical protein B456_009G324300                    263   2e-79   Gossypium raimondii
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         262   2e-79   
gb|EPS59468.1|  hypothetical protein M569_15338                         262   3e-79   Genlisea aurea
ref|XP_008373610.1|  PREDICTED: probable methyltransferase PMT14        253   4e-79   
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         262   4e-79   Nelumbo nucifera [Indian lotus]
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         261   7e-79   Sesamum indicum [beniseed]
emb|CBI15236.3|  unnamed protein product                                258   7e-79   Vitis vinifera
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             261   9e-79   Citrus clementina [clementine]
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             261   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         260   1e-78   Malus domestica [apple tree]
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             260   1e-78   
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         260   2e-78   Pyrus x bretschneideri [bai li]
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    260   2e-78   Glycine max [soybeans]
gb|KHG23981.1|  hypothetical protein F383_09020                         260   2e-78   Gossypium arboreum [tree cotton]
gb|KJB80180.1|  hypothetical protein B456_013G084900                    260   2e-78   Gossypium raimondii
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like    259   3e-78   Cucumis sativus [cucumbers]
gb|KDP31241.1|  hypothetical protein JCGZ_11617                         259   4e-78   Jatropha curcas
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             259   4e-78   Populus trichocarpa [western balsam poplar]
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         259   5e-78   Cucumis melo [Oriental melon]
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  256   6e-78   Citrus sinensis [apfelsine]
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         259   6e-78   Vitis vinifera
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         258   7e-78   Populus euphratica
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         258   8e-78   Populus euphratica
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    258   8e-78   Populus euphratica
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         258   9e-78   Tarenaya hassleriana [spider flower]
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        258   1e-77   Populus euphratica
gb|KJB51709.1|  hypothetical protein B456_008G228900                    258   1e-77   Gossypium raimondii
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             258   1e-77   Prunus persica
gb|KDP22915.1|  hypothetical protein JCGZ_01776                         258   1e-77   Jatropha curcas
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    258   1e-77   Cicer arietinum [garbanzo]
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             258   2e-77   Prunus persica
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    257   2e-77   Eucalyptus grandis [rose gum]
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    257   2e-77   Glycine max [soybeans]
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         257   2e-77   Prunus mume [ume]
ref|XP_010091504.1|  putative methyltransferase PMT2                    256   7e-77   Morus notabilis
gb|KHG27439.1|  hypothetical protein F383_15139                         256   7e-77   Gossypium arboreum [tree cotton]
emb|CBI33946.3|  unnamed protein product                                253   9e-77   Vitis vinifera
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             255   9e-77   
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    255   1e-76   Cicer arietinum [garbanzo]
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        255   2e-76   Prunus mume [ume]
gb|EPS64080.1|  hypothetical protein M569_10695                         254   2e-76   Genlisea aurea
ref|XP_010110495.1|  putative methyltransferase PMT14                   254   2e-76   Morus notabilis
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         255   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN17371.1|  Putative methyltransferase PMT2                         254   2e-76   Glycine soja [wild soybean]
ref|XP_009342549.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    252   2e-76   
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        254   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             254   2e-76   Phaseolus vulgaris [French bean]
gb|KHN01216.1|  Putative methyltransferase PMT2                         252   2e-76   Glycine soja [wild soybean]
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             254   3e-76   Phaseolus vulgaris [French bean]
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        254   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             254   4e-76   Eutrema salsugineum [saltwater cress]
emb|CDY50730.1|  BnaC05g50930D                                          251   4e-76   Brassica napus [oilseed rape]
ref|XP_008393149.1|  PREDICTED: probable methyltransferase PMT2         253   5e-76   
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        253   6e-76   Vitis vinifera
ref|XP_006578576.1|  PREDICTED: probable methyltransferase PMT2-l...    247   7e-76   
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    253   7e-76   Pyrus x bretschneideri [bai li]
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2         253   8e-76   Populus euphratica
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    253   8e-76   Glycine max [soybeans]
gb|KHN12213.1|  Putative methyltransferase PMT2                         252   9e-76   Glycine soja [wild soybean]
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        253   9e-76   Eucalyptus grandis [rose gum]
ref|XP_006663417.1|  PREDICTED: probable methyltransferase PMT2-like    243   9e-76   
ref|XP_002893375.1|  dehydration-responsive family protein              253   1e-75   
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    253   1e-75   
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             253   1e-75   Citrus clementina [clementine]
ref|NP_564265.1|  putative methyltransferase PMT2                       253   1e-75   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19504.1|  AT1G26850                                              253   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         253   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    252   2e-75   
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         252   2e-75   Tarenaya hassleriana [spider flower]
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         252   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         252   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         252   2e-75   Solanum lycopersicum
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    252   2e-75   Glycine max [soybeans]
emb|CDY16198.1|  BnaA09g29320D                                          251   3e-75   Brassica napus [oilseed rape]
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630          251   3e-75   
ref|XP_002528760.1|  ATP binding protein, putative                      251   3e-75   Ricinus communis
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        251   3e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         251   3e-75   Brassica rapa
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         251   5e-75   Nicotiana tomentosiformis
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    251   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT38682.2|  Methyltransferase family protein, putative              252   5e-75   Solanum demissum
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         251   5e-75   Nicotiana sylvestris
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             251   5e-75   Capsella rubella
gb|KHN21029.1|  Putative methyltransferase PMT14                        249   6e-75   Glycine soja [wild soybean]
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             251   6e-75   Phaseolus vulgaris [French bean]
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    251   7e-75   Solanum tuberosum [potatoes]
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         250   8e-75   Pyrus x bretschneideri [bai li]
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    250   9e-75   
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    250   1e-74   Glycine max [soybeans]
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    250   1e-74   Glycine max [soybeans]
emb|CDP12320.1|  unnamed protein product                                256   1e-74   Coffea canephora [robusta coffee]
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    250   1e-74   Citrus sinensis [apfelsine]
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        249   2e-74   Nelumbo nucifera [Indian lotus]
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         249   3e-74   
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         249   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_010441570.1|  PREDICTED: probable methyltransferase PMT14        243   3e-74   
emb|CDY40268.1|  BnaA07g09320D                                          249   3e-74   Brassica napus [oilseed rape]
emb|CDY46435.1|  BnaA08g19950D                                          248   4e-74   Brassica napus [oilseed rape]
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         248   5e-74   Phoenix dactylifera
emb|CDY45006.1|  BnaCnng12360D                                          248   5e-74   Brassica napus [oilseed rape]
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         248   5e-74   Brassica rapa
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         248   5e-74   Elaeis guineensis
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         248   6e-74   Brassica rapa
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    248   6e-74   Elaeis guineensis
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    248   6e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    248   7e-74   
emb|CDP12957.1|  unnamed protein product                                248   7e-74   Coffea canephora [robusta coffee]
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             248   8e-74   Citrus clementina [clementine]
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2         247   1e-73   Fragaria vesca subsp. vesca
emb|CAN60192.1|  hypothetical protein VITISV_038569                     247   1e-73   Vitis vinifera
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        247   2e-73   
ref|XP_008660000.1|  PREDICTED: probable methyltransferase PMT2 i...    240   3e-73   Zea mays [maize]
ref|XP_003523024.1|  PREDICTED: probable methyltransferase PMT2-l...    246   4e-73   Glycine max [soybeans]
gb|KHN21848.1|  Putative methyltransferase PMT2                         245   6e-73   Glycine soja [wild soybean]
dbj|BAH20410.1|  AT4G18030                                              240   9e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         245   1e-72   Nicotiana tomentosiformis
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         244   1e-72   Solanum lycopersicum
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             245   1e-72   
emb|CDY03207.1|  BnaC09g19490D                                          244   2e-72   
gb|KJB08228.1|  hypothetical protein B456_001G071800                    244   2e-72   Gossypium raimondii
ref|XP_007138189.1|  hypothetical protein PHAVU_009G187900g             244   2e-72   Phaseolus vulgaris [French bean]
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14        244   3e-72   Fragaria vesca subsp. vesca
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        244   3e-72   Brassica rapa
emb|CDY70748.1|  BnaCnng69650D                                          239   3e-72   Brassica napus [oilseed rape]
gb|EMS63414.1|  putative methyltransferase PMT2                         241   3e-72   Triticum urartu
gb|EAY79581.1|  hypothetical protein OsI_34717                          243   5e-72   Oryza sativa Indica Group [Indian rice]
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          243   5e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    243   6e-72   Solanum tuberosum [potatoes]
ref|NP_001065447.2|  Os10g0569300                                       243   7e-72   
gb|AAL86466.1|AC077693_5  hypothetical protein                          244   8e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         242   8e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         242   1e-71   Nicotiana sylvestris
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        242   1e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         242   1e-71   
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         242   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    241   2e-71   Oryza brachyantha
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    241   2e-71   
ref|XP_006398351.1|  hypothetical protein EUTSA_v10000856mg             239   2e-71   Eutrema salsugineum [saltwater cress]
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    241   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_004499422.1|  PREDICTED: probable methyltransferase PMT2-l...    239   3e-71   
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        241   3e-71   Solanum lycopersicum
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             241   3e-71   Eutrema salsugineum [saltwater cress]
gb|EMT05545.1|  hypothetical protein F775_20122                         241   3e-71   
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        241   4e-71   Camelina sativa [gold-of-pleasure]
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    241   4e-71   
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    241   4e-71   Setaria italica
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        241   4e-71   
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    241   5e-71   
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        241   5e-71   
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    240   6e-71   Oryza brachyantha
emb|CAA17146.1|  putative protein                                       240   7e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193537.2|  putative methyltransferase PMT14                      240   7e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KEH33485.1|  methyltransferase PMT2-like protein                     239   9e-71   Medicago truncatula
ref|NP_001050233.1|  Os03g0379100                                       239   1e-70   
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         239   1e-70   Phoenix dactylifera
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    239   1e-70   Solanum tuberosum [potatoes]
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             239   1e-70   
gb|ACF86888.1|  unknown                                                 228   1e-70   Zea mays [maize]
emb|CDY35169.1|  BnaA09g18060D                                          241   2e-70   Brassica napus [oilseed rape]
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    238   4e-70   Cicer arietinum [garbanzo]
emb|CDX78823.1|  BnaA01g08900D                                          238   4e-70   
ref|XP_002868016.1|  dehydration-responsive family protein              238   5e-70   
dbj|BAH19630.1|  AT4G18030                                              238   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        237   1e-69   Brassica rapa
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        236   2e-69   Nicotiana tomentosiformis
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        236   2e-69   Nicotiana sylvestris
gb|ACA66248.1|  putative methyltransferase                              236   2e-69   Nicotiana benthamiana
gb|ACB54686.1|  methyltransferase                                       236   3e-69   Nicotiana benthamiana
gb|EEC68449.1|  hypothetical protein OsI_36659                          235   4e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          235   5e-69   Sorghum bicolor [broomcorn]
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         235   6e-69   Brachypodium distachyon [annual false brome]
gb|ACN26954.1|  unknown                                                 228   6e-69   Zea mays [maize]
gb|EEE52366.1|  hypothetical protein OsJ_34430                          235   6e-69   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85549.1|  predicted protein                                      235   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001068227.1|  Os11g0601600                                       234   2e-68   
gb|EAZ09099.1|  hypothetical protein OsI_31366                          234   2e-68   Oryza sativa Indica Group [Indian rice]
ref|NP_001152056.1|  methyltransferase                                  234   3e-68   Zea mays [maize]
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       233   3e-68   
gb|EMS49438.1|  putative methyltransferase PMT2                         233   3e-68   Triticum urartu
gb|EMT27426.1|  hypothetical protein F775_29617                         233   3e-68   
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         233   4e-68   Zea mays [maize]
tpg|DAA46388.1|  TPA: hypothetical protein ZEAMMB73_857191              233   4e-68   
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         233   5e-68   Brachypodium distachyon [annual false brome]
ref|XP_008668148.1|  PREDICTED: methyltransferase isoform X1            233   5e-68   
emb|CAH18000.1|  Ankyrin protein kinase-like                            233   5e-68   Poa pratensis
ref|NP_001063174.1|  Os09g0415700                                       233   5e-68   
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         232   7e-68   Brachypodium distachyon [annual false brome]
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    231   1e-67   Setaria italica
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          230   4e-67   Sorghum bicolor [broomcorn]
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14-...    229   9e-67   Cucumis sativus [cucumbers]
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          235   3e-66   Medicago truncatula
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        228   3e-66   Cucumis melo [Oriental melon]
gb|EMS46508.1|  putative methyltransferase PMT2                         226   3e-66   Triticum urartu
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    228   3e-66   
ref|NP_001152470.1|  ankyrin protein kinase-like                        228   4e-66   
gb|AEX55231.1|  putative cold-regulated protein                         219   5e-66   Allium sativum
gb|EMS59423.1|  putative methyltransferase PMT2                         226   2e-65   Triticum urartu
ref|XP_004979626.1|  PREDICTED: probable methyltransferase PMT2-like    225   5e-65   Setaria italica
gb|KJB08229.1|  hypothetical protein B456_001G071800                    224   9e-65   Gossypium raimondii
ref|NP_001056669.2|  Os06g0128100                                       213   9e-65   
ref|XP_008392677.1|  PREDICTED: probable methyltransferase PMT18        210   2e-64   
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    223   2e-64   Oryza brachyantha
emb|CDY70936.1|  BnaAnng35600D                                          209   1e-63   Brassica napus [oilseed rape]
gb|AAM67038.1|  unknown                                                 207   1e-63   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001170352.1|  uncharacterized protein LOC100384329               209   1e-63   
gb|ABR16934.1|  unknown                                                 219   6e-63   Picea sitchensis
ref|XP_001778231.1|  predicted protein                                  218   1e-62   
ref|XP_010110847.1|  putative methyltransferase PMT18                   207   2e-62   
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        218   2e-62   Cucumis melo [Oriental melon]
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        218   3e-62   Phoenix dactylifera
ref|XP_004169220.1|  PREDICTED: probable methyltransferase PMT18-...    218   3e-62   
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18-...    218   3e-62   Cucumis sativus [cucumbers]
ref|XP_001779831.1|  predicted protein                                  217   4e-62   
gb|EPS60507.1|  hypothetical protein M569_14296                         216   7e-62   Genlisea aurea
emb|CDX94256.1|  BnaC02g29160D                                          216   7e-62   
ref|XP_006656589.1|  PREDICTED: probable methyltransferase PMT15-...    214   1e-61   
emb|CDP12267.1|  unnamed protein product                                215   2e-61   Coffea canephora [robusta coffee]
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        215   2e-61   Phoenix dactylifera
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        215   3e-61   Elaeis guineensis
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             214   3e-61   Selaginella moellendorffii
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             214   3e-61   
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        214   4e-61   Nelumbo nucifera [Indian lotus]
gb|EAZ35683.1|  hypothetical protein OsJ_19971                          214   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    214   4e-61   Phoenix dactylifera
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        214   5e-61   Brassica rapa
ref|NP_001047721.1|  Os02g0675700                                       214   5e-61   
gb|EEC73773.1|  hypothetical protein OsI_08448                          214   6e-61   Oryza sativa Indica Group [Indian rice]
gb|ABK94953.1|  unknown                                                 210   6e-61   Populus trichocarpa [western balsam poplar]
gb|KDP25187.1|  hypothetical protein JCGZ_20343                         214   7e-61   Jatropha curcas
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    214   7e-61   Phoenix dactylifera
gb|KJB18847.1|  hypothetical protein B456_003G072700                    208   7e-61   Gossypium raimondii
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        214   8e-61   Brachypodium distachyon [annual false brome]
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    214   9e-61   
dbj|BAC24840.1|  dehydration-responsive protein-like                    213   9e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    213   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    214   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    213   1e-60   Tarenaya hassleriana [spider flower]
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    214   1e-60   
gb|ACN28194.1|  unknown                                                 203   1e-60   
dbj|BAJ95401.1|  predicted protein                                      213   2e-60   
dbj|BAJ87212.1|  predicted protein                                      213   2e-60   
dbj|BAJ84848.1|  predicted protein                                      213   2e-60   
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        213   2e-60   
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    214   2e-60   
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    214   2e-60   
gb|KHN15675.1|  Putative methyltransferase PMT16                        208   2e-60   
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        212   2e-60   
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        213   2e-60   
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    213   3e-60   
emb|CBI34642.3|  unnamed protein product                                211   3e-60   
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    213   3e-60   
emb|CDX84046.1|  BnaC08g07230D                                          212   3e-60   
emb|CDY44966.1|  BnaA08g06660D                                          212   3e-60   
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        212   3e-60   
gb|KHM99141.1|  Putative methyltransferase PMT15                        207   4e-60   
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        212   4e-60   
emb|CDX93797.1|  BnaA09g23970D                                          209   4e-60   
ref|XP_002298987.1|  dehydration-responsive family protein              209   5e-60   
gb|EEE61530.1|  hypothetical protein OsJ_15834                          209   5e-60   
emb|CDX85977.1|  BnaC06g21570D                                          209   5e-60   
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        211   5e-60   
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    211   5e-60   
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        211   6e-60   
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        211   7e-60   
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        211   7e-60   
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             211   8e-60   
ref|XP_002874627.1|  dehydration-responsive family protein              211   9e-60   
ref|XP_002518966.1|  ATP binding protein, putative                      211   1e-59   
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    211   1e-59   
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    210   1e-59   
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    211   1e-59   
ref|NP_192782.1|  putative methyltransferase PMT17                      211   1e-59   
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    211   1e-59   
gb|KFK45055.1|  hypothetical protein AALP_AA1G338100                    210   1e-59   
gb|KEH17379.1|  methyltransferase PMT16, putative                       210   1e-59   
ref|NP_001053603.1|  Os04g0570800                                       210   2e-59   
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   210   2e-59   
dbj|BAJ98046.1|  predicted protein                                      210   2e-59   
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    209   2e-59   
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        210   2e-59   
ref|XP_006846537.1|  hypothetical protein AMTR_s00018p00198280          210   2e-59   
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        210   2e-59   
gb|KJB18849.1|  hypothetical protein B456_003G072700                    207   2e-59   
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg             210   3e-59   
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        209   3e-59   
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        209   3e-59   
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        209   4e-59   
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        209   4e-59   
gb|EMT22301.1|  hypothetical protein F775_16518                         209   4e-59   
emb|CDX99539.1|  BnaC09g24530D                                          209   4e-59   
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    209   4e-59   
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    209   4e-59   
gb|EEC67295.1|  hypothetical protein OsI_34283                          209   4e-59   
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                209   5e-59   
ref|NP_001065036.1|  Os10g0510400                                       209   5e-59   
gb|AAL24268.1|  AT4g00750/F15P23_1                                      196   5e-59   
gb|AAX94055.2|  dehydration-induced protein                             209   5e-59   
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    209   6e-59   
ref|XP_010662513.1|  PREDICTED: probable methyltransferase PMT15 ...    203   6e-59   
ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        209   6e-59   
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                209   6e-59   
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             209   6e-59   
dbj|BAK03905.1|  predicted protein                                      209   6e-59   
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        209   6e-59   
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        208   7e-59   
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    209   7e-59   
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             209   7e-59   
gb|KJB18848.1|  hypothetical protein B456_003G072700                    208   8e-59   
ref|NP_564419.1|  putative methyltransferase PMT18                      208   8e-59   
gb|AAF97349.1|AC021045_6  Unknown Protein                               209   9e-59   
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    207   9e-59   
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    208   9e-59   
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             208   9e-59   
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             208   1e-58   
ref|XP_002317647.1|  dehydration-responsive family protein              208   1e-58   
gb|EMS54302.1|  putative methyltransferase PMT17                        208   1e-58   
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        207   1e-58   
ref|NP_001056546.2|  Os06g0103900                                       208   1e-58   
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        208   1e-58   
gb|EEC79826.1|  hypothetical protein OsI_21282                          208   1e-58   
gb|KJB18860.1|  hypothetical protein B456_003G072700                    208   1e-58   
ref|XP_002891032.1|  dehydration-responsive family protein              208   1e-58   
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             208   1e-58   
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        208   2e-58   
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    207   2e-58   
ref|NP_001141030.1|  uncharacterized protein LOC100273109               201   2e-58   
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          207   2e-58   
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        207   2e-58   
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        207   2e-58   
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        207   2e-58   
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    207   2e-58   
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        207   2e-58   
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    207   2e-58   
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    207   2e-58   
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        207   2e-58   
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18        207   3e-58   
gb|AFW72783.1|  hypothetical protein ZEAMMB73_970285                    201   3e-58   
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    207   3e-58   
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              207   4e-58   
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    206   5e-58   
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        206   5e-58   
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             206   5e-58   
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        206   5e-58   
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    206   5e-58   
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        206   5e-58   
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        206   7e-58   
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        206   7e-58   
ref|XP_008800812.1|  PREDICTED: probable methyltransferase PMT15        208   8e-58   
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    206   8e-58   
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          205   8e-58   
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        206   8e-58   
ref|NP_001147806.1|  methyltransferase                                  205   9e-58   
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             206   1e-57   
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        205   1e-57   
emb|CDM86771.1|  unnamed protein product                                205   1e-57   
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  205   1e-57   
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        205   1e-57   
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    205   1e-57   
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        205   1e-57   
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    205   1e-57   
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    204   2e-57   
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    205   2e-57   
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    204   2e-57   
gb|KJB24074.1|  hypothetical protein B456_004G127200                    204   2e-57   
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        204   2e-57   
gb|KHN16709.1|  Putative methyltransferase PMT18                        204   2e-57   
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        204   2e-57   
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    204   2e-57   
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        204   2e-57   
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        204   2e-57   
ref|XP_010255519.1|  PREDICTED: probable methyltransferase PMT15 ...    200   3e-57   
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     204   3e-57   
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        204   3e-57   
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    204   3e-57   
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        204   3e-57   
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        204   3e-57   
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        204   4e-57   
ref|XP_002510829.1|  ATP binding protein, putative                      204   4e-57   
gb|KHM99867.1|  Putative methyltransferase PMT18                        202   5e-57   
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        203   5e-57   
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        204   6e-57   
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    203   6e-57   
ref|XP_002511797.1|  ATP binding protein, putative                      203   7e-57   
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             203   7e-57   
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    203   8e-57   
gb|KHG13750.1|  hypothetical protein F383_08462                         203   9e-57   
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    202   9e-57   
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        202   1e-56   
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        202   1e-56   
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                200   1e-56   
gb|EPS61626.1|  hypothetical protein M569_13168                         197   1e-56   
ref|XP_006857883.1|  hypothetical protein AMTR_s00069p00110310          202   1e-56   
emb|CDP05238.1|  unnamed protein product                                202   1e-56   
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        202   2e-56   
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        202   2e-56   
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        202   2e-56   
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    202   2e-56   
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    202   2e-56   
gb|KDP22318.1|  hypothetical protein JCGZ_26149                         202   2e-56   
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        202   2e-56   
ref|XP_010470192.1|  PREDICTED: probable methyltransferase PMT17        199   3e-56   
gb|EPS68701.1|  hypothetical protein M569_06064                         201   3e-56   
ref|NP_001148962.1|  ankyrin protein kinase-like                        201   3e-56   
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        201   3e-56   
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             201   3e-56   
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        201   3e-56   
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    201   3e-56   
ref|XP_001782639.1|  predicted protein                                  201   4e-56   
gb|KGN56550.1|  hypothetical protein Csa_3G123720                       196   4e-56   
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        201   4e-56   
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          201   5e-56   
gb|KHG11272.1|  hypothetical protein F383_13094                         195   5e-56   
gb|ACF85761.1|  unknown                                                 191   6e-56   
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             200   7e-56   
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             200   9e-56   
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        200   9e-56   
emb|CDY01971.1|  BnaC02g27560D                                          196   9e-56   
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16        200   1e-55   
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             199   1e-55   
ref|XP_001760613.1|  predicted protein                                  199   1e-55   
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        199   2e-55   
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    199   2e-55   
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             199   2e-55   
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        199   2e-55   
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   199   2e-55   
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             199   2e-55   
emb|CDP08881.1|  unnamed protein product                                199   2e-55   
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        199   2e-55   
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    199   2e-55   
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        199   2e-55   
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        199   2e-55   
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             199   2e-55   
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        198   2e-55   
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             199   3e-55   
emb|CAN66742.1|  hypothetical protein VITISV_009259                     186   3e-55   
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        199   3e-55   
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        199   3e-55   
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             198   3e-55   
ref|NP_191984.1|  putative methyltransferase PMT15                      198   3e-55   
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    198   4e-55   
gb|KJB09867.1|  hypothetical protein B456_001G171500                    198   4e-55   
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    198   5e-55   
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549             198   5e-55   
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    198   5e-55   
ref|XP_002875017.1|  dehydration-responsive family protein              198   6e-55   
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        198   6e-55   
gb|ABR16582.1|  unknown                                                 198   6e-55   
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        197   7e-55   
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        197   8e-55   
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    197   9e-55   
gb|KDP28686.1|  hypothetical protein JCGZ_14457                         197   9e-55   
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    197   1e-54   
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  197   1e-54   
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    197   1e-54   
gb|KEH21299.1|  methyltransferase PMT16, putative                       197   2e-54   
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15        196   2e-54   
ref|XP_007139953.1|  hypothetical protein PHAVU_008G072500g             192   2e-54   
gb|KHN04623.1|  Putative methyltransferase PMT15                        192   3e-54   



