BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011L04

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010267979.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    245   1e-75   Nelumbo nucifera [Indian lotus]
ref|XP_010267976.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    244   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_011085410.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    241   2e-74   Sesamum indicum [beniseed]
emb|CDP18953.1|  unnamed protein product                                241   2e-74   Coffea canephora [robusta coffee]
gb|AID51434.1|  acetoacetyl-coenzyme A thiolase                         240   3e-74   Astragalus membranaceus
ref|XP_010040361.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    234   4e-74   Eucalyptus grandis [rose gum]
gb|AFK46877.1|  unknown                                                 235   5e-74   Lotus japonicus
ref|XP_002320528.1|  truncated acetyl Co-A acetyltransferase-like...    239   9e-74   
ref|XP_010252788.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    239   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_011008068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    238   3e-73   Populus euphratica
ref|XP_002265690.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    238   3e-73   Vitis vinifera
ref|XP_006447819.1|  hypothetical protein CICLE_v10015452mg             238   6e-73   Citrus clementina [clementine]
ref|XP_006469436.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    237   9e-73   Citrus sinensis [apfelsine]
ref|XP_010942603.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    236   2e-72   Elaeis guineensis
ref|XP_008384190.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    236   2e-72   Malus domestica [apple tree]
ref|XP_009374846.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    236   3e-72   Pyrus x bretschneideri [bai li]
gb|ACU87560.2|  acetyl-CoA C-acetyltransferase                          236   3e-72   Bacopa monnieri
ref|XP_009374845.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    236   3e-72   Pyrus x bretschneideri [bai li]
gb|KCW58126.1|  hypothetical protein EUGRSUZ_H00849                     235   3e-72   Eucalyptus grandis [rose gum]
ref|XP_008384188.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    236   4e-72   Malus domestica [apple tree]
gb|AAD44539.1|  acetoacetyl CoA thiolase                                229   4e-72   Zea mays [maize]
ref|XP_004491616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    235   4e-72   Cicer arietinum [garbanzo]
gb|AGH32909.1|  acetyl-CoA C-acetyltransferase                          235   4e-72   Camellia chekiangoleosa
ref|XP_007049380.1|  Acetoacetyl-CoA thiolase 2 isoform 3               231   5e-72   
ref|XP_010069705.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    235   5e-72   Eucalyptus grandis [rose gum]
gb|ADD10719.1|  acetyl-CoA C-acetyltransferase protein                  235   5e-72   Camellia oleifera [abura-tsubaki]
ref|XP_007142529.1|  hypothetical protein PHAVU_008G288400g             235   5e-72   Phaseolus vulgaris [French bean]
gb|KDP29950.1|  hypothetical protein JCGZ_18519                         235   5e-72   Jatropha curcas
ref|XP_003545555.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    235   6e-72   Glycine max [soybeans]
ref|XP_009396114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    235   7e-72   
gb|KHN46894.1|  Acetyl-CoA acetyltransferase, cytosolic 1               235   7e-72   Glycine soja [wild soybean]
ref|XP_008365553.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    235   7e-72   
gb|ABV08820.1|  acetoacetyl-coenzyme A thiolase                         234   8e-72   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007026385.1|  Thiolase family protein isoform 1                  235   9e-72   
gb|KHG30083.1|  Acetyl-CoA acetyltransferase, cytosolic 1 -like p...    234   9e-72   Gossypium arboreum [tree cotton]
ref|XP_011100512.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    234   1e-71   Sesamum indicum [beniseed]
ref|XP_007215468.1|  hypothetical protein PRUPE_ppa006513mg             234   1e-71   Prunus persica
ref|XP_008811278.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   1e-71   
gb|EYU42777.1|  hypothetical protein MIMGU_mgv1a007511mg                234   2e-71   Erythranthe guttata [common monkey flower]
ref|XP_003519682.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    234   2e-71   Glycine max [soybeans]
ref|XP_011002352.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   2e-71   Populus euphratica