>gb|ABO93008.1| putative methyltransferase [Solanum tuberosum]
Length=509

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L +PK WVMNV+PTIA+K+TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  356  NIMDMNAGLGGFAAALHNPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTYPR  415

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW++
Sbjct  416  TYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRWNF  475

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  476  KLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  509



>ref|XP_004238796.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
 ref|XP_010320682.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L  PK WVMNV+PTIA+K+TLGV++ RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGGFAAALHDPKFWVMNVMPTIAEKNTLGVVFERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKDKCDF+DILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW++
Sbjct  519  TYDLIHANGLFSLYKDKCDFQDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRWNF  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  579  KLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>gb|ABO92980.1| putative methyltransferase [Solanum tuberosum]
Length=612

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++I+GGMRW++
Sbjct  519  TYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIMGGMRWNF  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  579  KLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>ref|XP_006366112.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366113.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
Length=612

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L +PK WVMNV+PTIA+K+TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGGFAAALHNPKFWVMNVMPTIAEKNTLGVIFERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD VD LIKV++IIGGMRW++
Sbjct  519  TYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDNVDVLIKVKKIIGGMRWNF  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  579  KLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  612



>ref|XP_002522425.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF39917.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   276 bits (705),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGGFAAALQSPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+KCDFEDILLEMDRILRPEGAV+FRDEVD LIKVR+I+ GMRWD 
Sbjct  520  TYDLIHANGVFSLYKEKCDFEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIVAGMRWDT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW +   NSTSAQ
Sbjct  580  KMVDHEDGPLVPEKILVAVKQYW-VTGGNSTSAQ  612



>ref|XP_006366703.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366704.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006366705.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006366706.1| PREDICTED: probable methyltransferase PMT2-like isoform X4 [Solanum 
tuberosum]
Length=612

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMN+GLGGFAA L SPK WVMNV+PTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNSGLGGFAAALQSPKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKD+CDFEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMRWD+
Sbjct  519  TYDLIHANGLFSLYKDRCDFEDILLEMDRILRPEGAVILRDDVDVLIKVKKIIGGMRWDF  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVP KILVAVK+YWT+ D NSTS +
Sbjct  579  KLMDHEDGPLVPVKILVAVKQYWTVEDNNSTSTR  612



>gb|KDP41191.1| hypothetical protein JCGZ_15598 [Jatropha curcas]
Length=617

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIADKSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+I+GGMRWD 
Sbjct  525  TYDLIHANGVFSLYKDKCNTEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIVGGMRWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW + D NSTS++
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYW-VADGNSTSSE  617



>ref|XP_009761475.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=611

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RDEVD LIKV++IIGGMRW++
Sbjct  520  TYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDEVDVLIKVKKIIGGMRWNF  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KLMDHEDGPLVPEKILVAVK+YWTLN T S+ 
Sbjct  580  KLMDHEDGPLVPEKILVAVKQYWTLNSTTSSQ  611



>emb|CBI31965.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  361  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWCEAFSTYPR  420

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKCD EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  421  TYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  480

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLV EKILVAVK+YW ++  NSTS+Q
Sbjct  481  KLVDHEDGPLVSEKILVAVKQYWVVSAENSTSSQ  514



>ref|XP_009793104.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=613

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGGFAAALHSPKMWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMRWD+
Sbjct  520  TYDLIHAHGLFSLYKDKCDFEDILLEMDRILRPEGAVIMRDDVDVLIKVKKIIGGMRWDF  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            KLMDHED PLVPEKILVAVKKYWT+ D N+T
Sbjct  580  KLMDHEDAPLVPEKILVAVKKYWTVGDNNTT  610



>ref|XP_009624681.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=611

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD+VD LIKV++IIGGMRW++
Sbjct  520  TYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDDVDVLIKVKKIIGGMRWNF  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KLMDHEDGPLVPEKILVAVK+YWTLN T S+ 
Sbjct  580  KLMDHEDGPLVPEKILVAVKQYWTLNSTTSSQ  611



>gb|KHN06856.1| Putative methyltransferase PMT2 [Glycine soja]
Length=221

 Score =   261 bits (666),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  71   NIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCEAFSTYPR  130

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKC  EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  131  TYDLIHAHGVFSLYKDKCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  190

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  191  KMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  221



>ref|XP_011071001.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=612

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L SPK WVMNVVPTIADK+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGFGGFAAALQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAV+FRDEVD L+KV+++IGGMRWD 
Sbjct  522  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVIFRDEVDVLVKVKKMIGGMRWDS  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K+MDHEDGPLVPEKILV VK+YW  N T+S
Sbjct  582  KMMDHEDGPLVPEKILVVVKQYWVGNSTSS  611



>gb|EYU28744.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
 gb|EYU28745.1| hypothetical protein MIMGU_mgv1a003087mg [Erythranthe guttata]
Length=609

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGGFAAALHSPKFWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAV+FRDEVD L+KVR+IIGGM+WD 
Sbjct  519  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVIFRDEVDVLVKVRKIIGGMKWDS  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+MDHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  579  KMMDHEDGPLVPEKILVAVKQYWV---GNSTSPQ  609



>ref|XP_002273644.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=618

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGAVYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKCD EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  525  TYDLIHAHGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLV EKILVAVK+YW ++  NSTS+Q
Sbjct  585  KLVDHEDGPLVSEKILVAVKQYWVVSAENSTSSQ  618



>ref|XP_004297305.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGF AQLTSPK WVMNVVPTIA+K+TLGVIY RGMIGIYHDWCEGFSTYPR
Sbjct  458  NVMDMNAGLGGFGAQLTSPKLWVMNVVPTIAEKNTLGVIYERGMIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKVR+I+GGMRWD 
Sbjct  518  TYDLIHANGIFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVRKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEKILVAVK+YW  N T++
Sbjct  578  KMVDHEDGPLVPEKILVAVKQYWVGNSTST  607



>ref|XP_010089758.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB38334.1| putative methyltransferase PMT2 [Morus notabilis]
Length=611

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 141/154 (92%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVIY RG++GIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGGFAAALHSPKLWVMNVMPTIAEKNTLGVIYERGLVGIYHDWCEPFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVDTL+KV++IIGGMRWD 
Sbjct  519  TYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDTLVKVKKIIGGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW   D NSTS Q
Sbjct  579  KMVDHEDGPLVPEKILVAVKQYWAA-DGNSTSTQ  611



>emb|CDP00327.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   270 bits (690),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD VD L KV++I+ G+RWD+
Sbjct  523  TYDLIHANGLFSLYKDKCDFEDILLEMDRILRPEGAVIIRDAVDVLNKVQKIVRGIRWDF  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL DHEDGPLVPEKIL+AVKKYW   + NSTS +
Sbjct  583  KLTDHEDGPLVPEKILIAVKKYWVAGENNSTSTE  616



>ref|XP_002311593.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
 gb|EEE88960.1| hypothetical protein POPTR_0008s14720g [Populus trichocarpa]
Length=615

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCESFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+DKCD EDILLEMDRILRPEGAV+FRDEVD L+KVR+++GGM+WD 
Sbjct  525  TYDLIHASGVFSLYRDKCDMEDILLEMDRILRPEGAVIFRDEVDVLVKVRKMVGGMKWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>ref|XP_003628359.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
Length=402

 Score =   263 bits (672),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  250  NIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  309

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMRW+ 
Sbjct  310  TYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMRWNM  369

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  370  KLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  402



>ref|XP_004228376.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMN+GLGGFAA L SPK WVMNV+PTIA K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNSGLGGFAAALQSPKLWVMNVMPTIAKKNTLGVIYERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD++D LIKV++IIGG+RWD 
Sbjct  519  TYDLIHAHGLFSLYKDKCNFEDILLEMDRILRPEGAVILRDDIDVLIKVKKIIGGIRWDS  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEKILVAVK+YWT+ D NSTS +
Sbjct  579  KLIDHEDGPLVPEKILVAVKQYWTVGDDNSTSTR  612



>ref|XP_011025778.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011025787.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA++STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAERSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+DKCD EDILLEMDRILRPEGAV+FRDEVD L+KVR+++GGM+WD 
Sbjct  525  TYDLIHASGVFSLYRDKCDMEDILLEMDRILRPEGAVIFRDEVDVLVKVRKMVGGMKWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>gb|EYU22421.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=611

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 138/154 (90%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  461  NIMDMNAGLGGFAAALQSPKLWVMNVVPTIAKKNTLGVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY DKC+FEDILLEMDRILRPEGAV+FRDEVD L+KV++IIGGMRWD 
Sbjct  521  TYDLIHANGVFSLYNDKCNFEDILLEMDRILRPEGAVIFRDEVDVLVKVKKIIGGMRWDS  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILV VK+YW     NSTS Q
Sbjct  581  KMIDHEDGPLVPEKILVVVKQYWV---GNSTSEQ  611



>ref|XP_009626042.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=613

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L S K WVMNV+PTI +K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGGFAAALHSSKMWVMNVMPTITEKNTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKCDFEDILLEMDRILRPEGAV+ RD+V+ LIKV++IIGGMRWD+
Sbjct  520  TYDLIHAHGLFSLYKDKCDFEDILLEMDRILRPEGAVIMRDDVEVLIKVKKIIGGMRWDF  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            KLMDHEDGPLVPEK++VAVKKYWT+ D NST
Sbjct  580  KLMDHEDGPLVPEKVVVAVKKYWTVGDYNST  610



>ref|XP_011027055.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=615

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 140/154 (91%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA++STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAERSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+DKCD EDILLEMDR+LRPEGAV+FRDEVD L+KVR+++GGM+WD 
Sbjct  525  TYDLIHASGVFSLYRDKCDMEDILLEMDRLLRPEGAVIFRDEVDVLVKVRKMVGGMKWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  615



>ref|XP_010258374.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
 ref|XP_010258376.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=617

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA + SPK WVMNVVPTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NMMDMNAGLGSFAAAIESPKLWVMNVVPTIAEKKTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKV+RII GM+W+ 
Sbjct  524  TYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDDVDVLIKVKRIIAGMKWNT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLVPEKILVAVK+YWT+ + NSTS+
Sbjct  584  KMVDHEDGPLVPEKILVAVKQYWTVGENNSTSS  616



>ref|XP_003628358.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
Length=507

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  355  NIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  414

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMRW+ 
Sbjct  415  TYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMRWNM  474

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  475  KLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  507



>ref|XP_007222021.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
 gb|EMJ23220.1| hypothetical protein PRUPE_ppa002971mg [Prunus persica]
Length=616

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  464  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY  KCD+EDIL+EMDRILRPEGAVVFRDEVD LIKV++I+GGMRWD 
Sbjct  524  TYDLIHAHGVFSLYDGKCDWEDILIEMDRILRPEGAVVFRDEVDVLIKVKKIVGGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L+AVK+YW     NSTS Q
Sbjct  584  KMVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSTQ  616



>ref|XP_008221626.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
 ref|XP_008221627.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=616

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  464  NIMDMNAGLGGFAAALESPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLY  KCD+EDIL+EMDRILRPEGAVVFRDEVD LIKV++I+GGMRWD 
Sbjct  524  TYDLIHAHGIFSLYDGKCDWEDILIEMDRILRPEGAVVFRDEVDVLIKVKKIVGGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW     NSTS Q
Sbjct  584  KMVDHEDGPLVPEKVLVAVKQYWVAGG-NSTSTQ  616



>gb|KDO43766.1| hypothetical protein CISIN_1g026623mg [Citrus sinensis]
Length=235

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT A K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  84   NVMDMNAGLGGFAAALESPKSWVMNVVPTTA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  142

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD L KVR+   GMRWD 
Sbjct  143  TYDLIHANGVFSLYENTCKPEDILLEMDRILRPEGAVIFRDEVDALNKVRKFAEGMRWDT  202

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPL+PEKIL+AVK+YW  +  NSTS
Sbjct  203  KMMDHEDGPLMPEKILIAVKQYWVGSAGNSTS  234



>gb|KDO82912.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=334

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPT+ADK+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  183  NIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFSTYPR  242

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMRWD 
Sbjct  243  TYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDT  302

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLVPEKILVAVK+YW  +  NSTS+
Sbjct  303  KMVDHEDGPLVPEKILVAVKQYWVAS-GNSTSS  334



>ref|XP_002511570.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52172.1| ATP binding protein, putative [Ricinus communis]
Length=613

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAG+GGFAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NVMDMNAGMGGFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEG V+ RD+VD LIKV+RI+GGMRW+ 
Sbjct  520  TYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGTVILRDQVDVLIKVKRIVGGMRWNT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLVPEK+L AVK+YW   D NSTS+
Sbjct  580  KMVDHEDGPLVPEKVLFAVKRYWVAGDNNSTSS  612



>ref|XP_010066916.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 ref|XP_010066917.1| PREDICTED: probable methyltransferase PMT2 [Eucalyptus grandis]
 gb|KCW64965.1| hypothetical protein EUGRSUZ_G02508 [Eucalyptus grandis]
Length=615

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA LGGFAA + SPK W MNVVPTIADKSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNARLGGFAAAIESPKLWTMNVVPTIADKSTLGVIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY DKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++I+GGMRWD 
Sbjct  523  TYDLIHANGVFSLYNDKCDAEDILLEMDRILRPEGAVIIRDEVDVLIKVKKIVGGMRWDT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+MDHEDGPLVPEKILVAVK+YW     NSTS+ 
Sbjct  583  KMMDHEDGPLVPEKILVAVKQYWVAGG-NSTSSH  615



>ref|XP_003613748.1| hypothetical protein MTR_5g040360 [Medicago truncatula]
 gb|AES96706.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=609

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+K TLG IY RG+IGIYHDWCE FSTYPR
Sbjct  457  NIMDMNAGLGSFAAAIQSPKLWVMNVVPTIAEKHTLGAIYQRGLIGIYHDWCEAFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+NG+FSLYKDKC+ E+IL+EMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  517  TYDLIHSNGLFSLYKDKCNIENILMEMDRILRPEGAVIFRDEVDILIKVKKIVGGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEKIL+AVK+YW + DTN+TS Q
Sbjct  577  KLVDHEDGPLVPEKILIAVKQYW-VADTNTTSTQ  609



>ref|XP_004160003.1| PREDICTED: probable methyltransferase PMT2-like [Cucumis sativus]
Length=452

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIA+K+TLG I+ RG+IGIYHDWCE FSTYPR
Sbjct  300  NIMDMNAGLGSFAAALESSKLWVMNVVPTIAEKNTLGAIFERGLIGIYHDWCEAFSTYPR  359

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAVVFRDEVD L+KV+++IGGMRWD 
Sbjct  360  TYDLIHAHGLFSLYKDKCNMEDILLEMDRILRPEGAVVFRDEVDVLVKVKKMIGGMRWDA  419

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEK+L+AVK+YW +   NSTS
Sbjct  420  KMVDHEDGPLVPEKVLIAVKQYWVVGGNNSTS  451



>ref|XP_004490044.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004490045.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=608

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  457  NIMDMNAGLGSFAAAIQSPKLWVMNVVPTIAEKNTLGVIYQRGLIGIYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++G+FSLY+DKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  517  TYDLIHSHGLFSLYEDKCNIEDILLEMDRILRPEGAVIFRDEVDILIKVKKIVGGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKIL+AVK+YW + DTN+TS
Sbjct  577  KMVDHEDGPLVPEKILIAVKQYW-VADTNATS  607



>ref|NP_001280936.1| uncharacterized protein LOC103402903 [Malus domestica]
 gb|AAF27920.1|AF220204_1 unknown [Malus domestica]
Length=608

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNV+PTIA+K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  458  NIMDMNAGLGGFAAAIESPKLWVMNVMPTIAEKNTLGVVYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFS+Y  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  518  TYDLIHAHGVFSMYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+LVAVK+YW     NSTSAQ
Sbjct  578  KLVDHEDGPLVPEKVLVAVKQYWV---GNSTSAQ  608



>ref|XP_010683197.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683199.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683200.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010683201.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=610

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + S K WVMNV+PTIA+K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  457  NIMDMNAGLGGFAAAIHSSKLWVMNVMPTIAEKNTLGVIYERGLIGIYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYK+KC+ EDILLEMDRILRPEGAV+ RDEVD L+KV++I+ GMRWD 
Sbjct  517  TYDLIHANGIFSLYKNKCNLEDILLEMDRILRPEGAVIIRDEVDVLVKVKKIVAGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            +++DHEDGPLVPEKILVAVK+YWT++  N TS+Q
Sbjct  577  RMVDHEDGPLVPEKILVAVKQYWTVDGGNVTSSQ  610



>gb|ACJ85858.1| unknown [Medicago truncatula]
Length=610

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  458  NIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMRW+ 
Sbjct  518  TYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMRWNM  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  578  KLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  610



>ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
 gb|AET02833.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=610

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  458  NIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++IGGMRW+ 
Sbjct  518  TYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLIGGMRWNM  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW + D NSTS Q
Sbjct  578  KLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTQ  610



>ref|XP_007039581.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY24082.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=612

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT+A K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NMMDMNAGLGGFAASLESPKSWVMNVVPTVA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY++KC+FEDILLEMDRILRPEGAV+FRD+VD L KVR+I GGMRW+ 
Sbjct  518  TYDFIHANGVFSLYQNKCNFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPLVPEKILVAVK+YW  +  NSTS
Sbjct  578  KMMDHEDGPLVPEKILVAVKQYWVGSSGNSTS  609



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKITAGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YWT+   N+TSAQ
Sbjct  584  KMVDHEDGPLVPEKVLVAVKQYWTVGG-NTTSAQ  616



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGGFAAALNSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKITAGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YWT+   N+TSAQ
Sbjct  584  KMVDHEDGPLVPEKVLVAVKQYWTVGG-NTTSAQ  616



>ref|XP_008339908.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=608

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNV+PTIA+K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  458  NIMDMNAGLGGFAAAIESPKLWVMNVMPTIAEKNTLGVVYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFS Y  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  518  TYDLIHAHGVFSXYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+LVAVK+YW     NSTSAQ
Sbjct  578  KLVDHEDGPLVPEKVLVAVKQYWV---GNSTSAQ  608



>gb|EPS59468.1| hypothetical protein M569_15338, partial [Genlisea aurea]
Length=611

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L SPK WVMNVVPTIA+++TLG IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAASLESPKSWVMNVVPTIAEENTLGAIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN V++LYKD+C+FEDILLEMDRILRPEGAVVFRDEVD L+KV+R+IGGMRWD 
Sbjct  523  TYDLIHANRVYTLYKDRCNFEDILLEMDRILRPEGAVVFRDEVDALVKVKRMIGGMRWDS  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDT  281
            K+MDHEDGPL+PEKILVAVK+YW + ++
Sbjct  583  KMMDHEDGPLIPEKILVAVKQYWVVGNS  610



>ref|XP_008373610.1| PREDICTED: probable methyltransferase PMT14 [Malus domestica]
Length=325

 Score =   253 bits (647),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  172  NVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  230

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            +YDLIHA+GVF+LYK++C  EDILLEMDRILRPEG V+FRDEVD L KVR+I+GGMRWD 
Sbjct  231  SYDLIHASGVFTLYKNECKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDT  290

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  291  KIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  322



>ref|XP_010257294.1| PREDICTED: probable methyltransferase PMT2 [Nelumbo nucifera]
Length=615

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTI++K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESPKLWVMNVVPTISEKNTLGVIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+KC  EDILLEMDRILRPEGAV+FRD+VD LIKV++I GG+RW+ 
Sbjct  522  TYDLIHANGVFSLYKNKCKAEDILLEMDRILRPEGAVIFRDDVDVLIKVKKIAGGIRWNT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW +   NSTS++
Sbjct  582  KMVDHEDGPLVPEKILVAVKQYWVVGGDNSTSSE  615



>ref|XP_011075499.1| PREDICTED: probable methyltransferase PMT2 [Sesamum indicum]
Length=613

 Score =   261 bits (667),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAALQSPKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA  VFSLYKDKCD EDILLEMDRILRPEGA++ RDEVD L+KV+++IGGMR+D+
Sbjct  523  TYDLIHAYRVFSLYKDKCDLEDILLEMDRILRPEGAIMLRDEVDVLVKVKKMIGGMRYDF  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+MDHEDGPLVPEKILVAVK+YW     NSTSAQ
Sbjct  583  KMMDHEDGPLVPEKILVAVKQYWV---GNSTSAQ  613



>emb|CBI15236.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   258 bits (660),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  359  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  418

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C  EDILLEMDRILRPEGAV+FRD++D LIKV++I+GGMRW+ 
Sbjct  419  TYDLIHANGVFSLYKNSCSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKIVGGMRWNT  478

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  479  KLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  511



>ref|XP_006438677.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
 ref|XP_006483161.1| PREDICTED: probable methyltransferase PMT2-like [Citrus sinensis]
 gb|ESR51917.1| hypothetical protein CICLE_v10030989mg [Citrus clementina]
Length=610

 Score =   261 bits (666),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTIADK+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGFGGFAAAIQSPKLWVMNVVPTIADKNTLGVIYERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMRWD 
Sbjct  519  TYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLVPEKILVAVK+YW  +  NSTS+
Sbjct  579  KMVDHEDGPLVPEKILVAVKQYWVASG-NSTSS  610



>ref|XP_002315803.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
 gb|EEF01974.2| hypothetical protein POPTR_0010s10420g [Populus trichocarpa]
Length=617

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKD+C+ EDILLEMDRILRPEGAV+FRDEV+ LIKVR+++G MRW  
Sbjct  525  TYDLIHASGVFSLYKDRCNMEDILLEMDRILRPEGAVIFRDEVNVLIKVRKMVGQMRWHT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW     NSTS Q
Sbjct  585  KMVDHEDGPLVPEKVLVAVKQYWVAGG-NSTSTQ  617



>ref|XP_008389474.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=606

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  456  NIMDMNAGLGGFAAAIESPKLWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEGFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  516  TYDLIHAHGVFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEK+LV VK+YW  N T++
Sbjct  576  KMVDHEDGPLVPEKVLVVVKQYWVGNSTDT  605



>ref|XP_002317981.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
 gb|EEE96201.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
Length=610

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA L SPK WVMNV+PTI ++ TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  457  NIMDMNAGMGGFAAALESPKLWVMNVMPTINERDTLGVIYERGLIGIYHDWCEAFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKVRRI+GGMRW+ 
Sbjct  517  TYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDKVDVLIKVRRIVGGMRWNA  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL  EK+L  VK+YW   + NSTS+Q
Sbjct  577  KMVDHEDGPLPSEKVLFTVKQYWVAGENNSTSSQ  610



>ref|XP_009360348.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=606

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  456  NIMDMNAGLGGFAAAIESPKLWVMNVVPTIAEKNTLGVVYERGLIGIYHDWCEGFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY  KC++EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  516  TYDLIHAHGVFSLYNGKCNWEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEK+LV VK+YW  N T++
Sbjct  576  KMVDHEDGPLVPEKVLVVVKQYWVGNSTDT  605



>ref|XP_003532062.1| PREDICTED: probable methyltransferase PMT2-like isoformX1 [Glycine 
max]
 ref|XP_003532063.1| PREDICTED: probable methyltransferase PMT2-like isoformX2 [Glycine 
max]
Length=608

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAEANTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKC  EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  518  TYDLIHAHGVFSLYKDKCKAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  578  KMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>gb|KHG23981.1| hypothetical protein F383_09020 [Gossypium arboreum]
Length=616

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKITAGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW +   NSTS Q
Sbjct  584  KMVDHEDGPLVPEKILVAVKRYWVVG-ANSTSVQ  616



>gb|KJB80180.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
 gb|KJB80181.1| hypothetical protein B456_013G084900 [Gossypium raimondii]
Length=616

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLGGFAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGGFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNLEDILLEMDRILRPEGAVIFRDEVDVLIKVKKITAGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW +   NSTS Q
Sbjct  584  KMVDHEDGPLVPEKILVAVKRYWVVG-ANSTSVQ  616



>ref|XP_004138921.1| PREDICTED: probable methyltransferase PMT2-like [Cucumis sativus]
 gb|KGN61383.1| hypothetical protein Csa_2G108610 [Cucumis sativus]
Length=616

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIA+K+TLG I+ RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAALESSKLWVMNVVPTIAEKNTLGAIFERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAVVFRDEVD L+KV+++IGGMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNMEDILLEMDRILRPEGAVVFRDEVDVLVKVKKMIGGMRWDA  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEK+L+AVK+YW +   NSTS
Sbjct  584  KMVDHEDGPLVPEKVLIAVKQYWVVGGNNSTS  615



>gb|KDP31241.1| hypothetical protein JCGZ_11617 [Jatropha curcas]
Length=613

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGMGGFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+ D LIKV+RI+GGMRW+ 
Sbjct  520  TYDLIHANALFSLYKDKCNMEDILLEMDRILRPEGAVIFRDQEDILIKVKRIVGGMRWNT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK++ AVK+YW   + N T++Q
Sbjct  580  KMVDHEDGPLVPEKVMFAVKQYWVAGEYNRTTSQ  613



>ref|XP_006385609.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
 gb|ERP63406.1| hypothetical protein POPTR_0003s08590g [Populus trichocarpa]
Length=612

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I GGMRWD 
Sbjct  518  TYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKIAGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKILV VK+YW     NSTS+
Sbjct  578  KMMDHEDGPLVPEKILVVVKQYWVGGTGNSTSS  610



>ref|XP_008441700.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
 ref|XP_008441701.1| PREDICTED: probable methyltransferase PMT2 [Cucumis melo]
Length=616

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIA+K+TLG I+ RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAALESSKLWVMNVVPTIAEKNTLGAIFERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD L+KV+++IGGMRWD 
Sbjct  524  TYDLIHAHGLFSLYKDKCNMEDILLEMDRILRPEGAVIFRDEVDVLVKVKKMIGGMRWDA  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEK+L+AVK+YW +   NSTS
Sbjct  584  KMVDHEDGPLVPEKVLIAVKQYWVVGGNNSTS  615



>gb|KDO82910.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
 gb|KDO82911.1| hypothetical protein CISIN_1g0105922mg [Citrus sinensis]
Length=506

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPT+ADK+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  355  NIMDMNAGFGGFAAAIQSSKLWVMNVVPTLADKNTLGVIYERGLIGIYHDWCEAFSTYPR  414

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYKDKC+ EDILLEMDRILRPEGA++ RDEVD +IKV++I+GGMRWD 
Sbjct  415  TYDLIHAHGLFSLYKDKCNIEDILLEMDRILRPEGAIIIRDEVDEIIKVKKIVGGMRWDT  474

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKILVAVK+YW  +  +++S
Sbjct  475  KMVDHEDGPLVPEKILVAVKQYWVASGNSTSS  506



>ref|XP_002275852.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
 ref|XP_010663379.1| PREDICTED: probable methyltransferase PMT2 [Vitis vinifera]
Length=610

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  456  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C  EDILLEMDRILRPEGAV+FRD++D LIKV++I+GGMRW+ 
Sbjct  516  TYDLIHANGVFSLYKNSCSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKIVGGMRWNT  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  576  KLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  608



>ref|XP_011015217.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011015218.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+D+C+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+++  MRW  
Sbjct  525  TYDLIHASGVFSLYQDRCNMEDILLEMDRILRPEGAVIFRDEVDVLIKVRKMVRQMRWHT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYWVAGG-NSTSTQ  617



>ref|XP_011021619.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
 ref|XP_011021621.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=617

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA L SPK WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  465  NIMDMNAGMGGFAAALESPKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+D+C+ EDILLEMDRILRPEGAV+FRDEVD LIKVR+++  MRW  
Sbjct  525  TYDLIHASGVFSLYQDRCNMEDILLEMDRILRPEGAVIFRDEVDVLIKVRKMVRQMRWHT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW     NSTS Q
Sbjct  585  KMVDHEDGPLVPEKILVAVKQYWVAGG-NSTSTQ  617



>ref|XP_011018632.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
 ref|XP_011018633.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Populus 
euphratica]
Length=612

 Score =   258 bits (660),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA LGGFAA L SPK WVMNVVPTIA K+TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NIMDMNARLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I GGMRWD 
Sbjct  518  TYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKITGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  578  KMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSS  610



>ref|XP_010552579.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   258 bits (660),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 138/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+TLGVIY RG+IGIYHDWC+ FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESRKLWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCQAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYKD+C+ EDILLEMDRILRPEGAV+FRDEVD LIKV++IIGGMRWD 
Sbjct  523  TYDLIHANHLFSLYKDRCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIIGGMRWDS  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW +  +NSTSA 
Sbjct  583  KLVDHEDGPLVPEKVLIAVKQYW-VTGSNSTSAN  615



>ref|XP_011032031.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
 ref|XP_011032032.1| PREDICTED: probable methyltransferase PMT14 [Populus euphratica]
Length=612

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I GGMRWD 
Sbjct  518  TYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKIAGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKI+V VK+YW     NSTS+
Sbjct  578  KMMDHEDGPLVPEKIVVVVKQYWVGGTGNSTSS  610



>gb|KJB51709.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51710.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
 gb|KJB51711.1| hypothetical protein B456_008G228900 [Gossypium raimondii]
Length=613

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 2/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTI  K TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NVMDMNAGLGGFAAALESPKSWVMNVVPTIG-KDTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY+DKC FEDILLEMDRILRPEGAV+FRD+VD L KVR+I GGMRWD 
Sbjct  518  TYDLIHANGVFSLYQDKCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWT-LNDTNSTSA  266
            K+ DHEDGPLVPEKILVAVK+YW  +   NSTS+
Sbjct  578  KMNDHEDGPLVPEKILVAVKQYWVGVIKGNSTSS  611



>ref|XP_007210880.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
 gb|EMJ12079.1| hypothetical protein PRUPE_ppa003016mg [Prunus persica]
Length=612

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NVMDMNAGLGGFAAALESRKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            +YDLIHA+GVFSLYK++C+ EDILLEMDR+LRPEGAV+FRDEVD L KVR+I+GGMRWD 
Sbjct  518  SYDLIHASGVFSLYKNECNLEDILLEMDRMLRPEGAVIFRDEVDVLNKVRKIVGGMRWDA  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  578  KIMDHEDGPLVPEKILVVVKQYWVAGSRNSTS  609



>gb|KDP22915.1| hypothetical protein JCGZ_01776 [Jatropha curcas]
Length=612

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT+A K+TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NVMDMNAGLGGFAAALESPKSWVMNVVPTVA-KNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY+++C FEDILLEMDRILRPEG+V+FRD VD L +V++I GGMRWD 
Sbjct  518  TYDLIHANGVFSLYQNRCKFEDILLEMDRILRPEGSVIFRDGVDVLNEVKKIAGGMRWDI  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KLMDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  578  KLMDHEDGPLVPEKILVAVKQYWVGGAGNSTSS  610



>ref|XP_004511207.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511208.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=610

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 137/154 (89%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAAIHSSKSWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGAV+ RDEVD LIKV+++I GMRW+ 
Sbjct  518  TYDLIHANGLFSLYQDKCNTEDILLEMDRILRPEGAVIIRDEVDVLIKVKQLISGMRWNS  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW + D NSTS +
Sbjct  578  KLVDHEDGPLVPEKVLIAVKQYW-VTDGNSTSTE  610



>ref|XP_007210881.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
 gb|EMJ12080.1| hypothetical protein PRUPE_ppa003018mg [Prunus persica]
Length=611

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD +D L+KV +I+ GMRW+ 
Sbjct  518  TYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKIVRGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVK+YW   + NSTS++
Sbjct  578  KMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTSSE  611



>ref|XP_010029610.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010029618.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83590.1| hypothetical protein EUGRSUZ_B00481 [Eucalyptus grandis]
Length=614

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA + TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAKRDTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDE+D L+KV+RI+GGMRW+ 
Sbjct  518  TYDLIHAHGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDELDVLLKVKRIVGGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPL+ EK+L AVK+YW   +++STSA
Sbjct  578  KMVDHEDGPLITEKVLFAVKQYWVAGESSSTSA  610



>ref|XP_006602298.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=608

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMN+GLG FAA + S   WVMNVVPTIA+ +TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNSGLGSFAAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  518  TYDLIHAHGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  578  KMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>ref|XP_008239959.1| PREDICTED: probable methyltransferase PMT2 [Prunus mume]
Length=611

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD +D L+KV +I+ GMRW+ 
Sbjct  518  TYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKIVRGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVK+YW   + NSTS++
Sbjct  578  KMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTSSE  611



>ref|XP_010091504.1| putative methyltransferase PMT2 [Morus notabilis]
 gb|EXB44674.1| putative methyltransferase PMT2 [Morus notabilis]
Length=613