ref|XP_009361536.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    234   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_010441409.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    233   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010445761.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   2e-71   
ref|XP_008342241.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    233   2e-71   
ref|XP_008811276.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   2e-71   Phoenix dactylifera
ref|XP_010441408.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    233   3e-71   Camelina sativa [gold-of-pleasure]
ref|XP_003618040.1|  Acetyl-CoA acetyltransferase, cytosolic            233   3e-71   
ref|XP_002308755.1|  truncated acetyl Co-A acetyltransferase-like...    233   3e-71   Populus trichocarpa [western balsam poplar]
dbj|BAF98276.1|  acetyl-CoA C-acetyltransferase                         233   3e-71   Hevea brasiliensis [jebe]
ref|XP_011002351.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   3e-71   Populus euphratica
ref|XP_009590926.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   4e-71   Nicotiana tomentosiformis
ref|XP_010088359.1|  Acetyl-CoA acetyltransferase, cytosolic 1          233   4e-71   
ref|XP_004293407.2|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    233   5e-71   Fragaria vesca subsp. vesca
ref|XP_003618039.1|  Acetyl-CoA acetyltransferase, cytosolic            233   6e-71   Medicago truncatula
ref|XP_007049379.1|  Acetoacetyl-CoA thiolase 2 isoform 2               232   8e-71   
gb|ACU19591.1|  unknown                                                 232   9e-71   Glycine max [soybeans]
ref|XP_007049378.1|  Acetoacetyl-CoA thiolase 2 isoform 1               232   9e-71   Theobroma cacao [chocolate]
dbj|BAF98277.1|  acetyl-CoA C-acetyltransferase                         232   9e-71   Hevea brasiliensis [jebe]
tpg|DAA45682.1|  TPA: hypothetical protein ZEAMMB73_471357              229   9e-71   
gb|AFK39138.1|  unknown                                                 232   1e-70   Medicago truncatula
gb|AEM42969.1|  acetyl-CoA C-acetyltransferase                          232   1e-70   Siraitia grosvenorii [arhat fruit]
dbj|BAD22334.1|  putative acetyl-CoA C-acyltransferase                  231   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008229933.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   1e-70   Prunus mume [ume]
gb|ABC74567.1|  acetoacetyl-CoA thiolase                                231   1e-70   Picrorhiza kurrooa
gb|AEC13714.1|  acetoacetyl-CoA thiolase                                231   1e-70   Catharanthus roseus [chatas]
ref|XP_010481278.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010495013.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   2e-70   
ref|XP_010481277.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   2e-70   Camelina sativa [gold-of-pleasure]
ref|NP_851150.1|  acetoacetyl-CoA thiolase 1                            231   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010647165.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-70   Vitis vinifera
ref|XP_010495012.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   3e-70   Camelina sativa [gold-of-pleasure]
ref|NP_199583.1|  acetoacetyl-CoA thiolase 1                            231   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006353096.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-70   Solanum tuberosum [potatoes]
ref|XP_010647163.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-70   Vitis vinifera
ref|XP_008782420.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-70   Phoenix dactylifera
gb|KJB42690.1|  hypothetical protein B456_007G165600                    231   3e-70   Gossypium raimondii
ref|XP_002865105.1|  hypothetical protein ARALYDRAFT_494196             231   3e-70   
ref|XP_010039422.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-70   Eucalyptus grandis [rose gum]
ref|NP_001062685.1|  Os09g0252100                                       231   3e-70   
ref|NP_001032028.1|  acetoacetyl-CoA thiolase 1                         231   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010647164.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    230   3e-70   Vitis vinifera
ref|XP_009759542.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    230   3e-70   Nicotiana sylvestris
ref|XP_003635396.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    230   4e-70   Vitis vinifera
ref|XP_004977186.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    230   5e-70   Setaria italica
gb|ACJ84564.1|  unknown                                                 230   5e-70   Medicago truncatula
ref|XP_006398473.1|  hypothetical protein EUTSA_v10000897mg             230   6e-70   
gb|AIK21787.1|  acetyl-CoA C-acetyltransferase                          230   6e-70   Panax notoginseng [san-qi]
gb|ACX47470.1|  acetoacetyl-CoA thiolase                                229   7e-70   Medicago sativa [alfalfa]
tpg|DAA47710.1|  TPA: hypothetical protein ZEAMMB73_220204              229   7e-70   
ref|XP_004303573.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    229   7e-70   Fragaria vesca subsp. vesca
ref|XP_006398474.1|  hypothetical protein EUTSA_v10000897mg             230   8e-70   
ref|XP_010538441.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    229   9e-70   Tarenaya hassleriana [spider flower]
ref|NP_001266315.1|  acetyl-CoA acetyltransferase, cytosolic 1          229   9e-70   
gb|ACF85124.1|  unknown                                                 229   9e-70   Zea mays [maize]
ref|XP_006660462.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    229   1e-69   Oryza brachyantha
ref|XP_010538440.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    229   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_009399886.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    229   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148667.1|  acetyl-CoA acetyltransferase, cytosolic 1          228   2e-69   Zea mays [maize]
ref|XP_009412135.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   2e-69   
ref|XP_004236650.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    228   2e-69   Solanum lycopersicum
ref|XP_009399870.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009114255.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    228   3e-69   Brassica rapa
ref|XP_007154060.1|  hypothetical protein PHAVU_003G087600g             228   3e-69   Phaseolus vulgaris [French bean]
ref|XP_009114253.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    228   3e-69   
ref|XP_009412114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412128.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   3e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006357655.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   4e-69   
ref|XP_004243582.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   4e-69   
ref|XP_007211795.1|  hypothetical protein PRUPE_ppa006371mg             228   4e-69   Prunus persica
emb|CDY25950.1|  BnaC09g20370D                                          228   5e-69   Brassica napus [oilseed rape]
ref|XP_009761989.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   5e-69   Nicotiana sylvestris
ref|XP_004144550.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   5e-69   Cucumis sativus [cucumbers]
ref|XP_008462041.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    227   5e-69   Cucumis melo [Oriental melon]
ref|XP_008224638.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    228   6e-69   Prunus mume [ume]
gb|EMS56611.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      226   6e-69   Triticum urartu
ref|XP_004969865.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    227   6e-69   Setaria italica
ref|XP_004239258.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    227   7e-69   
ref|XP_006350251.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    227   7e-69   Solanum tuberosum [potatoes]
ref|XP_010936771.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    227   9e-69   Elaeis guineensis
gb|AFI23434.1|  thiolase II                                             226   1e-68   Betula platyphylla [Asian white birch]
ref|XP_004159110.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    226   2e-68   
gb|ABV02024.1|  peroxisomal acetoacetyl-coenzyme A thiolase             223   2e-68   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004139514.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    226   2e-68   Cucumis sativus [cucumbers]
gb|KGN64993.1|  hypothetical protein Csa_1G173130                       226   3e-68   Cucumis sativus [cucumbers]
ref|XP_010092017.1|  putative acetyl-CoA acetyltransferase, cytos...    226   3e-68   
ref|XP_002865618.1|  acetoacetyl-CoA thiolase 2, embryo defective...    225   3e-68   
emb|CDY05693.1|  BnaC02g38440D                                          223   3e-68   
ref|XP_003637597.1|  Acetyl-CoA acetyltransferase cytosolic             225   4e-68   
gb|AFQ62006.1|  acetyl-CoA acetyltransferase                            224   4e-68   Euphorbia lathyris
ref|XP_004491615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    226   4e-68   