 Score =   256 bits (653),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGV+Y RG+IG+YHDWCE FSTYPR
Sbjct  460  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVVYERGLIGVYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCD  DILLEMDRILRPEGAV+FRD+ D LI+VRRI+ GMRW+ 
Sbjct  520  TYDLIHANGVFSLYKDKCDPVDILLEMDRILRPEGAVIFRDQEDVLIRVRRIVRGMRWNT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVKKYW   + NS S+ 
Sbjct  580  KIVDHEDGPLVPEKVLFAVKKYWVAGENNSPSSN  613



>gb|KHG27439.1| hypothetical protein F383_15139 [Gossypium arboreum]
Length=643

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTI  K TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  489  NVMDMNAGLGGFAAALESPKSWVMNVVPTIG-KDTLGVIYERGLIGIYHDWCEGFSTYPR  547

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HANGVFSLY+DKC FEDILLEMDRILRPEGAV+FRD+VD L KVR+I GGMRWD 
Sbjct  548  TYDLMHANGVFSLYQDKCSFEDILLEMDRILRPEGAVIFRDDVDVLNKVRKIAGGMRWDT  607

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLN-DTNSTSA  266
            K+ DHEDGPLVPEKILVAVK+YW      NSTS+
Sbjct  608  KMNDHEDGPLVPEKILVAVKQYWVGGIKGNSTSS  641



>emb|CBI33946.3| unnamed protein product [Vitis vinifera]
Length=509

 Score =   253 bits (646),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  357  NIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  415

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRW+ 
Sbjct  416  TYDFIHASGVFSLYQNTCKLEDILLEMDRILRPEGAVMFRDEVDVLIKVKKIAKGMRWNT  475

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
             +MDHEDGPLVPEKILV VK+YW     NSTSA
Sbjct  476  NMMDHEDGPLVPEKILVVVKQYWVGGGDNSTSA  508



>ref|XP_006368452.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
 gb|ERP65021.1| hypothetical protein POPTR_0001s02930g [Populus trichocarpa]
Length=612

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA LGGFAA L SPK WVMNVVPTIA K+TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NIMDMNARLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY++KC+ EDILLEMDRILRPEG V+FRDEVD L KV++I  GMRWD 
Sbjct  518  TYDFIHANGVFSLYQNKCNLEDILLEMDRILRPEGTVIFRDEVDVLNKVKKITEGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKILVAVK+YW     NSTS+
Sbjct  578  KMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSS  610



>ref|XP_004508998.1| PREDICTED: probable methyltransferase PMT14-like [Cicer arietinum]
Length=611

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIAD +TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  460  NLMDMNAGLGGFAAALESQKSWVMNVVPTIAD-NTLGVIYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGA++ RDEVD L KV++I+GGMRW+ 
Sbjct  519  TYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIVGGMRWEA  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKILVA K+YW     N+TS+
Sbjct  579  KMMDHEDGPLVPEKILVATKEYWVGISKNNTSS  611



>ref|XP_008229546.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229547.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
 ref|XP_008229548.1| PREDICTED: probable methyltransferase PMT14 [Prunus mume]
Length=612

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NVMDMNAGLGGFAAALESRKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            +YDLIHA+GVFSLYK++C+ EDILLEMDRILRPEG V+FRDEVD L KVR+I+GGMRWD 
Sbjct  518  SYDLIHASGVFSLYKNECNLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDA  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKILV VK+YW     NSTS
Sbjct  578  KIVDHEDGPLVPEKILVVVKQYWVAGSGNSTS  609



>gb|EPS64080.1| hypothetical protein M569_10695, partial [Genlisea aurea]
Length=606

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
              MDMNAGLGGFAA L SPK WVMNVVPT A+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  454  NFMDMNAGLGGFAAALQSPKIWVMNVVPTAAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLYKDKC+FED+LLEMDRILRPEGAVVFRDEVD L+KV+++  GMRWD 
Sbjct  514  TYDFIHASGVFSLYKDKCEFEDVLLEMDRILRPEGAVVFRDEVDVLVKVKKMTEGMRWDS  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KL+DHEDGPLV +KIL AVK+YW     +S+S+
Sbjct  574  KLIDHEDGPLVSQKILFAVKQYWVAAGNSSSSS  606



>ref|XP_010110495.1| putative methyltransferase PMT14 [Morus notabilis]
 gb|EXC26713.1| putative methyltransferase PMT14 [Morus notabilis]
Length=612

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIAD S LGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  458  NVMDMNAGLGGFAAALESRKSWVMNVVPTIADNS-LGVIYERGLIGIYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH NGVFSLY+DKC+ EDILLEMDRILRPEG+V+ RDEVD L KV++I  GMRWD 
Sbjct  517  TYDLIHGNGVFSLYQDKCELEDILLEMDRILRPEGSVLLRDEVDVLNKVKKISAGMRWDI  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKILVAVK+YW ++  NSTS
Sbjct  577  KLLDHEDGPLVPEKILVAVKQYWVVSKGNSTS  608



>ref|XP_009390921.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAAIESPKLWVMNVVPTIAEMSTLGVIYDRGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+FRD+VD LIKV++I+GGMRW+ 
Sbjct  524  TYDLIHANGVFSLYRNKCKMEDILLEMDRILRPEGAVIFRDDVDVLIKVKKIVGGMRWNI  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KL+DHEDGPLVPEKILVAVK+YW
Sbjct  584  KLVDHEDGPLVPEKILVAVKQYW  606



>gb|KHN17371.1| Putative methyltransferase PMT2 [Glycine soja]
Length=608

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMN+GLG FAA + S   WVMNVVPTIA+ +TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNSGLGSFAAAIHSSNLWVMNVVPTIAEMNTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++ +GGMRWD 
Sbjct  518  TYDLIHAHGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKRVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+LVAVK+YW    TNSTS Q
Sbjct  578  KMVDHEDGPLVPEKVLVAVKQYWV---TNSTSTQ  608



>ref|XP_009342549.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT14 
[Pyrus x bretschneideri]
Length=509

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEG STYPR
Sbjct  356  NVMDMNAGLGGFAAALESQKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGSSTYPR  414

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            +YDLIHA+GVFSLYK++C  EDILLEMDRILRPEG V+FRDEVD L KVR+I+GGMRWD 
Sbjct  415  SYDLIHASGVFSLYKNECKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDA  474

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEKILV VK+YW     NSTS+
Sbjct  475  KIMDHEDGPLVPEKILVVVKQYWVAGSGNSTSS  507



>ref|XP_010559283.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010559284.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 132/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTIA K+TLG+IY RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGIIYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VR++  GMRWD 
Sbjct  519  TYDLIHANGVFSLYQNSCKIEDILLEMDRILRPEGMVIFRDEVDVLNDVRKMANGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YW     N TS++
Sbjct  579  KLMDHEDGPLVPEKILVAVKQYWVAGGGNGTSSE  612



>ref|XP_007153607.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 ref|XP_007153608.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25601.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25602.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
Length=610

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+ +TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAAIHSSKLWVMNVVPTIAETNTLGVIYERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I+GGMRWD 
Sbjct  518  TYDLIHAPGLFSLYKDKCNAEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIVGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L+AVK+YW +   NST+ Q
Sbjct  578  KMVDHEDGPLVPEKVLIAVKQYW-VTGGNSTATQ  610



>gb|KHN01216.1| Putative methyltransferase PMT2 [Glycine soja]
Length=504

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  354  NIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  413

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRWD 
Sbjct  414  TYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRWDT  473

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  474  KMVDHEDGPLVPEKVLIAVKQYWVANATST  503



>ref|XP_007157631.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
 gb|ESW29625.1| hypothetical protein PHAVU_002G085900g [Phaseolus vulgaris]
Length=607

 Score =   254 bits (649),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+ GIYHDWCE FSTYPR
Sbjct  457  NIMDMNAGLGSFAAAIESAKLWVMNVVPTIAEKSTLGVIYERGLTGIYHDWCEAFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++G+FSLYKDKC+ EDILLEMDRILRPEGAV+FRDEVD LIKV+++I GMRWD 
Sbjct  517  TYDLIHSHGLFSLYKDKCNEEDILLEMDRILRPEGAVIFRDEVDALIKVKKLIEGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  577  KMVDHEDGPLVPEKILIAVKQYWVANATST  606



>ref|XP_010529126.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
 ref|XP_010529127.1| PREDICTED: probable methyltransferase PMT14 [Tarenaya hassleriana]
Length=614

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 134/156 (86%), Gaps = 3/156 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA + SPK WVMNV+PTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAAVESPKSWVMNVIPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C  EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  519  TYDLIHANGVFSLYKNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKIADGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTL--NDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YW    N T+S+S +
Sbjct  579  KLMDHEDGPLVPEKILVAVKQYWVAGGNSTSSSSEE  614



>ref|XP_006415973.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
 gb|ESQ34326.1| hypothetical protein EUTSA_v10007096mg [Eutrema salsugineum]
Length=616

 Score =   254 bits (648),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW    TNSTSA 
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWV---TNSTSAH  616



>emb|CDY50730.1| BnaC05g50930D [Brassica napus]
Length=496

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  346  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  405

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  406  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  465

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  466  KLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  496



>ref|XP_008393149.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=609

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  456  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKCD EDILLEMDRILRPEGAV+FRD  D L+KV ++  GMRW+ 
Sbjct  516  TYDLIHANGVFSLYKDKCDAEDILLEMDRILRPEGAVIFRDHXDVLVKVSKLARGMRWNT  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVK+YW   + NST+++
Sbjct  576  KMVDHEDGPLVPEKVLFAVKRYWVAGEDNSTTSE  609



>ref|XP_002282093.2| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663982.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
 ref|XP_010663986.1| PREDICTED: probable methyltransferase PMT14 [Vitis vinifera]
Length=611

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NIMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRW+ 
Sbjct  518  TYDFIHASGVFSLYQNTCKLEDILLEMDRILRPEGAVMFRDEVDVLIKVKKIAKGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
             +MDHEDGPLVPEKILV VK+YW     NSTSA
Sbjct  578  NMMDHEDGPLVPEKILVVVKQYWVGGGDNSTSA  610



>ref|XP_006578576.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Glycine 
max]
Length=375

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  223  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTYPR  282

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW+ 
Sbjct  283  TYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRWNT  342

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLV EK+L AVK+YW   D +++SA
Sbjct  343  KMVDHEDGPLVSEKVLFAVKQYWVAGDNSTSSA  375



>ref|XP_009371899.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Pyrus 
x bretschneideri]
Length=615

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            +YDLIHA+GVFSLYK+ C  EDILLEMDRILRPEG V+FRDEVD L KVR+I+GGMRWD 
Sbjct  521  SYDLIHASGVFSLYKNGCKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWDA  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  581  KIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  612



>ref|XP_011013091.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=610

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFA  L SPK WVMNV+PTI ++ TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  457  NIMDMNAGMGGFAVALESPKLWVMNVMPTINERDTLGVIYERGLIGIYHDWCEAFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD LIKVRRI+ GMRW+ 
Sbjct  517  TYDLIHANGVFSLYKDKCNMEDILLEMDRILRPEGAVIFRDKVDVLIKVRRIVRGMRWNA  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL+ EK+L  VK YW   + NSTS++
Sbjct  577  KMVDHEDGPLLSEKVLFTVKLYWVAGENNSTSSR  610



>ref|XP_003518725.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  457  NIMDMNAGLGSFAAAIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW+ 
Sbjct  517  TYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRWNT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  577  KMVDHEDGPLVPEKILIAVKQYWVANATST  606



>gb|KHN12213.1| Putative methyltransferase PMT2 [Glycine soja]
Length=585

 Score =   252 bits (644),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  435  NIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEGFSTYPR  494

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRW+ 
Sbjct  495  TYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRWNT  554

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEKIL+AVK+YW  N T++
Sbjct  555  KMVDHEDGPLVPEKILIAVKQYWVANATST  584



>ref|XP_010053567.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 ref|XP_010053568.1| PREDICTED: probable methyltransferase PMT14 [Eucalyptus grandis]
 gb|KCW77890.1| hypothetical protein EUGRSUZ_D02155 [Eucalyptus grandis]
Length=613

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVP IA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAALESPKLWVMNVVPNIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYK KC FEDILLEMDRILRPEGA++ RDEVDT+ +VR+I G MRWD 
Sbjct  519  TYDLIHASGIFSLYKGKCKFEDILLEMDRILRPEGAIILRDEVDTMNEVRKITGRMRWDV  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KL+DHEDGPLVPEKILV VK+YW  +  NSTS 
Sbjct  579  KLVDHEDGPLVPEKILVGVKQYWVGSSGNSTSG  611



>ref|XP_006663417.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=260

 Score =   243 bits (619),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SP  WVMNVVP I++K+TLG++Y RG+IGIYHDWCE FSTYPR
Sbjct  109  NIMDMNAGLGSFAAVLESPISWVMNVVPAISEKNTLGIVYERGLIGIYHDWCEAFSTYPR  168

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  169  TYDLIHANGLFSLYQNKCNIEDILLEMDRILRPEGAVIMRDNVEVLNKVRRTVMGMRWKS  228

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  S S
Sbjct  229  KLLDHEDGPHIPEKILVSVKKYWVGNEEESGS  260



>ref|XP_002893375.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69634.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=616

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIIAGMRWDS  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>ref|XP_010937120.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Elaeis 
guineensis]
Length=616

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPT+A+KSTL V+Y RG+IGIYHDWCE FS+YPR
Sbjct  463  NIMDMNAGLGSFAAAIESPKLWVMNVVPTVAEKSTLSVVYERGLIGIYHDWCEAFSSYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKD+C  EDILLEMDRILRPEGAV+FRD+ D L KV++I+ GMRW+ 
Sbjct  523  TYDLIHANGVFSLYKDRCKMEDILLEMDRILRPEGAVMFRDQDDVLAKVKQIVSGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+ DHEDGPLVPEKILVAVK+YW   D N T+
Sbjct  583  KMADHEDGPLVPEKILVAVKQYWVSGDNNRTA  614



>ref|XP_006436790.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
 ref|XP_006485402.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485403.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Citrus 
sinensis]
 gb|ESR50030.1| hypothetical protein CICLE_v10030990mg [Citrus clementina]
Length=609

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT A K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  458  NVMDMNAGLGGFAAALESPKSWVMNVVPTTA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++ C  EDILLEMDRILRPEGAV+FRDEVD L KVR+   GMRWD 
Sbjct  517  TYDLIHANGVFSLYENTCKPEDILLEMDRILRPEGAVIFRDEVDALNKVRKFAEGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K+MDHEDGPL+PEKIL+AVK+YW  +  NSTS
Sbjct  577  KMMDHEDGPLMPEKILIAVKQYWVGSAGNSTS  608



>ref|NP_564265.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 ref|NP_849710.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 sp|B9DFI7.2|PMT2_ARATH RecName: Full=Probable methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AAK59830.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AAN18206.1| At1g26850/T2P11_4 [Arabidopsis thaliana]
 gb|AEE30749.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
 gb|AEE30751.1| putative methyltransferase PMT2 [Arabidopsis thaliana]
Length=616

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIIAGMRWDA  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>dbj|BAH19504.1| AT1G26850 [Arabidopsis thaliana]
Length=616

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIIAGMRWDA  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTST  615



>ref|XP_009380165.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIAD STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAAIESPKLWVMNVVPTIADISTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+FRD+VD L++V++ + GMRWD 
Sbjct  524  TYDLIHANGVFSLYQNKCKMEDILLEMDRILRPEGAVIFRDDVDVLLRVKKTVSGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPL+PEKILVAVK+YW    T+    +
Sbjct  584  KLVDHEDGPLIPEKILVAVKQYWVGGSTSKKEKE  617



>ref|XP_007046111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY01943.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=616

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNA LGGFAA L SPK WVMNV+PTIA K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAVLGGFAAALDSPKLWVMNVMPTIAQKDTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA G+FSLYKD+C+ EDILLEMDRILRPEGAV+FRDEVD LIKV++I  GMRWD 
Sbjct  524  TYDLIHAYGLFSLYKDRCNVEDILLEMDRILRPEGAVIFRDEVDVLIKVKKIAAGMRWDA  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW +   N+TS Q
Sbjct  584  KMIDHEDGPLVPEKILVAVKQYWVVGG-NTTSTQ  616



>ref|XP_010532828.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK W MNVVPTIA+K+TLGVIY RG+IGIYHDWCE  STYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKLWTMNVVPTIAEKNTLGVIYERGLIGIYHDWCEALSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYKDKCD  DIL+EMDRILRPEGAV+ RDEVD L+KV+++IGGMRWD 
Sbjct  523  TYDLIHANHLFSLYKDKCDMGDILVEMDRILRPEGAVIIRDEVDVLVKVKKMIGGMRWDS  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEK+L+AVK+YW     NSTSA 
Sbjct  583  KLVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSAN  615



>ref|XP_010460256.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
 ref|XP_010477804.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDA  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>ref|XP_010498988.1| PREDICTED: probable methyltransferase PMT2 [Camelina sativa]
Length=616

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDA  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>ref|XP_004241578.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=615

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA+K TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKDTLGVVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLYKDKC  EDILLEMDRILRPEGAV+ RD VD L +V+RI  GMRW+ 
Sbjct  524  TYDLIHANRVFSLYKDKCSVEDILLEMDRILRPEGAVILRDHVDVLTQVKRIATGMRWNI  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPL+PEK+L AV+KYW + D NST
Sbjct  584  KMVDHEDGPLIPEKVLFAVRKYWVVGDNNST  614



>ref|XP_003517972.1| PREDICTED: probable methyltransferase PMT2-like [Glycine max]
Length=607

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + S K WVMNVVPTIA+KSTLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  457  NIMDMNAGLGSFAADIQSSKLWVMNVVPTIAEKSTLGVIYERGLIGIYHDWCEAFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH++ +FSLYKDKCD EDILLEMDRILRPEGAV+ RDEVD LIKV++++ GMRWD 
Sbjct  517  TYDLIHSDSLFSLYKDKCDTEDILLEMDRILRPEGAVIIRDEVDVLIKVKKLVEGMRWDT  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            K++DHEDGPLVPEK+L+AVK+YW  N T++
Sbjct  577  KMVDHEDGPLVPEKVLIAVKQYWVANATST  606



>emb|CDY16198.1| BnaA09g29320D [Brassica napus]
Length=606

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  456  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  516  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  576  KLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  606



>ref|XP_006827213.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
 gb|ERM94450.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
Length=614

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGLGGFAAAIESPKSWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY DKC  EDILLEMDRILRPEGAV+FRD+VD L KV+++  GMRW+ 
Sbjct  523  TYDLIHAHGVFSLYNDKCKMEDILLEMDRILRPEGAVIFRDDVDVLNKVKKMASGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDT  281
            K++DHEDGPLVP+K+LVAVK+YW  N T
Sbjct  583  KMVDHEDGPLVPQKVLVAVKQYWITNGT  610



>ref|XP_002528760.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33582.1| ATP binding protein, putative [Ricinus communis]
Length=612

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT A ++TLGVIY RG++GIYHDWCEGFSTYPR
Sbjct  459  NVMDMNAGLGGFAAALESPKSWVMNVVPTAA-QNTLGVIYERGLVGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+  C  EDILLEMDRILRPEG+V+FRDEVD L +V+RI GGMRWD 
Sbjct  518  TYDLIHADGVFSLYQKICKLEDILLEMDRILRPEGSVIFRDEVDVLNEVKRIAGGMRWDT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+MDHEDGPLVPEKILVAVK+YW     NSTS +
Sbjct  578  KMMDHEDGPLVPEKILVAVKQYWVGGTGNSTSNE  611