ref|XP_009129716.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    225   5e-68   Brassica rapa
gb|EMT20974.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      225   5e-68   
ref|XP_002522876.1|  acetyl-CoA acetyltransferase, mitochondrial,...    224   5e-68   Ricinus communis
ref|XP_010493636.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010482068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   6e-68   Camelina sativa [gold-of-pleasure]
emb|CDY48742.1|  BnaA02g30030D                                          224   6e-68   Brassica napus [oilseed rape]
ref|XP_003551110.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    225   6e-68   Glycine max [soybeans]
gb|KJB68524.1|  hypothetical protein B456_010G248300                    224   6e-68   Gossypium raimondii
emb|CDY00071.1|  BnaC09g02300D                                          224   6e-68   
ref|XP_010442239.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   7e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009111830.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   7e-68   Brassica rapa
gb|KEH32695.1|  peroxisomal acetoacetyl-coenzyme A thiolase             224   7e-68   Medicago truncatula
gb|KJB68523.1|  hypothetical protein B456_010G248300                    224   8e-68   Gossypium raimondii
gb|KHN03551.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      225   8e-68   Glycine soja [wild soybean]
ref|XP_009787709.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   8e-68   Nicotiana sylvestris
ref|XP_009608453.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   8e-68   Nicotiana tomentosiformis
emb|CDY19963.1|  BnaA09g02880D                                          224   9e-68   Brassica napus [oilseed rape]
gb|AAU95619.1|  peroxisomal acetoacetyl-coenzyme A thiolase             224   9e-68   Nicotiana tabacum [American tobacco]
ref|XP_006600286.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    224   9e-68   
ref|XP_009129715.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    225   1e-67   
ref|XP_006279490.1|  hypothetical protein CARUB_v10026490mg             224   1e-67   Capsella rubella
gb|AHZ96597.1|  acetyl-CoA C-acetyl transferase                         224   1e-67   Aquilaria sinensis
ref|XP_008464274.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    225   1e-67   
ref|XP_006600285.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    224   1e-67   Glycine max [soybeans]
ref|XP_003580738.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   1e-67   Brachypodium distachyon [annual false brome]
ref|NP_568694.2|  acetoacetyl-CoA thiolase 2                            224   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003529679.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    223   1e-67   
ref|XP_008661103.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    224   2e-67   
ref|NP_851154.1|  acetoacetyl-CoA thiolase 2                            223   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006584106.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    224   2e-67   Glycine max [soybeans]
ref|XP_008464273.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    225   2e-67   
ref|XP_010547202.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    223   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_006395207.1|  hypothetical protein EUTSA_v10004340mg             223   2e-67   Eutrema salsugineum [saltwater cress]
ref|XP_009151624.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    223   2e-67   Brassica rapa
gb|ACN41149.1|  unknown                                                 223   2e-67   Picea sitchensis
ref|XP_008464272.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    225   2e-67   
gb|KGN43403.1|  hypothetical protein Csa_7G031640                       222   2e-67   Cucumis sativus [cucumbers]
emb|CDX86320.1|  BnaA06g30370D                                          223   3e-67   
ref|XP_011095903.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    223   3e-67   Sesamum indicum [beniseed]
gb|KJB42689.1|  hypothetical protein B456_007G165600                    223   4e-67   Gossypium raimondii
ref|XP_011095902.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    223   4e-67   Sesamum indicum [beniseed]
ref|XP_004507588.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    223   5e-67   Cicer arietinum [garbanzo]
gb|EYU42778.1|  hypothetical protein MIMGU_mgv1a007511mg                222   6e-67   Erythranthe guttata [common monkey flower]
gb|ACN40771.1|  unknown                                                 222   8e-67   Picea sitchensis