>ref|XP_010695192.1| PREDICTED: probable methyltransferase PMT14 [Beta vulgaris subsp. 
vulgaris]
Length=612

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA + SPK WVMNVVP IAD +TLG IY RG+IGIYHDWCEGFSTYPR
Sbjct  459  NIMDMNAGLGGFAAAIDSPKVWVMNVVPNIAD-NTLGAIYERGLIGIYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FS+Y+DKC++EDILLEMDRILRPEG V+FRD VD LIKV++I  GMRWD 
Sbjct  518  TYDLIHANHLFSMYQDKCEYEDILLEMDRILRPEGVVIFRDAVDPLIKVKQIARGMRWDL  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGP VPEKIL+AVK+YW   + NSTS+ 
Sbjct  578  KLVDHEDGPFVPEKILIAVKQYWVAGEMNSTSSN  611



>ref|XP_009115418.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  524  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLV EK+L+AVK+YW    TNSTSAQ
Sbjct  584  KLVDHEDGPLVNEKVLIAVKQYWV---TNSTSAQ  614



>ref|XP_009591906.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009591908.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=617

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLG FAA L SPK WVMNVVP IA++ TLGVIY +G+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGSFAAALESPKLWVMNVVPNIAEQDTLGVIYEQGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD VD L +V+RI  GMRW+ 
Sbjct  524  TYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVILRDHVDVLTQVKRIASGMRWNI  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL+PEK+L  VKKYW   D NST ++
Sbjct  584  KMVDHEDGPLIPEKVLFGVKKYWVAGDNNSTVSE  617



>ref|XP_009393700.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=616

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG F+A + SPK WVMNVVPTIADKSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGSFSAAIESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWCEGFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY  KC  EDILLEMDRILRPEGAV+FRD+VD L+KV+R++ GMRW+ 
Sbjct  523  TYDLIHANAVFSLYNKKCKMEDILLEMDRILRPEGAVIFRDQVDILMKVKRMVTGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPL+ EK+LVAVK+YW    TN T
Sbjct  583  KMVDHEDGPLLQEKVLVAVKQYWAGGHTNET  613



>gb|AAT38682.2| Methyltransferase family protein, putative [Solanum demissum]
 gb|AAT38802.2| Methyltransferase family protein, putative [Solanum demissum]
Length=666

 Score =   252 bits (644),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 139/172 (81%), Gaps = 18/172 (10%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMI---------------  590
             IMDMNAGLGGFAA L SPK WVMNV+PTIA+K+TLGVI+ RG+I               
Sbjct  495  NIMDMNAGLGGFAAALHSPKFWVMNVMPTIAEKNTLGVIFERGLIETLISPGSMCFVYML  554

Query  589  ---GIYHDWCEGFSTYPRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDE  419
                I    CE FSTYPRTYDLIHA+G+FSLYKDKC+FEDILLEMDRILRPEGAV+ RD 
Sbjct  555  ELRSILPPKCEAFSTYPRTYDLIHASGLFSLYKDKCEFEDILLEMDRILRPEGAVILRDN  614

Query  418  VDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            VD LIKV++IIGGMRW++KLMDHEDGPLVPEKILVAVK+YWTL DTNSTS+Q
Sbjct  615  VDVLIKVKKIIGGMRWNFKLMDHEDGPLVPEKILVAVKQYWTLGDTNSTSSQ  666



>ref|XP_009782774.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782775.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009782776.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=617

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLG FAA L SPK WVMNVVP IA++ TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNAGLGSFAAALESPKLWVMNVVPNIAEQDTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH NGVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD VD L +V+RI  GMRW+ 
Sbjct  524  TYDLIHGNGVFSLYKDKCNAEDILLEMDRILRPEGAVILRDHVDVLTQVKRIASGMRWNI  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL+PEK+L AVKKYW + D  ST ++
Sbjct  584  KMVDHEDGPLIPEKVLFAVKKYWVVGDNKSTVSE  617



>ref|XP_006303579.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
 gb|EOA36477.1| hypothetical protein CARUB_v10011097mg [Capsella rubella]
Length=616

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA L S K WVMNVVPTIA+K+ LGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  466  NIMDMNAGFGGFAAALESQKLWVMNVVPTIAEKNRLGVVYERGLIGIFHDWCEAFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GM+WD 
Sbjct  526  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIIAGMKWDS  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLVPEK+L+AVK+YW  N T+S
Sbjct  586  KLVDHEDGPLVPEKVLIAVKQYWVTNSTSS  615



>gb|KHN21029.1| Putative methyltransferase PMT14 [Glycine soja]
Length=561

 Score =   249 bits (637),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVP+IA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  408  NVMDMNAGLGGFAAALESQKSWVMNVVPSIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  466

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FS+Y+DKC+ EDILLEMDRILRPEGA++ RDEVD L +V++I+GGMRWD 
Sbjct  467  TYDLIHANGLFSIYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNQVKKIVGGMRWDA  526

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEKILVA+K YW     N TS +
Sbjct  527  KLVDHEDGPLVPEKILVALKVYWVGTSKNKTSNE  560



>ref|XP_007155749.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
 gb|ESW27743.1| hypothetical protein PHAVU_003G228500g [Phaseolus vulgaris]
Length=613

 Score =   251 bits (640),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  460  NLMDMNAGLGGFAAALDSPKSWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+ KC+ EDILLEMDRILRPEGA++ RDEVD L KV++I+GGMRW+ 
Sbjct  519  TYDLIHANGLFSLYRGKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIVGGMRWEA  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEKILVAVK+YW       +S +
Sbjct  579  KMVDHEDGPLVPEKILVAVKEYWVATTKKDSSNE  612



>ref|XP_006354784.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=615

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA++ TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEQDTLGVVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLYKDKC  EDILLEMDRILRPEGAV+ RD VD L +V+RI  GMRW+ 
Sbjct  524  TYDLIHANRVFSLYKDKCSAEDILLEMDRILRPEGAVILRDHVDVLTQVKRIATGMRWNI  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPL+PEK+L AV+KYW + D NST
Sbjct  584  KMVDHEDGPLIPEKVLFAVRKYWVVGDNNST  614



>ref|XP_009369302.1| PREDICTED: probable methyltransferase PMT2 [Pyrus x bretschneideri]
Length=611

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVIFERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD +D L+KV +++ GMRW+ 
Sbjct  518  TYDLIHANGVFSLYKDKCNAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKLVRGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVK+YW   +  +T+++
Sbjct  578  KMVDHEDGPLVPEKVLFAVKQYWVAGEDKATTSE  611



>ref|XP_009371893.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371894.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371895.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371896.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371897.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009371898.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Pyrus 
x bretschneideri]
Length=616

 Score =   250 bits (639),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 133/153 (87%), Gaps = 2/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA K+TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESRKLWVMNVVPTIA-KNTLGVIYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKD-KCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWD  368
            +YDLIHA+GVFSLYK+ +C  EDILLEMDRILRPEG V+FRDEVD L KVR+I+GGMRWD
Sbjct  521  SYDLIHASGVFSLYKNGRCKLEDILLEMDRILRPEGTVIFRDEVDVLNKVRKIVGGMRWD  580

Query  367  YKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
             K+MDHEDGPLVPEKILV VK+YW     NSTS
Sbjct  581  AKIMDHEDGPLVPEKILVVVKQYWVAGSGNSTS  613



>ref|XP_006600888.1| PREDICTED: probable methyltransferase PMT14 isoform X1 [Glycine 
max]
 ref|XP_006600889.1| PREDICTED: probable methyltransferase PMT14 isoform X2 [Glycine 
max]
 gb|KHN01668.1| Putative methyltransferase PMT14 [Glycine soja]
Length=613

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAVLESQKSWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEGA++ RDEVD L KV++I+ GMRW+ 
Sbjct  519  TYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNKVKKIVRGMRWEA  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEKILVAVK YW     N TS +
Sbjct  579  KLVDHEDGPLVPEKILVAVKVYWVGTSKNKTSTE  612



>ref|XP_003524439.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Glycine 
max]
 ref|XP_006579671.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Glycine 
max]
Length=613

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVP+IA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAALESQKSWVMNVVPSIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FS+Y+DKC+ EDILLEMDRILRPEGA++ RDEVD L +V++I+GGMRWD 
Sbjct  519  TYDLIHANGLFSIYQDKCNLEDILLEMDRILRPEGAIIIRDEVDVLNQVKKIVGGMRWDA  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            KL+DHEDGPLVPEKILVA+K YW     N TS +
Sbjct  579  KLVDHEDGPLVPEKILVALKVYWVGTSKNKTSNE  612



>emb|CDP12320.1| unnamed protein product [Coffea canephora]
Length=1044

 Score =   256 bits (653),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA   SPK WVMNV+PTIAD+ TLGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  461  NVMDMNAGLGSFAAAFESPKLWVMNVMPTIADRDTLGVIFERGLIGIYHDWCEAFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA GVFSLYKDKC+ EDILLEMDRILRPEGAV+ RD  D L +V+RII GMRW+ 
Sbjct  521  TYDLIHAEGVFSLYKDKCNMEDILLEMDRILRPEGAVILRDHADVLTEVKRIIAGMRWNM  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K+ DHEDGPLVPEKILVAVKKYW   D NST
Sbjct  581  KMYDHEDGPLVPEKILVAVKKYWVAGDKNST  611



>ref|XP_006476610.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006476611.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Citrus 
sinensis]
Length=613

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGLGSFAAAIESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVF+LYKDKC+ EDILLEMDRILRPEGAV+ RD+ D L+KVR+I+GGMRW+ 
Sbjct  522  TYDLIHANGVFTLYKDKCNAEDILLEMDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPLV EKIL AVK+YW   +  S+
Sbjct  582  KIIDHEDGPLVTEKILFAVKRYWVTENVTSS  612



>ref|XP_010275323.1| PREDICTED: probable methyltransferase PMT14 [Nelumbo nucifera]
Length=613

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+K+TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  459  NIMDMNAGLGSFAAAIESPKSWVMNVVPTIAEKNTLGVIYERGLIGIYHDWCEAFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFS+Y++KC+  DILLEMDRILRPEGAV+ RD VD L KVR+I  GM+WD 
Sbjct  519  TYDLIHASGVFSMYQNKCEAVDILLEMDRILRPEGAVIIRDNVDVLNKVRKIANGMKWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKILVAVK+YW     NSTS
Sbjct  579  KMVDHEDGPLVPEKILVAVKQYWVGGSGNSTS  610



>ref|XP_008356626.1| PREDICTED: probable methyltransferase PMT2 [Malus domestica]
Length=611

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGV + RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVXFERGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY+DKC+ EDILLEMDRILRPEGAV+FRD +D L+KV +++ GMRW+ 
Sbjct  518  TYDLIHANGVFSLYRDKCNAEDILLEMDRILRPEGAVIFRDHMDVLVKVSKLVRGMRWNT  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLVPEK+L AVK+YW   +  ST+++
Sbjct  578  KMVDHEDGPLVPEKVLFAVKRYWVAGEDKSTTSE  611



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L S K WVMNV+PTIA K+TLGVIY RG+IG+YHDWCE FSTYPR
Sbjct  465  NIMDMNAGLGGFAAALESAKLWVMNVMPTIAPKNTLGVIYERGLIGVYHDWCEAFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLYK+KC+ EDILLEMDRILRPEGAV+FRD+V+ LIKV++I+  MRWD 
Sbjct  525  TYDLIHANRVFSLYKNKCNPEDILLEMDRILRPEGAVIFRDQVEVLIKVKKIVRRMRWDS  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLV EKILVAVK+YW +N T+S
Sbjct  585  KLVDHEDGPLVSEKILVAVKQYWVVNSTSS  614



>ref|XP_010441570.1| PREDICTED: probable methyltransferase PMT14, partial [Camelina 
sativa]
Length=404

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPT+A K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  251  NVMDMNAGLGGFAAALESPKSWVMNVVPTVA-KNTLSVVYERGLIGIYHDWCEGFSTYPR  309

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI  GMRWD 
Sbjct  310  TYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRITKGMRWDT  369

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KLMDHE+ PLVPEKILVAVK+YW
Sbjct  370  KLMDHENSPLVPEKILVAVKQYW  392



>emb|CDY40268.1| BnaA07g09320D [Brassica napus]
Length=606

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  456  NIMDMNAGFGGFAAAIESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  515

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  516  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  575

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLV EK+L+AVK+YW  N T+S
Sbjct  576  KLVDHEDGPLVNEKVLIAVKQYWVTNSTSS  605



>emb|CDY46435.1| BnaA08g19950D [Brassica napus]
Length=603

 Score =   248 bits (634),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  453  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  512

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  513  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  572

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  573  KLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  602



>ref|XP_008781841.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=616

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY++KC  EDILLEMDRILRPEGA++FRD+VD LIKV+R++ GMRW  
Sbjct  523  TYDLIHASGVFSLYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKRMVSGMRWST  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+ DHEDGPLV EKIL AVK+YW     N T  Q
Sbjct  583  KMADHEDGPLVSEKILFAVKQYWVGGSKNKTREQ  616



>emb|CDY45006.1| BnaCnng12360D [Brassica napus]
Length=605

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  455  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  514

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  515  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  574

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  575  KLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  604



>ref|XP_009110047.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=611

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  461  NIMDMNAGFGGFAAAIESQKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  521  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL+DHEDGPLV EK+L+AVK+YW  N T S
Sbjct  581  KLVDHEDGPLVNEKVLIAVKQYWVTNSTAS  610



>ref|XP_010917038.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=616

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTIA+ STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGLGSFAAAIESPKLWVMNVVPTIAELSTLGVIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFS+Y++KC  EDILLEMDRILRPEGA++FRD+VD LIKV+ ++ GMRW  
Sbjct  523  TYDLIHANGVFSMYQNKCKMEDILLEMDRILRPEGAIIFRDDVDVLIKVKSMVSGMRWST  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K+ DHEDGPLV EKIL AVK+YW     N TS Q
Sbjct  583  KMADHEDGPLVSEKILFAVKQYWVGGSKNKTSEQ  616



>ref|XP_009103114.1| PREDICTED: probable methyltransferase PMT2 [Brassica rapa]
Length=614

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S K WVMNVVPTIA+K+ LGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAGFGGFAAAIESTKLWVMNVVPTIAEKNRLGVVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN +FSLYK+KC+ +DILLEMDRILRPEGAV+ RD+VDTLIKV+RII GMRWD 
Sbjct  524  TYDLIHANHLFSLYKNKCNADDILLEMDRILRPEGAVIIRDDVDTLIKVKRIISGMRWDS  583

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            KL DHEDGPLV EK+L+AVK+YW  N T+S
Sbjct  584  KLADHEDGPLVNEKVLIAVKQYWVTNSTSS  613



>ref|XP_010937119.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Elaeis 
guineensis]
Length=617

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPT+A+KSTL V+Y RG+IGIYHDWCE FS+YPR
Sbjct  463  NIMDMNAGLGSFAAAIESPKLWVMNVVPTVAEKSTLSVVYERGLIGIYHDWCEAFSSYPR  522

Query  544  TYDLIHANGVFSLYKD-KCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWD  368
            TYDLIHANGVFSLYKD +C  EDILLEMDRILRPEGAV+FRD+ D L KV++I+ GMRW+
Sbjct  523  TYDLIHANGVFSLYKDSRCKMEDILLEMDRILRPEGAVMFRDQDDVLAKVKQIVSGMRWN  582

Query  367  YKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
             K+ DHEDGPLVPEKILVAVK+YW   D N T+
Sbjct  583  TKMADHEDGPLVPEKILVAVKQYWVSGDNNRTA  615



>ref|XP_009393699.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=617

 Score =   248 bits (633),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG F+A + SPK WVMNVVPTIADKSTLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGSFSAAIESPKLWVMNVVPTIADKSTLGVIYERGLIGIYHDWCEGFSTYPR  522

Query  544  TYDLIHANGVFSLY-KDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWD  368
            TYDLIHAN VFSLY K++C  EDILLEMDRILRPEGAV+FRD+VD L+KV+R++ GMRW+
Sbjct  523  TYDLIHANAVFSLYNKNRCKMEDILLEMDRILRPEGAVIFRDQVDILMKVKRMVTGMRWN  582

Query  367  YKLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
             K++DHEDGPL+ EK+LVAVK+YW    TN T
Sbjct  583  TKMVDHEDGPLLQEKVLVAVKQYWAGGHTNET  614



>ref|XP_007037318.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY21819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=615

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGIIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA  +FSLYK+KC+ EDILLEMDRILRPEG V+ RD+VD L+KV++I+GGMRW+ 
Sbjct  522  TYDLIHAKSIFSLYKNKCNVEDILLEMDRILRPEGTVIIRDQVDELMKVKKIVGGMRWNT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            +++DHEDGPLV EKIL AVK+YW   ++N+TS +
Sbjct  582  RMVDHEDGPLVSEKILFAVKRYWVAGESNTTSME  615



>emb|CDP12957.1| unnamed protein product [Coffea canephora]
Length=612

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA ++TLG+IY RG+IG+YHDWCEGFSTYPR
Sbjct  459  NIMDMNAGLGGFAANLESPKLWVMNVVPTIA-QNTLGIIYERGLIGMYHDWCEGFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HA+G+FSLY+DKC+FE+ILLEMDRILRPEG V+ RD VD L +VR+I GGMRWD 
Sbjct  518  TYDLLHASGLFSLYQDKCEFEEILLEMDRILRPEGTVIIRDGVDALNEVRKIAGGMRWDI  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI VAVK+YW  +  NST+
Sbjct  578  KLVDHEDGPLVPEKIFVAVKQYWVGSAGNSTT  609



>ref|XP_006439600.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
 gb|ESR52840.1| hypothetical protein CICLE_v10019341mg [Citrus clementina]
Length=613

 Score =   248 bits (633),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNV+P IA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGLGSFAAAIESPKLWVMNVMPNIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVF+LYKDKC+ EDILLEMDRILRPEGAV+ RD+ D L+KVR+I+GGMRW+ 
Sbjct  522  TYDLIHANGVFTLYKDKCNAEDILLEMDRILRPEGAVIIRDQADVLVKVRKIVGGMRWNT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPLV EKIL AVK+YW   +  S+
Sbjct  582  KIIDHEDGPLVTEKILFAVKRYWVTENVTSS  612



>ref|XP_004299370.1| PREDICTED: probable methyltransferase PMT2 [Fragaria vesca subsp. 
vesca]
Length=607

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG G FAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGFGSFAAALDSPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKDKCD EDILLEMDRILRPEGA + RD +D L KV R + GMRW  
Sbjct  514  TYDLIHANGIFSLYKDKCDAEDILLEMDRILRPEGAAIIRDHMDVLAKVSRTVKGMRWKT  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPLV EK+L AVK+YW  ++ NSTS +
Sbjct  574  KIVDHEDGPLVTEKVLFAVKQYWVADENNSTSTE  607



>emb|CAN60192.1| hypothetical protein VITISV_038569 [Vitis vinifera]
Length=605

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 4/153 (3%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  455  NIMDMNAGLGSFAAALESPKLWVMNVMPTIAEKDTLGVIYERGLIGIYHDWCEAFSTYPR  514