ref|XP_006280568.1|  hypothetical protein CARUB_v10026521mg             221   9e-67   Capsella rubella
emb|CDX85319.1|  BnaC07g26300D                                          222   9e-67   
dbj|BAA97003.1|  acetyl-CoA C-acetyltransferase                         224   1e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KHG07894.1|  hypothetical protein F383_03812                         221   1e-66   Gossypium arboreum [tree cotton]
ref|XP_006857772.1|  hypothetical protein AMTR_s00061p00203040          223   1e-66   
gb|KJB68526.1|  hypothetical protein B456_010G248300                    220   2e-66   Gossypium raimondii
ref|XP_010675964.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    221   2e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU27653.1|  hypothetical protein MIMGU_mgv1a007243mg                221   3e-66   Erythranthe guttata [common monkey flower]
gb|AAL18924.1|AF429383_1  acetyl Co-A acetyltransferase                 220   3e-66   Hevea brasiliensis [jebe]
gb|KFK31312.1|  hypothetical protein AALP_AA6G096400                    219   7e-66   Arabis alpina [alpine rockcress]
gb|ACX46381.1|  acetoacetyl-CoA thiolase                                219   9e-66   Helianthus annuus
gb|EMS66391.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      222   1e-65   Triticum urartu
gb|KDO78588.1|  hypothetical protein CISIN_1g015003mg                   218   2e-65   Citrus sinensis [apfelsine]
ref|XP_001773218.1|  predicted protein                                  218   2e-65   
gb|KJB68525.1|  hypothetical protein B456_010G248300                    217   2e-65   Gossypium raimondii
gb|KDO78587.1|  hypothetical protein CISIN_1g015003mg                   218   3e-65   Citrus sinensis [apfelsine]
ref|XP_006467262.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    218   3e-65   Citrus sinensis [apfelsine]
gb|EMT07958.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      218   3e-65   
ref|XP_010689228.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    218   4e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002968816.1|  hypothetical protein SELMODRAFT_146037             217   5e-65   Selaginella moellendorffii
gb|KDP35512.1|  hypothetical protein JCGZ_08950                         217   6e-65   Jatropha curcas
ref|XP_010087672.1|  putative acetyl-CoA acetyltransferase, cytos...    217   1e-64   
gb|ABD57973.1|  acetoacetyl-coenzyme A thiolase                         216   2e-64   Arnebia euchroma
emb|CDP04540.1|  unnamed protein product                                216   2e-64   Coffea canephora [robusta coffee]
ref|XP_006449940.1|  hypothetical protein CICLE_v10015403mg             215   3e-64   Citrus clementina [clementine]
ref|XP_006449941.1|  hypothetical protein CICLE_v10015403mg             215   3e-64   Citrus clementina [clementine]
ref|XP_002536874.1|  acetyl-CoA acetyltransferase, mitochondrial,...    207   4e-64   
gb|KDO50953.1|  hypothetical protein CISIN_1g0154951mg                  206   5e-64   Citrus sinensis [apfelsine]
gb|KHN42262.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      214   1e-63   Glycine soja [wild soybean]
ref|XP_006643659.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    211   2e-63   
ref|XP_002974156.1|  hypothetical protein SELMODRAFT_173909             211   9e-63   
ref|NP_001041797.1|  Os01g0110400                                       211   9e-63   
gb|EEC69797.1|  hypothetical protein OsI_00091                          211   9e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001141874.1|  acetyl-CoA acetyltransferase, cytosolic 2 is...    211   1e-62   Zea mays [maize]
gb|EMS54102.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      209   2e-62   Triticum urartu
ref|XP_006449942.1|  hypothetical protein CICLE_v10015403mg             211   2e-62   
gb|AFW88030.1|  hypothetical protein ZEAMMB73_639334                    210   2e-62   
ref|XP_008654616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    211   3e-62   
ref|XP_004967970.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    210   3e-62   Setaria italica
ref|XP_008654615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    211   4e-62   Zea mays [maize]
dbj|BAJ96752.1|  predicted protein                                      206   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004967971.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    210   4e-62   Setaria italica
emb|CAA55006.1|  Acetoacetyl-coenzyme A thiolase                        208   1e-61   Raphanus sativus