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFS     C  EDILLEMDRILRPEGAV+FRD++D LIKV++I+GGMRW+ 
Sbjct  515  TYDLIHANGVFSF----CSAEDILLEMDRILRPEGAVIFRDQIDVLIKVKKIVGGMRWNT  570

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            KL+DHEDGPLV EKIL AVK+YW + + NST+A
Sbjct  571  KLVDHEDGPLVSEKILFAVKQYWVVGENNSTAA  603



>ref|XP_010494834.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=621

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  465  NVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSVVYERGLIGIYHDWCEGFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI  GMRWD 
Sbjct  524  TYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRITKGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KLMDHEDGPLVPEKILVAVK+YW
Sbjct  584  KLMDHEDGPLVPEKILVAVKQYW  606



>ref|XP_008660000.1| PREDICTED: probable methyltransferase PMT2 isoform X2 [Zea mays]
Length=383

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  234  NIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPR  293

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+N +FSLY++KC FEDILLEMDRILRPEGA++ RD+VD L+KV +I   MRW  
Sbjct  294  TYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIANAMRWKT  353

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHE GP VPEKIL AVK+YWT   T+S
Sbjct  354  RLADHEGGPHVPEKILFAVKQYWTAEKTSS  383



>ref|XP_003523024.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Glycine 
max]
Length=606

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW+ 
Sbjct  514  TYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRWNT  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLV EK+L AVK+YW   D +++SA
Sbjct  574  KMVDHEDGPLVSEKVLFAVKQYWVAGDNSTSSA  606



>gb|KHN21848.1| Putative methyltransferase PMT2 [Glycine soja]
Length=606

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L++V+ I+ GMRW+ 
Sbjct  514  TYDLIHANGVFSLYKNVCNVEDILLEMDRILRPEGAVIFRDQADVLMQVKGIVKGMRWNT  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K++DHEDGPLV EK+L AVK+YW   D  ++SA
Sbjct  574  KMVDHEDGPLVSEKVLFAVKQYWVAGDNTTSSA  606



>dbj|BAH20410.1| AT4G18030 [Arabidopsis thaliana]
Length=420

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  261  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  319

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I+ GMRWD 
Sbjct  320  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIVDGMRWDT  379

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  380  KLMDHEDGPLVPEKILVATKQYWVAGD  406



>ref|XP_009595709.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
 ref|XP_009595710.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana tomentosiformis]
Length=615

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLG FAA L SPK WVMNV+PT A+  TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  463  NILDMNAGLGSFAAALESPKLWVMNVMPTKAESDTLGVLYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD VD L +V+RI  GMRW  
Sbjct  523  TYDLIHANGVFSLYKDKCNVEDILLEMDRILRPEGAVIFRDHVDILGQVKRIATGMRWKT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K +D+EDGPL+PEK+L AVK+YW + D NST+
Sbjct  583  KTVDNEDGPLIPEKLLFAVKRYWVVGDNNSTA  614



>ref|XP_004235979.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=616

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLG FAA L S K WVMNVVPTIA++ TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NILDMNAGLGSFAAALESSKLWVMNVVPTIAERDTLGIIYDRGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+VD L +V+R++ GMRW  
Sbjct  523  TYDLIHANGIFSLYKDKCNTEDILLEMDRILRPEGAVIFRDDVDILGQVKRVVSGMRWKT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPL+ +K+L AVK+YW + + NST
Sbjct  583  KMVDHEDGPLISKKVLFAVKRYWVVGENNST  613



>ref|XP_006280182.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 ref|XP_006280183.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13080.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
 gb|EOA13081.1| hypothetical protein CARUB_v10026086mg [Capsella rubella]
Length=622

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  467  NVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSVVYERGLIGIYHDWCEGFSTYPR  525

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  526  TYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKITKGMRWDT  585

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KLMDHEDGPLVPEKILVAVK YW      +++
Sbjct  586  KLMDHEDGPLVPEKILVAVKHYWVAGGKENST  617



>emb|CDY03207.1| BnaC09g19490D [Brassica napus]
Length=622

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 5/157 (3%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S + WVMNVVPTIA K+TL V++ RG+IGIYHDWCEGFSTYPR
Sbjct  466  NVMDMNAGLGGFAAALESTESWVMNVVPTIA-KNTLSVVFERGLIGIYHDWCEGFSTYPR  524

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  525  TYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIANGMRWDT  584

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  266
            KLMDHEDGPLVPEKILVAVKKYW   D     NSTS 
Sbjct  585  KLMDHEDGPLVPEKILVAVKKYWVAGDGVSVGNSTST  621



>gb|KJB08228.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=617

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI  RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVISDRGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYKDKC  EDILLEMDRILRPEG+V+ RD V+ L+KV++I+GGMRWD 
Sbjct  518  TYDLIHANGIFSLYKDKCKAEDILLEMDRILRPEGSVIIRDNVNVLVKVKKIVGGMRWDA  577

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            +++DHEDGPLV EK+L AVKKYW + D
Sbjct  578  RMVDHEDGPLVSEKVLFAVKKYWVVGD  604



>ref|XP_007138189.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
 gb|ESW10183.1| hypothetical protein PHAVU_009G187900g [Phaseolus vulgaris]
Length=607

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 134/154 (87%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  455  NIMDMNAGLGSFAAALESPKLWVMNVVPTIAEKANLGVIFVRGLIGIYHDWCEAFSTYPR  514

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLYK+ C+ EDILLEMDRILRPEGAV+FRD+ D L+KV++I+ GMRW+ 
Sbjct  515  TYDLIHANGLFSLYKNGCNAEDILLEMDRILRPEGAVIFRDQADVLLKVKKIVKGMRWNT  574

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGP+V EK+L AVK+YW   D N+TS++
Sbjct  575  KMVDHEDGPMVSEKMLFAVKQYWVAGD-NTTSSE  607



>ref|XP_004300275.1| PREDICTED: probable methyltransferase PMT14 [Fragaria vesca subsp. 
vesca]
Length=608

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S   WVMNVVP+IA K+TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  455  NVMDMNAGLGGFAAALESKNSWVMNVVPSIA-KNTLGVVYERGLIGIYHDWCEGFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFSLY+++C  EDILLEMDRILRPEG V+ RDEV+ L KV++I G MRWD 
Sbjct  514  TYDLIHASGVFSLYRNECKVEDILLEMDRILRPEGTVILRDEVNVLNKVKKIAGAMRWDT  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            K+MDHEDGPLVPEK+LV VK+YW  +  NSTS+
Sbjct  574  KMMDHEDGPLVPEKVLVVVKQYWVESSGNSTSS  606



>ref|XP_009114343.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=624

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 5/157 (3%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S + WVMNVVPTIA K+TL V++ RG+IGIYHDWCEGFSTYPR
Sbjct  464  NVMDMNAGLGGFAAALESSESWVMNVVPTIA-KNTLSVVFERGLIGIYHDWCEGFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  523  TYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVLFRDEVDVLNDVRKIAKGMRWDT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  266
            KLMDHEDGPLVPEKILVAVK+YW   D     NSTS 
Sbjct  583  KLMDHEDGPLVPEKILVAVKQYWVAGDGGNVRNSTST  619



>emb|CDY70748.1| BnaCnng69650D, partial [Brassica napus]
Length=430

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  270  NVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWCEGFSTYPR  328

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFS+Y+  C  EDILLEMDRILRPEG V+ RDEVD L  VR+I  GMRWD 
Sbjct  329  TYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGIVIIRDEVDVLNDVRKIANGMRWDT  388

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  389  KLMDHEDGPLVPEKILYAVKQYWVAGD  415



>gb|EMS63414.1| putative methyltransferase PMT2 [Triticum urartu]
Length=511

 Score =   241 bits (615),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVP IAD STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  361  NIMDMNAGLGSFAAVLESPKLWVMNVVPFIADTSTLGVIYERGLIGMYHDWCEGFSTYPR  420

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++KC FEDILLEMDRILRPEGAV+ RD VD L+KV +I   MRW+ 
Sbjct  421  TYDLIHANGVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDMVDALVKVEKIANAMRWET  480

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTN  278
            +L DHE GP VPEKIL AVK+YWT +  +
Sbjct  481  RLADHEGGPRVPEKILFAVKQYWTADSKS  509



>gb|EAY79581.1| hypothetical protein OsI_34717 [Oryza sativa Indica Group]
Length=589

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  438  NIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPR  497

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  498  TYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKS  557

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  558  KLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  589



>gb|EAZ17038.1| hypothetical protein OsJ_32528 [Oryza sativa Japonica Group]
Length=589

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  438  NIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPR  497

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  498  TYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKS  557

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  558  KLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  589



>ref|XP_006364604.1| PREDICTED: probable methyltransferase PMT2-like [Solanum tuberosum]
Length=616

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
            +++DMNAGLG FAA L S K WVMNVVPTIA++ TL VIY RG+IGIYHDWCE FSTYPR
Sbjct  463  SVLDMNAGLGSFAAALESSKLWVMNVVPTIAERDTLAVIYDRGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANG+FSLYKDKC+ EDILLEMDRILRPEGAV+FRD+ D L +V+RI+ GMRW  
Sbjct  523  TYDFIHANGIFSLYKDKCNTEDILLEMDRILRPEGAVIFRDDADILGRVKRIVSGMRWKT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            K++DHEDGPL+ +K+L AVK+YW + D NST
Sbjct  583  KMVDHEDGPLISKKVLFAVKRYWVVGDNNST  613



>ref|NP_001065447.2| Os10g0569300 [Oryza sativa Japonica Group]
 gb|ABB48009.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92980.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF27284.2| Os10g0569300 [Oryza sativa Japonica Group]
Length=605

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  514  TYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKS  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  574  KLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  605



>gb|AAL86466.1|AC077693_5 hypothetical protein [Oryza sativa Japonica Group]
Length=686

 Score =   244 bits (623),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SP  WVMNVVPTI++K+TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  535  NIMDMNAGLGSFAAIIDSPISWVMNVVPTISEKNTLGIIYERGLIGIYHDWCEAFSTYPR  594

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  595  TYDLIHANGLFSLYQNKCNMEDILLEMDRILRPEGAVILRDNVEVLNKVRRTVMGMRWKS  654

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  ++S
Sbjct  655  KLLDHEDGPHIPEKILVSVKKYWVGNEEENSS  686



>ref|XP_010668105.1| PREDICTED: probable methyltransferase PMT2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   242 bits (618),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA + SPK WVMNVVPTI++K TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  453  NIMDMNAGLGSFAAAIDSPKLWVMNVVPTISEKDTLGVLYERGLIGIYHDWCEAFSTYPR  512

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA G+FSLYK+KC+ EDILLEMDR+LRPEGAV+FRDEVD L+KV+RI  GMRW+ 
Sbjct  513  TYDLIHAYGLFSLYKNKCNTEDILLEMDRMLRPEGAVIFRDEVDVLMKVKRIAAGMRWNT  572

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPL  EK+L  VK+YW  +  NSTS
Sbjct  573  KMIDHEDGPLHTEKVLFIVKQYWVASGNNSTS  604



>ref|XP_009772034.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
 ref|XP_009772035.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=615

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNAGLG FAA L SPK WVMNV+PT A+  TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  463  NILDMNAGLGSFAAALESPKLWVMNVMPTKAESDTLGVLYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC+ EDILLEMDRILRPEGAV+FRD  D L +V+ I  GMRW  
Sbjct  523  TYDLIHANGVFSLYKDKCNVEDILLEMDRILRPEGAVIFRDHADILGQVKLIATGMRWKT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++D+EDGPL+PEK+L AVK+YW + D NST+
Sbjct  583  KMVDNEDGPLIPEKVLFAVKRYWVVGDNNSTA  614



>ref|XP_010439911.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            KLMDHEDGPLVPEKILVAVK+YW   D  +T
Sbjct  581  KLMDHEDGPLVPEKILVAVKQYWVAGDDGNT  611



>ref|XP_010919849.1| PREDICTED: probable methyltransferase PMT2 [Elaeis guineensis]
Length=613

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG G FAA + SPK WVMNVVPTI++  TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGFGSFAAAIESPKSWVMNVVPTISEIDTLGIIYERGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLYK+KC+ EDILLEMDRILRPEG+V+ RD+VD L KV++++ GMRW  
Sbjct  522  TYDLIHASGLFSLYKNKCEMEDILLEMDRILRPEGSVILRDDVDVLNKVKKMVSGMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKIL+ VK+YW  N  N TS
Sbjct  582  KMLDHEDGPLVPEKILITVKQYWVGNGGNYTS  613



>ref|XP_009413462.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             I+DMNA LG FAA + SPK WVMNVVPTIA+ STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  464  NILDMNARLGSFAAAIESPKLWVMNVVPTIAEISTLGVIYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++KC  EDILLEMDRILRPEGAV+ RD+VD L+KV++++ GMRW+ 
Sbjct  524  TYDLIHANGVFSLYQNKCKMEDILLEMDRILRPEGAVILRDDVDVLMKVKKMVTGMRWNT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KL+DHEDGPLVPEKILVAVK+YW
Sbjct  584  KLLDHEDGPLVPEKILVAVKQYW  606



>ref|XP_006662085.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=605

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SP  WVMNVVP I++K+TLG++Y RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAAVLESPISWVMNVVPAISEKNTLGIVYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY++KC+ EDILLEMDRILRPEGAV+ RD V+ L KVRR + GMRW  
Sbjct  514  TYDLIHANGLFSLYQNKCNIEDILLEMDRILRPEGAVIMRDNVEVLNKVRRTVMGMRWKS  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGP +PEKILV+VKKYW  N+  S S
Sbjct  574  KLLDHEDGPHIPEKILVSVKKYWVGNEEESGS  605



>ref|XP_004986789.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=606

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SP+ WVMNVVPTI++++TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAAALDSPRSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH  G+FSLY++KCD EDILLEMDRILRPEGAV+ RD VD L KVR  +GGMRW  
Sbjct  514  TYDLIHGYGIFSLYQNKCDVEDILLEMDRILRPEGAVILRDSVDVLNKVRSTVGGMRWKS  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDT  281
            KL+DHEDGP VPEKIL++VK+YW+ +++
Sbjct  574  KLLDHEDGPHVPEKILISVKEYWSSHES  601



>ref|XP_006398351.1| hypothetical protein EUTSA_v10000856mg [Eutrema salsugineum]
 gb|ESQ39804.1| hypothetical protein EUTSA_v10000856mg [Eutrema salsugineum]
Length=521

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S K WVMNVVPTIA+ +TL V++ RG+IGIYHDWCEGFSTYPR
Sbjct  361  NVMDMNAGLGGFAAALESSKCWVMNVVPTIAN-NTLSVVFERGLIGIYHDWCEGFSTYPR  419

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY+  C  EDILLEMDRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  420  TYDLIHANNVFSLYQHSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRKITNGMRWDT  479

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KLMDHEDGPLVPEKILVAVK+YW
Sbjct  480  KLMDHEDGPLVPEKILVAVKRYW  502



>ref|XP_010551537.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPT--IADKSTLGVIYGRGMIGIYHDWCEGFSTY  551
             IMDMNAG GGFAA + SPK WVMNVVPT  I +K+ LGVI+ RG++GIYHDWCE FSTY
Sbjct  465  NIMDMNAGFGGFAAAIESPKLWVMNVVPTTKIPEKNMLGVIFERGLVGIYHDWCEAFSTY  524

Query  550  PRTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRW  371
            PRTYDLIH+N +FSLYK+KC  EDILLEMDRILRPEGAV+FRDEVDTLIKV +II GMRW
Sbjct  525  PRTYDLIHSNHLFSLYKNKCKPEDILLEMDRILRPEGAVIFRDEVDTLIKV-KIIAGMRW  583

Query  370  DYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            + KL+DHEDGPLVPEK+L+AVK+YW     NSTSA 
Sbjct  584  ESKLVDHEDGPLVPEKVLIAVKQYWVAGG-NSTSAN  618



>ref|XP_004499422.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=502

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA + SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  350  NVMDMNAGLGSFAAAIDSPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTYPR  409

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYK++C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW+ 
Sbjct  410  TYDLIHANGLFTLYKNQCNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRWNT  469

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL+ EK+L AVK+YW   + N+TS++
Sbjct  470  KMVDHEDGPLISEKVLYAVKQYWVAGN-NTTSSE  502



>ref|XP_004245869.1| PREDICTED: probable methyltransferase PMT14 [Solanum lycopersicum]
Length=616

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEGAV+ RD V+ L KVR+I  G+RWD 
Sbjct  521  TYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGAVILRDGVEVLNKVRKIAAGLRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI VAVK+Y+   D + ++
Sbjct  581  KLLDHEDGPLVPEKIFVAVKQYFVEGDEDQST  612



>ref|XP_006414159.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
 gb|ESQ55612.1| hypothetical protein EUTSA_v10024685mg [Eutrema salsugineum]
Length=623

 Score =   241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI  K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  463  NVMDMNAGLGGFAAALESPKSWVMNVIPTIT-KNTLSVVYERGLIGIYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  522  TYDFIHASGVFSLYQHSCKIEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTL-NDTNSTSAQ  263
            KLMDHEDGPLVPEKILVAVK+YW    D NS S+ 
Sbjct  582  KLMDHEDGPLVPEKILVAVKQYWVAGGDGNSPSSS  616



>gb|EMT05545.1| hypothetical protein F775_20122 [Aegilops tauschii]
Length=612

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNVVP IAD STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAVLESPKLWVMNVVPFIADTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLY++KC FEDILLEMDRILRPEGAV+ RD VD L+KV +I   MRW+ 
Sbjct  522  TYDLIHANGVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDTVDALVKVEKIANAMRWET  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTN  278
            +L DHE GP VPEK+L AVK+YWT +  +
Sbjct  582  RLADHEGGPRVPEKMLFAVKQYWTADSKS  610



>ref|XP_010481446.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=618

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTIA K+TL  +Y RG+IGIYHDWCEGFSTYPR
Sbjct  465  NVMDMNAGLGGFAAALESPKSWVMNVVPTIA-KNTLSAVYERGLIGIYHDWCEGFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++ C  EDILLEMDRILRPEG V+FRDEVD L  VRRI  GMR+D 
Sbjct  524  TYDLIHANNVFSLYQNSCKIEDILLEMDRILRPEGTVIFRDEVDVLNDVRRITKGMRYDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KLMDHEDGPLVPEKILV VK+YW
Sbjct  584  KLMDHEDGPLVPEKILVVVKQYW  606



>ref|XP_008659999.1| PREDICTED: probable methyltransferase PMT2 isoform X1 [Zea mays]
Length=611

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESPKVWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+N +FSLY++KC FEDILLEMDRILRPEGA++ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAIIIRDKVDVLVKVEKIANAMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHE GP VPEKIL AVK+YWT   T+S
Sbjct  582  RLADHEGGPHVPEKILFAVKQYWTAEKTSS  611



>ref|XP_004984213.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=611

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NLMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHSNAIFSLYQNKCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKIANAMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHEDGP VPEKIL AVK+YW     +S
Sbjct  582  RLADHEDGPHVPEKILFAVKQYWATTSKSS  611



>ref|XP_010449513.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   241 bits (615),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVAVK+YW   D
Sbjct  581  KLMDHEDGPLVPEKILVAVKQYWVAGD  607



>ref|XP_004984212.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
Length=619

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  470  NLMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPR  529

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  530  TYDLIHSNAIFSLYQNKCKFEDILLEMDRILRPEGAVIVRDKVDALVKVEKIANAMRWKT  589

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHEDGP VPEKIL AVK+YW     +S
Sbjct  590  RLADHEDGPHVPEKILFAVKQYWATTSKSS  619



>ref|XP_010434585.1| PREDICTED: probable methyltransferase PMT14 [Camelina sativa]
Length=625

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVAVK+YW   D
Sbjct  581  KLMDHEDGPLVPEKILVAVKQYWVAGD  607



>ref|XP_006650137.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=611

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY+++C FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHANSVFSLYENRCKFEDILLEMDRILRPEGAVIVRDKVDVLVKVEKIANAMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHE GP VPEKILVAVK+YW +   +S
Sbjct  582  RLADHEGGPHVPEKILVAVKQYWVVESKSS  611



>emb|CAA17146.1| putative protein [Arabidopsis thaliana]
 emb|CAB78805.1| putative protein [Arabidopsis thaliana]
Length=629

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  470  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  528

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I+ GMRWD 
Sbjct  529  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIVDGMRWDT  588

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  589  KLMDHEDGPLVPEKILVATKQYWVAGD  615



>ref|NP_193537.2| putative methyltransferase PMT14 [Arabidopsis thaliana]
 sp|Q94EJ6.1|PMTE_ARATH RecName: Full=Probable methyltransferase PMT14 [Arabidopsis thaliana]
 gb|AAK95250.1|AF410264_1 AT4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AAN64540.1| At4g18030/T6K21_210 [Arabidopsis thaliana]
 gb|AEE83986.1| putative methyltransferase PMT14 [Arabidopsis thaliana]
Length=621

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I+ GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIVDGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  581  KLMDHEDGPLVPEKILVATKQYWVAGD  607



>gb|KEH33485.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=606

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAG G FAA L SPK WVMNVVPTIA+K+TLGV++ RG+IGIYHDWCE FSTYPR
Sbjct  455  NVMDMNAGFGSFAAALDSPKLWVMNVVPTIAEKATLGVVFERGLIGIYHDWCEAFSTYPR  514

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVF+LYK+ C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW+ 
Sbjct  515  TYDLIHANGVFTLYKNACNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRWNT  574

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPL+ EK+L AVK+YW   D  +++
Sbjct  575  KMVDHEDGPLISEKVLYAVKRYWVAGDNTTST  606



>ref|NP_001050233.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|AAL58254.1|AC084762_28 hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96247.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12147.1| Os03g0379100 [Oryza sativa Japonica Group]
 gb|EAZ27118.1| hypothetical protein OsJ_11050 [Oryza sativa Japonica Group]
 gb|EEC75363.1| hypothetical protein OsI_11805 [Oryza sativa Indica Group]
Length=611

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESTKLWVMNVVPTIADTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHANAVFSLYENKCKFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKIANAMRWQT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +L DHE GP VPEKIL AVK+YW +   +S
Sbjct  582  RLTDHEGGPHVPEKILFAVKQYWVVESKSS  611



>ref|XP_008784684.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=612

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG G FAA + SPK WVMNVVPTI++ +TLG+IY RG+IG+YHDWCE FSTYPR
Sbjct  461  NIMDMNAGFGSFAAAIESPKSWVMNVVPTISEINTLGIIYERGLIGMYHDWCEAFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+FSLY++KC+ EDILLEMDRILRPEG+V+ RD+VD L KV++ + GMRW  
Sbjct  521  TYDLIHASGLFSLYENKCEMEDILLEMDRILRPEGSVILRDDVDVLNKVKKTVSGMRWKT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            K++DHEDGPLVPEKIL+AVK+YW  +  N TS
Sbjct  581  KMLDHEDGPLVPEKILIAVKQYWAGSGRNYTS  612



>ref|XP_006358580.1| PREDICTED: probable methyltransferase PMT14-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358581.1| PREDICTED: probable methyltransferase PMT14-like isoform X2 [Solanum 
tuberosum]
Length=616

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEGAV+ RD V+ L KVR+I  G+RWD 
Sbjct  521  TYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGAVILRDGVEVLNKVRKIAAGLRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI VAVK+Y    D   ++
Sbjct  581  KLLDHEDGPLVPEKIFVAVKQYVVEGDEEQST  612



>ref|XP_006283339.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
 gb|EOA16237.1| hypothetical protein CARUB_v10004377mg [Capsella rubella]
Length=626

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KL+DHEDGPLVPEKILVAVK+YW   D
Sbjct  581  KLLDHEDGPLVPEKILVAVKQYWVAGD  607



>gb|ACF86888.1| unknown [Zea mays]
Length=228

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  77   NIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  136

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +  GMRWD 
Sbjct  137  TYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLALGMRWDT  196

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K++DHEDGPLV EKIL AVK+YW
Sbjct  197  KMVDHEDGPLVREKILYAVKQYW  219



>emb|CDY35169.1| BnaA09g18060D [Brassica napus]
Length=725

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 130/157 (83%), Gaps = 5/157 (3%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L S + WVMNVVPTIA K++L V++ RG+IGIYHDWCEGFSTYPR
Sbjct  565  NVMDMNAGLGGFAAALESSESWVMNVVPTIA-KNSLSVVFERGLIGIYHDWCEGFSTYPR  623

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY+++C+ EDILLEMDRILRPEG V+ RDEVD L  VR+I  GMRWD 
Sbjct  624  TYDLIHANNVFSLYQNRCNVEDILLEMDRILRPEGTVILRDEVDALNDVRKIAKGMRWDT  683

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND----TNSTSA  266
            KLMDHEDGPLVPEKILVAVK+YW   D     NSTS 
Sbjct  684  KLMDHEDGPLVPEKILVAVKQYWVAGDGGNVRNSTST  720



>ref|XP_004499421.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
Length=606

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%), Gaps = 1/154 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLG FAA + SPK WVMNVVPTIA+K+ LGVI+ RG+IGIYHDWCE FSTYPR
Sbjct  454  NVMDMNAGLGSFAAAIDSPKLWVMNVVPTIAEKANLGVIFERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYK++C+ EDILLEMDRILRPEGAV+FRD+V  L +V+RI  GMRW+ 
Sbjct  514  TYDLIHANGLFTLYKNQCNAEDILLEMDRILRPEGAVIFRDQVGVLKQVKRIAKGMRWNT  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            K++DHEDGPL+ EK+L AVK+YW   + N+TS++
Sbjct  574  KMVDHEDGPLISEKVLYAVKQYWVAGN-NTTSSE  606



>emb|CDX78823.1| BnaA01g08900D [Brassica napus]
Length=620

 Score =   238 bits (608),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFS+Y+  C  EDILLEMDRILRPEG V+ RDEVD L  VR+I  GMRWD 
Sbjct  519  TYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGIVIIRDEVDVLNDVRKIADGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  579  KLMDHEDGPLVPEKILYAVKQYWVAGD  605



>ref|XP_002868016.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44275.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=624

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVNPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFSLY+  C  EDILLE DRILRPEG V+FRDEVD L  VR+I  GMRWD 
Sbjct  521  TYDFIHANGVFSLYQHSCKLEDILLETDRILRPEGIVIFRDEVDVLNDVRKIADGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KLMDHEDGPLVPEKILVA K+YW
Sbjct  581  KLMDHEDGPLVPEKILVATKQYW  603



>dbj|BAH19630.1| AT4G18030 [Arabidopsis thaliana]
Length=621

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNV+PTI +K+TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  462  NVMDMNAGLGGFAAALESPKSWVMNVIPTI-NKNTLSVVYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHA+GVFSLY+  C  EDILLE DRILRPEG V+FR EVD L  VR+I+ GMRWD 
Sbjct  521  TYDFIHASGVFSLYQHSCKLEDILLETDRILRPEGIVIFRGEVDVLNDVRKIVDGMRWDT  580

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKILVA K+YW   D
Sbjct  581  KLMDHEDGPLVPEKILVATKQYWVAGD  607



>ref|XP_009131372.1| PREDICTED: probable methyltransferase PMT14 [Brassica rapa]
Length=620

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAGLGGFAA L SPK WVMNVVPTI  K TL V+Y RG+IGIYHDWCEGFSTYPR
Sbjct  460  NVMDMNAGLGGFAAALESPKSWVMNVVPTIT-KKTLSVVYERGLIGIYHDWCEGFSTYPR  518

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IHANGVFS+Y+  C  EDILLEMDRILRPEG ++ RDEVD L  VR+I  GMRWD 
Sbjct  519  TYDFIHANGVFSMYQHSCKIEDILLEMDRILRPEGILIIRDEVDVLNDVRKIADGMRWDT  578

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLND  284
            KLMDHEDGPLVPEKIL AVK+YW   D
Sbjct  579  KLMDHEDGPLVPEKILYAVKQYWVAGD  605



>ref|XP_009587333.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana tomentosiformis]
Length=617

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I  G+RW+ 
Sbjct  522  TYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKIAAGLRWET  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI VAVK+Y    D +  +
Sbjct  582  KLVDHEDGPLVPEKIFVAVKQYHVEGDDDQNT  613



>ref|XP_009793368.1| PREDICTED: probable methyltransferase PMT14 [Nicotiana sylvestris]
Length=617

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I  G+RW+ 
Sbjct  522  TYDLLHANRLFTLYEDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKIAAGLRWET  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI VAVK+Y    D +  +
Sbjct  582  KLVDHEDGPLVPEKIFVAVKQYHVEGDDDQNT  613



>gb|ACA66248.1| putative methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I  G+RW+ 
Sbjct  522  TYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKIAAGLRWET  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI +AVK+Y    D +  +
Sbjct  582  KLVDHEDGPLVPEKIFIAVKQYHVEGDDDQNT  613



>gb|ACB54686.1| methyltransferase [Nicotiana benthamiana]
Length=617

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L SPK WVMNVVPTIA+ +TLGV+Y RG+IGIYHDWCEGFSTYPR
Sbjct  463  NIMDMNAGLGGFAAALDSPKLWVMNVVPTIAE-NTLGVVYERGLIGIYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDL+HAN +F+LY+DKC+FEDILLEMDR+LRPEG+V+ RD V+ L KVR+I  G+RW+ 
Sbjct  522  TYDLLHANRLFTLYQDKCEFEDILLEMDRVLRPEGSVILRDGVEVLNKVRKIAAGLRWET  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLVPEKI +AVK+Y    D +  +
Sbjct  582  KLVDHEDGPLVPEKIFIAVKQYHVEGDDDQNT  613



>gb|EEC68449.1| hypothetical protein OsI_36659 [Oryza sativa Indica Group]
Length=596

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  407  NIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAFSTYPR  466

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  GMRW  
Sbjct  467  TYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASGMRWKM  526

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
             + +HED P +PEK+L AVK+YWT +D +S
Sbjct  527  IMANHEDSPHIPEKVLYAVKRYWTADDKSS  556



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+ STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAALESPKLWVMNVIPTIANTSTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH+N +FSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHSNDIFSLYQNKCQFEDILLEMDRILRPEGAVIIRDKVDVLVKVEKIANAMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTN  278
            +L DHE GP VPEKIL  VK+YW ++ ++
Sbjct  582  RLADHEGGPHVPEKILFVVKQYWDVSTSS  610



>ref|XP_003574364.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=604

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SP  WVMNVVPTI++++TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  453  NIMDMNAGLGSFAAVLDSPGSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFSTYPR  512

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVF+LY++KCD EDILLEMDRILRPEG V+ RD V  L KVR  + GMRW  
Sbjct  513  TYDLIHASGVFTLYENKCDLEDILLEMDRILRPEGTVILRDNVHVLNKVRSTVAGMRWKT  572

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KL+DHEDGP VPEKIL+AVK+YW
Sbjct  573  KLLDHEDGPYVPEKILIAVKEYW  595



>gb|ACN26954.1| unknown [Zea mays]
Length=328

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  177  NIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  236

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +  GMRWD 
Sbjct  237  TYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLALGMRWDT  296

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K++DHEDGPLV EKIL AVK+YW
Sbjct  297  KMVDHEDGPLVREKILYAVKQYW  319



>gb|EEE52366.1| hypothetical protein OsJ_34430 [Oryza sativa Japonica Group]
Length=624

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  435  NIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAFSTYPR  494

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  GMRW  
Sbjct  495  TYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASGMRWKM  554

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
             + +HED P +PEK+L AVK+YWT +D +S
Sbjct  555  IMANHEDSPHIPEKVLYAVKRYWTADDKSS  584



>dbj|BAJ85549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKS-TLGVIYGRGMIGIYHDWCEGFSTYP  548
             IMDMNAGLG FAA L SP  WVMNVVPTI++++ TLG+IY RG+IGIYHDWCE FSTYP
Sbjct  518  NIMDMNAGLGSFAAALNSPGSWVMNVVPTISERNNTLGIIYERGLIGIYHDWCEAFSTYP  577

Query  547  RTYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWD  368
            RTYDLIHA+GVFSLY++KCD EDILLEMDRILRPEG V+ RD V+ L KVRR + GMRW 
Sbjct  578  RTYDLIHASGVFSLYENKCDLEDILLEMDRILRPEGTVILRDNVEVLNKVRRTVAGMRWK  637

Query  367  YKLMDHEDGPLVPEKILVAVKKY  299
             KL+DHEDGPLVPEK+L+AVK+Y
Sbjct  638  SKLLDHEDGPLVPEKLLIAVKEY  660



>ref|NP_001068227.1| Os11g0601600 [Oryza sativa Japonica Group]
 gb|ABA94590.1| Methyltransferase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28590.1| Os11g0601600 [Oryza sativa Japonica Group]
Length=652

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGV+Y RG+IGI+HDWCE FSTYPR
Sbjct  463  NIMDMNAGVGGFAAAVFSPKSWVMNVVPTAAELSTLGVVYERGLIGIFHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH NGVF+LYKDKC  EDILLEMDRILRPEG V+ RD+++ L+KV+RI  GMRW  
Sbjct  523  TYDLIHGNGVFTLYKDKCKMEDILLEMDRILRPEGTVILRDDIEVLLKVQRIASGMRWKM  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
             + +HED P +PEK+L AVK+YWT +D +S
Sbjct  583  IMANHEDSPHIPEKVLYAVKRYWTADDKSS  612



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTI+  STLG IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKSWVMNVVPTISKMSTLGAIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC+ EDILLEMDR+LRPEGAV+ RD+VD L KV R+  GM+W+ 
Sbjct  523  TYDLIHASGLFTLYKNKCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRLALGMKWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            +L+DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  583  RLVDHEDGPMVREKVLYAVKQYWVGGNQTAAAA  615



>ref|NP_001152056.1| methyltransferase [Zea mays]
 gb|ACG45571.1| methyltransferase [Zea mays]
Length=628

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW  
Sbjct  520  TYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
             L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  580  LLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  613



>tpg|DAA42264.1| TPA: methyltransferase isoform 1 [Zea mays]
 tpg|DAA42265.1| TPA: methyltransferase isoform 2 [Zea mays]
Length=628

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  460  NIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW  
Sbjct  520  TYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
             L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  580  LLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  613



>gb|EMS49438.1| putative methyltransferase PMT2 [Triticum urartu]
Length=614

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTIA  +TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKIATLGAVYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LY +KC  EDILLEMDRILRPEGAV+ RD+VD L KV ++  GMRW+ 
Sbjct  523  TYDLIHASGLFTLYSNKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNKLARGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  583  KLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>gb|EMT27426.1| hypothetical protein F775_29617 [Aegilops tauschii]
Length=614

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTIA  +TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKIATLGAVYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LY +KC  EDILLEMDRILRPEGAV+ RD+VD L KV ++  GMRW+ 
Sbjct  523  TYDLIHASGLFTLYSNKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNKLARGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  583  KLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>ref|XP_008658538.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
 ref|XP_008658539.1| PREDICTED: probable methyltransferase PMT2 [Zea mays]
Length=604

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S   WVMNVVP+I++++TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  454  NIMDMNAGLGSFAATLHSSSSWVMNVVPSISERNTLGIIYERGLIGIYHDWCEAFSTYPR  513

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH N +FSLY++KCD EDILLEMDRILRPEGAV+ RD  D L KVR ++ GMRW  
Sbjct  514  TYDLIHGNDIFSLYQNKCDAEDILLEMDRILRPEGAVILRDNADVLNKVRSMVAGMRWKS  573

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            KL+DHEDGP VPEKIL++VK+YW  ++  ++
Sbjct  574  KLLDHEDGPHVPEKILISVKEYWVGSEEQNS  604



>tpg|DAA46388.1| TPA: hypothetical protein ZEAMMB73_857191 [Zea mays]
Length=613

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S   WVMNVVP+I++++TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGLGSFAATLHSSSSWVMNVVPSISERNTLGIIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIH N +FSLY++KCD EDILLEMDRILRPEGAV+ RD  D L KVR ++ GMRW  
Sbjct  523  TYDLIHGNDIFSLYQNKCDAEDILLEMDRILRPEGAVILRDNADVLNKVRSMVAGMRWKS  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNST  272
            KL+DHEDGP VPEKIL++VK+YW  ++  ++
Sbjct  583  KLLDHEDGPHVPEKILISVKEYWVGSEEQNS  613



>ref|XP_003578117.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=614

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPT A  +TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKSWVMNVVPTSAKIATLGAVYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L+KV ++  GMRW+ 
Sbjct  523  TYDLIHASGLFTLYKNKCSNEDILLEMDRILRPEGAVIMRDDVDVLMKVNKLARGMRWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            KL+DHEDGPLV EK+L AVK+YW   +  + S
Sbjct  583  KLVDHEDGPLVREKVLYAVKQYWVGGNQTAAS  614



>ref|XP_008668148.1| PREDICTED: methyltransferase isoform X1 [Zea mays]
Length=658

 Score =   233 bits (595),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 125/154 (81%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+  TLGV+Y RG+IGIYHDWCE FSTYPR
Sbjct  490  NIMDMNAGVGGFAAAIFSPKSWVMNVVPTAAEICTLGVVYERGLIGIYHDWCEAFSTYPR  549

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW  
Sbjct  550  TYDLIHANGIFTLYKDRCRMEDILLEMDRILRPEGTVILRDDVEVLLKVQRTVKGMRWKT  609

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
             L +HEDGP VPEK+L AVK+YWT     + + +
Sbjct  610  LLANHEDGPNVPEKVLFAVKRYWTAAGEGTAAEE  643



>emb|CAH18000.1| Ankyrin protein kinase-like [Poa pratensis]
Length=613

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTI   +TLG +YGRG+IGIYHDWCE FSTYPR
Sbjct  462  NIMDMNAGFGGFAAAIESPKSWVMNVVPTIGKIATLGSVYGRGLIGIYHDWCEAFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV +   GMRW+ 
Sbjct  522  TYDLIHASGLFTLYKNKCSLEDILLEMDRILRPEGAVIMRDDVDILTKVDKFARGMRWNT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWT-LNDTNST  272
            +L+DHEDGPLV EK+L AVK+YW   N T ST
Sbjct  582  RLVDHEDGPLVREKVLYAVKQYWVGGNQTAST  613



>ref|NP_001063174.1| Os09g0415700 [Oryza sativa Japonica Group]
 dbj|BAD28913.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF25088.1| Os09g0415700 [Oryza sativa Japonica Group]
 gb|EAZ44732.1| hypothetical protein OsJ_29364 [Oryza sativa Japonica Group]
Length=616

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMN VPTI+  STLG IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESPKSWVMNAVPTISKMSTLGAIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC+ EDILLEMDR+LRPEGAV+ RD+VD L KV R+  GM+W+ 
Sbjct  523  TYDLIHASGLFTLYKNKCNMEDILLEMDRVLRPEGAVIMRDDVDILTKVNRLALGMKWNT  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            +L+DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  583  RLVDHEDGPMVREKVLYAVKQYWVGGNQTAAAA  615



>ref|XP_003557818.1| PREDICTED: probable methyltransferase PMT2 [Brachypodium distachyon]
Length=611

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L S K WVMNVVPTIAD STLGVIY RG+IG+YHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGSFAAVLESTKLWVMNVVPTIADASTLGVIYERGLIGMYHDWCEGFSTYPR  521

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHAN VFSLY++KC FEDILLEMDRILRPEGAV+ RD+VD L+KV +I   MRW  
Sbjct  522  TYDLIHANDVFSLYQNKCKFEDILLEMDRILRPEGAVIIRDKVDALVKVEKIANAMRWKT  581

Query  364  KLMDHEDGPLVPEKILVAVKKYWT  293
            +L +HE GP V EKIL AVK+YW 
Sbjct  582  RLANHESGPHVSEKILFAVKQYWA  605



>ref|XP_004956815.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Setaria 
italica]
 ref|XP_004956816.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Setaria 
italica]
Length=615

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNAG GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NVMDMNAGFGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV  +  GMRW+ 
Sbjct  524  TYDLIHASGLFTLYKNKCSMEDILLEMDRILRPEGAVIVRDDVDVLTKVNSLAQGMRWNT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            KL+DHEDGPLV EKIL AVK+YW
Sbjct  584  KLVDHEDGPLVGEKILYAVKQYW  606



>ref|XP_002460211.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
 gb|EER96732.1| hypothetical protein SORBIDRAFT_02g024670 [Sorghum bicolor]
Length=618

 Score =   230 bits (587),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  467  NIMDMNAGFGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  526

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK+KC  EDILLEMDRILRPEGAV+ RD+VD L KV  +  GMRW+ 
Sbjct  527  TYDLIHASGLFTLYKNKCSMEDILLEMDRILRPEGAVIIRDDVDILTKVNSLALGMRWNT  586

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K++DHEDGPLV EKIL AVK+YW
Sbjct  587  KMVDHEDGPLVREKILYAVKQYW  609



>ref|XP_004150171.1| PREDICTED: probable methyltransferase PMT14-like [Cucumis sativus]
 ref|XP_004164359.1| PREDICTED: probable methyltransferase PMT14-like [Cucumis sativus]
 gb|KGN55796.1| hypothetical protein Csa_3G016410 [Cucumis sativus]
Length=614

 Score =   229 bits (584),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 127/156 (81%), Gaps = 3/156 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNA LGGFAA + S   WVMNVVPTI+ K+TLG IY RG++G+YHDWCEGFSTYPR
Sbjct  458  NVMDMNANLGGFAAAVHSKNSWVMNVVPTIS-KNTLGAIYERGLVGMYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IH NGVF LY++ C+ EDILLEMDRILRPEG V+ RD VD + KV+++  GMRWD 
Sbjct  517  TYDFIHGNGVFDLYENNCNLEDILLEMDRILRPEGIVILRDGVDVMNKVKKLAAGMRWDV  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDT--NSTSAQ  263
            KLMDHEDGPLVPEKI+VAVK+YW +++   N TS+ 
Sbjct  577  KLMDHEDGPLVPEKIMVAVKQYWVVSNPPHNRTSSS  612



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L S K WVMN VPTIAD +TLGVIY RG+IGIYHDWCEGFSTYPR
Sbjct  462  NIMDMNAGLGGFAAALESQKSWVMNAVPTIAD-NTLGVIYERGLIGIYHDWCEGFSTYPR  520

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+FSLY+DKC+ EDILLEMDRILRPEG+V+ RDEVD + KV++I+ GMRW+ 
Sbjct  521  TYDLIHANGLFSLYQDKCNLEDILLEMDRILRPEGSVIIRDEVDVINKVQKIVRGMRWES  580

Query  364  KLMDHEDGPLVPEKILVAVK  305
            K++DHEDGP  PEKILV VK
Sbjct  581  KMVDHEDGPFAPEKILVIVK  600



>ref|XP_008448741.1| PREDICTED: probable methyltransferase PMT14 [Cucumis melo]
Length=613

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 125/155 (81%), Gaps = 3/155 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             +MDMNA LGGFAA + S   WVMNVVPTI+ K+TLG IY RG++G+YHDWCEGFSTYPR
Sbjct  458  NVMDMNANLGGFAAAVHSKNSWVMNVVPTIS-KNTLGAIYERGLVGMYHDWCEGFSTYPR  516

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD IH NGVF LY++ C+ EDILLEMDRILRPEG V+ RD VD + KV++I  GMRWD 
Sbjct  517  TYDFIHGNGVFDLYENNCNLEDILLEMDRILRPEGIVILRDGVDVMNKVKKIAAGMRWDV  576

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDT--NSTSA  266
            KLMDHEDGPLVPEKI+VAVK+YW  ++   N TS 
Sbjct  577  KLMDHEDGPLVPEKIMVAVKQYWVASNPPDNRTSG  611



>gb|EMS46508.1| putative methyltransferase PMT2 [Triticum urartu]
Length=524

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 127/173 (73%), Gaps = 21/173 (12%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SP  WVMNVVPTI++++TLG+IY RG+IGIYHDWCE FSTYPR
Sbjct  352  NIMDMNAGLGSFAAVLDSPGSWVMNVVPTISERNTLGIIYERGLIGIYHDWCEAFSTYPR  411

Query  544  TYDLIHANGVFSLYKD---------------------KCDFEDILLEMDRILRPEGAVVF  428
            TYDLIHA+GVFSLY++                     +CD EDILLEMDRILRPEG V+ 
Sbjct  412  TYDLIHASGVFSLYQNNYMYTTWEIHDLFLYGLGALVRCDLEDILLEMDRILRPEGTVIL  471

Query  427  RDEVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            RD V+ L KVRR + GM+W  KL+DHEDGPLVPEK+L+ VK YW   +  S+S
Sbjct  472  RDNVEVLNKVRRTVTGMQWKSKLLDHEDGPLVPEKLLIGVKTYWVGREEGSSS  524



>ref|XP_008651354.1| PREDICTED: uncharacterized protein LOC100279910 isoform X1 [Zea 
mays]
 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays]
Length=615

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +  GMRWD 
Sbjct  524  TYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLALGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K++DHEDGPLV EKIL AVK+YW
Sbjct  584  KMVDHEDGPLVREKILYAVKQYW  606



>ref|NP_001152470.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG47777.1| ankyrin protein kinase-like [Zea mays]
Length=615

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA  GGFAA + SPK WVMNVVPTIA   TLG +Y RG+IGIYHDWCE FSTYPR
Sbjct  464  NIMDMNAQYGGFAAAIESPKSWVMNVVPTIAKMPTLGAVYERGLIGIYHDWCEAFSTYPR  523

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F+LYK KC  ED+LLEMDRILRPEGAV+ RD+VD L KV  +  GMRWD 
Sbjct  524  TYDLIHASGLFTLYKTKCSMEDVLLEMDRILRPEGAVIIRDDVDVLTKVNSLALGMRWDT  583

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K++DHEDGPLV EKIL AVK+YW
Sbjct  584  KMVDHEDGPLVREKILYAVKQYW  606



>gb|AEX55231.1| putative cold-regulated protein [Allium sativum]
Length=324

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+G FAA + SPK WVMNVVPTI++KSTLG++Y RG+IGIYHDWCE FSTYPR
Sbjct  172  NIMDMNAGVGSFAAAIESPKLWVMNVVPTISEKSTLGIVYERGLIGIYHDWCEAFSTYPR  231

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVFSLYKDKC  EDILLEMDRILRPEG+V+ RD+VD ++K++++  GMRW+ 
Sbjct  232  TYDLIHANGVFSLYKDKCKMEDILLEMDRILRPEGSVIIRDDVDMVVKIKKMAKGMRWNS  291

Query  364  KLMDHEDGPLVPEKILVAVKKYW  296
            K +D+  G     K+L  VK+YW
Sbjct  292  KFIDNVVGSSNSTKVLFVVKQYW  314



>gb|EMS59423.1| putative methyltransferase PMT2 [Triticum urartu]
Length=659

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 4/173 (2%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SP  WVMNVVPT A+ STLGVIY RG+IGIYHDWCE FSTYPR
Sbjct  361  NIMDMNAGVGGFAAAIFSPMSWVMNVVPTAAELSTLGVIYERGLIGIYHDWCEAFSTYPR  420

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANGVF++Y+DKC  EDI+LEMDRILRPEG V+ RD++D L++V ++  GMRW  
Sbjct  421  TYDLIHANGVFNIYRDKCKMEDIMLEMDRILRPEGTVILRDDIDVLLRVDKVATGMRWKT  480

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ*GVPEGEARNDRCDGVDYE  206
             + +HED P + EK+L A+K YWT +   S+  Q    E +A + +  G D E
Sbjct  481  MMANHEDSPHIREKVLYAIKPYWTADSDKSSQDQ----EKKATSSKGKGSDSE  529



>ref|XP_004979626.1| PREDICTED: probable methyltransferase PMT2-like [Setaria italica]
Length=626

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG+GGFAA + SPK WVMNVVPT A+ STLGVIY RG+IG+YHDWCE FSTYPR
Sbjct  460  NIMDMNAGVGGFAAAIFSPKAWVMNVVPTAAELSTLGVIYERGLIGMYHDWCEAFSTYPR  519

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHANG+F+LYKD+C  EDILLEMDRILRPEG V+ RD+V+ L+KV+R + GMRW  
Sbjct  520  TYDLIHANGIFTLYKDRCKMEDILLEMDRILRPEGTVILRDDVEILLKVQRTVKGMRWKT  579

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
             + +HED   + EK+L AVK+YWT +   S
Sbjct  580  LMANHEDSQNIREKVLFAVKRYWTADSDGS  609



>gb|KJB08229.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=655

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 128/185 (69%), Gaps = 38/185 (21%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLG FAA L SPK WVMNV+PTIA+K TLGVI  RG+IGIYHDWCE FSTYPR
Sbjct  458  NIMDMNAGLGSFAAALDSPKLWVMNVMPTIAEKDTLGVISDRGLIGIYHDWCEAFSTYPR  517

Query  544  TYDLIHANGVFSLYKD--------------------------------------KCDFED  479
            TYDLIHANG+FSLYKD                                      +C  ED
Sbjct  518  TYDLIHANGIFSLYKDNSVCPDFQLIEFIFAHTCTTCLVITRTVEAYMLVFYRCRCKAED  577

Query  478  ILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDYKLMDHEDGPLVPEKILVAVKKY  299
            ILLEMDRILRPEG+V+ RD V+ L+KV++I+GGMRWD +++DHEDGPLV EK+L AVKKY
Sbjct  578  ILLEMDRILRPEGSVIIRDNVNVLVKVKKIVGGMRWDARMVDHEDGPLVSEKVLFAVKKY  637

Query  298  WTLND  284
            W + D
Sbjct  638  WVVGD  642



>ref|NP_001056669.2| Os06g0128100 [Oryza sativa Japonica Group]
 dbj|BAF18583.2| Os06g0128100 [Oryza sativa Japonica Group]
Length=230

 Score =   213 bits (543),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             ++DMNAGLGGFAA L     WVMNVVPT A  +TLGVIY RG+IG Y DWCE  STYPR
Sbjct  86   NLLDMNAGLGGFAAALVDDPVWVMNVVPTAAVANTLGVIYERGLIGTYQDWCEAMSTYPR  145

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA  +F++YKD+C+ EDILLEMDR+LRPEG V+FRD+VD L+K++ I  GMRW+ 
Sbjct  146  TYDLIHAYSLFTMYKDRCEMEDILLEMDRVLRPEGTVIFRDDVDVLVKIKNIADGMRWES  205

Query  364  KLMDHEDGPLVPEKILVAVKKYWT  293
            +++DHEDGP+  EKILV+VK YWT
Sbjct  206  RIVDHEDGPMQREKILVSVKSYWT  229



>ref|XP_008392677.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=149

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  718  MDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPRTY  539
            MDMNA LGGFAA L+    WVMN VP  +++ TLGVIY RG IG Y DWCE FSTYPRTY
Sbjct  1    MDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFIGTYQDWCEAFSTYPRTY  60

Query  538  DLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDYKL  359
            DLIHA GVFS+Y+D+CD   ILLEMDRILRPEG VVFRD V+ L+K++ I  GMRW  ++
Sbjct  61   DLIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAITDGMRWKSQI  120

Query  358  MDHEDGPLVPEKILVAVKKYWT  293
            MDHE GP  PEKIL+AVK YWT
Sbjct  121  MDHESGPFNPEKILLAVKTYWT  142



>ref|XP_006660624.1| PREDICTED: probable methyltransferase PMT2-like [Oryza brachyantha]
Length=616

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAG GGFAA + S + WVMNVVPTI+  STLG IY RG+IGIYHDWCE FSTYPR
Sbjct  463  NIMDMNAGFGGFAAAIESQRSWVMNVVPTISKISTLGAIYERGLIGIYHDWCEAFSTYPR  522

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+F++YK KC  EDILLEMDRILRPEGAV+ RD+VD L KV  +  GM+W  
Sbjct  523  TYDLIHASGLFTMYKTKCSMEDILLEMDRILRPEGAVIMRDDVDVLTKVNGLALGMKWST  582

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSA  266
            +++DHEDGP+V EK+L AVK+YW   +  + +A
Sbjct  583  RMVDHEDGPMVREKVLYAVKQYWAGGNQTAAAA  615



>emb|CDY70936.1| BnaAnng35600D [Brassica napus]
Length=183

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA LGGFAA +     WVMNVVP  A+K TLGVIY RG+IG Y DWCEGFSTYPR
Sbjct  30   NIMDMNAYLGGFAASMLKYPSWVMNVVPVHAEKQTLGVIYERGLIGTYQDWCEGFSTYPR  89

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYD+IHA G+F+LY ++CD   ILLEMDRILRPEG VV RD V+ L KV +I   M+W+ 
Sbjct  90   TYDMIHAGGLFTLYDNRCDLTLILLEMDRILRPEGTVVLRDNVEMLTKVEKIAKRMKWNT  149

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            +++DHE GP  PEKILVAVK YWT   +N+++ +
Sbjct  150  QIVDHEKGPYNPEKILVAVKTYWTGQPSNNSNNK  183



>gb|AAM67038.1| unknown [Arabidopsis thaliana]
Length=146

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  718  MDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPRTY  539
            MDMNA LGGFAA +     WVMNVVP  A+K TLGVI+ RG IG Y DWCEGFSTYPRTY
Sbjct  1    MDMNAYLGGFAAAMMKYPSWVMNVVPVDAEKQTLGVIFERGFIGTYQDWCEGFSTYPRTY  60

Query  538  DLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDYKL  359
            DLIHA G+FS+Y+++CD   ILLEMDRILRPEG VVFRD V+ L K++ I  GMRW  ++
Sbjct  61   DLIHAGGLFSIYENRCDVTLILLEMDRILRPEGTVVFRDTVEMLTKIQSITNGMRWKSRI  120

Query  358  MDHEDGPLVPEKILVAVKKYWT  293
            +DHE GP  PEKIL+AVK YWT
Sbjct  121  LDHERGPFNPEKILLAVKSYWT  142



>ref|NP_001170352.1| uncharacterized protein LOC100384329 [Zea mays]
 gb|ACN36721.1| unknown [Zea mays]
Length=180

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 120/150 (80%), Gaps = 0/150 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             ++DMNA LGGFAA L +   WVMN+VPT+ + +TLGVIY RG+IG Y DWCEG STYPR
Sbjct  31   NLLDMNAKLGGFAAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYPR  90

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+ VF+LY  +C+ E+ILLEMDRILRPEG V+ RD+VD L+K++ +  GMRW+ 
Sbjct  91   TYDLIHADTVFTLYNGRCEAENILLEMDRILRPEGTVIIRDDVDLLVKIKSMADGMRWNS  150

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNS  275
            +++DHEDGPLV EK+L+ VK YWTL+ +  
Sbjct  151  QIVDHEDGPLVREKLLLVVKTYWTLDGSEQ  180



>gb|ABR16934.1| unknown [Picea sitchensis]
Length=626

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L +   WVMNVVP+ A  +TLGVIY RG IG Y DWCE FSTYPR
Sbjct  475  NIMDMNAGLGGFAAALANDPVWVMNVVPSDAKHNTLGVIYERGFIGTYQDWCEAFSTYPR  534

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+G+ S+Y+D+C+  DILLEMDRILRPEG V+FRD VD L+KV  +IGGMRW  
Sbjct  535  TYDLIHASGLLSMYQDRCEISDILLEMDRILRPEGTVIFRDTVDVLVKVENLIGGMRWQS  594

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTS  269
            ++MDHE GP   EKIL+AVK+YWT    + +S
Sbjct  595  QMMDHESGPFNQEKILIAVKQYWTGKAADRSS  626



>ref|XP_001778231.1| predicted protein [Physcomitrella patens]
 gb|EDQ56898.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNAGLGGFAA L     WVMNV+P  A  +TLGVIY RG+IG Y +WCE FSTYPR
Sbjct  448  NIMDMNAGLGGFAAALVKYPVWVMNVMPFDAKLNTLGVIYERGLIGTYQNWCEAFSTYPR  507

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA+GVFS+Y+D+C+ EDILLEMDRILRPEGA++ RDEVD L  V  I  GMRW+ 
Sbjct  508  TYDLIHASGVFSMYQDRCNIEDILLEMDRILRPEGAIIIRDEVDVLNNVMMISNGMRWET  567

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTNSTSAQ  263
            ++ DHEDGPLV EKIL+ VK YW  +++N T A 
Sbjct  568  RIADHEDGPLVSEKILIGVKTYWVGSNSNKTGAS  601



>ref|XP_010110847.1| putative methyltransferase PMT18 [Morus notabilis]
 gb|EXC28326.1| putative methyltransferase PMT18 [Morus notabilis]
Length=224

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 112/149 (75%), Gaps = 0/149 (0%)
 Frame = -3

Query  724  TIMDMNAGLGGFAAQLTSPKQWVMNVVPTIADKSTLGVIYGRGMIGIYHDWCEGFSTYPR  545
             IMDMNA LGGFAA L+    WVMNVVP  +D+ TLGVIY RG IG Y DWCE FSTYPR
Sbjct  76   NIMDMNAHLGGFAAALSKYPVWVMNVVPANSDQDTLGVIYERGFIGTYQDWCEAFSTYPR  135

Query  544  TYDLIHANGVFSLYKDKCDFEDILLEMDRILRPEGAVVFRDEVDTLIKVRRIIGGMRWDY  365
            TYDLIHA GVFS+Y+D+CD   IL+EMDRILRPEG V+FRD V+ L+K++ I   MRW  
Sbjct  136  TYDLIHAGGVFSIYQDRCDITHILVEMDRILRPEGTVIFRDTVEILVKIQSIAKEMRWKS  195

Query  364  KLMDHEDGPLVPEKILVAVKKYWTLNDTN  278
            ++MDHE GP   EKILVAVK YW  +  +
Sbjct  196  QIMDHESGPFNQEKILVAVKTYWAAHKQH  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570