ref|XP_004507587.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    209   2e-61   
emb|CDM80037.1|  unnamed protein product                                207   7e-61   Triticum aestivum [Canadian hard winter wheat]
gb|EMT15552.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      207   8e-61   
ref|XP_003565785.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    205   3e-60   Brachypodium distachyon [annual false brome]
gb|AEZ55671.1|  acetyl-CoA C-acetyltransferase 2                        203   1e-59   Salvia miltiorrhiza [Chinese salvia]
gb|EIM78382.1|  acetyl-CoA acetyltransferase                            185   7e-55   Nitritalea halalkaliphila LW7
ref|WP_026898359.1|  acetyl-CoA acetyltransferase                       183   3e-52   Pedobacter oryzae
gb|EWC45148.1|  acetyl-CoA acetyltransferase                            183   3e-52   Drechslerella stenobrocha 248
gb|KFY13686.1|  hypothetical protein V491_06314                         183   4e-52   Pseudogymnoascus sp. VKM F-3775
gb|EFX00901.1|  acetyl-acetyltransferase                                183   5e-52   Grosmannia clavigera kw1407
ref|WP_026879909.1|  acetyl-CoA acetyltransferase                       182   6e-52   Hymenobacter norwichensis
gb|KFY07615.1|  hypothetical protein V492_06978                         182   7e-52   Pseudogymnoascus sp. VKM F-4246
gb|ESA09717.1|  hypothetical protein GLOINDRAFT_202383                  177   7e-52   
ref|XP_002483239.1|  acetyl-CoA acetyltransferase, putative             180   9e-52   Talaromyces stipitatus ATCC 10500
gb|ELR09971.1|  acetyl-CoA C-acetyltransferase                          182   1e-51   Pseudogymnoascus destructans 20631-21
gb|KFY70134.1|  hypothetical protein V499_09436                         181   2e-51   Pseudogymnoascus sp. VKM F-103
gb|KCW45285.1|  hypothetical protein EUGRSUZ_L01056                     174   2e-51   Eucalyptus grandis [rose gum]
gb|KFY46917.1|  hypothetical protein V495_02185                         181   3e-51   Pseudogymnoascus sp. VKM F-4514 (FW-929)
gb|KFY01072.1|  hypothetical protein V490_01093                         181   3e-51   Pseudogymnoascus sp. VKM F-3557
gb|KFY05043.1|  hypothetical protein O988_00301                         181   3e-51   Pseudogymnoascus sp. VKM F-3808
ref|WP_010855680.1|  Acetyl-CoA acetyltransferase                       181   3e-51   Lunatimonas lonarensis
gb|KFY87056.1|  hypothetical protein V500_07216                         181   4e-51   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|WP_013991848.1|  acetyl-CoA acetyltransferase                       180   4e-51   Zobellia galactanivorans
gb|EWG41746.1|  acetyl-CoA C-acetyltransferase                          177   5e-51   Fusarium verticillioides 7600
gb|KFZ10783.1|  hypothetical protein V502_07930                         181   5e-51   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
emb|CDS14271.1|  Putative Acetyl-CoA C-acetyltransferase                180   6e-51   Lichtheimia ramosa
gb|KFY24540.1|  hypothetical protein V493_05181                         180   6e-51   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_002483238.1|  acetyl-CoA acetyltransferase, putative             180   6e-51   Talaromyces stipitatus ATCC 10500
dbj|GAM82703.1|  hypothetical protein ANO11243_006870                   180   8e-51   fungal sp. No.11243
gb|KFY58963.1|  hypothetical protein V496_05895                         180   9e-51   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|EWZ42897.1|  acetyl-CoA C-acetyltransferase                          177   1e-50   Fusarium oxysporum Fo47
gb|EWY95310.1|  acetyl-CoA C-acetyltransferase                          177   1e-50   Fusarium oxysporum FOSC 3-a
gb|EZF12970.1|  hypothetical protein H100_06526                         177   1e-50   Trichophyton rubrum MR850
ref|WP_014201445.1|  acetyl-CoA acetyltransferase                       179   1e-50   Owenweeksia hongkongensis
gb|ERT01950.1|  hypothetical protein HMPREF1624_00245                   179   1e-50   Sporothrix schenckii ATCC 58251
ref|XP_007291315.1|  acetyl-CoA acetyltransferase                       179   2e-50   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gb|KIH88237.1|  acetyl-CoA C-acetyltransferase                          179   2e-50   Sporothrix brasiliensis 5110
emb|CAN83794.1|  hypothetical protein VITISV_022891                     179   2e-50   Vitis vinifera
emb|CDH58208.1|  acetyl-cytosolic 1-like                                179   2e-50   Lichtheimia corymbifera JMRC:FSU:9682
gb|KFH73378.1|  acetyl-CoA C-acetyltransferase                          179   3e-50   Mortierella verticillata NRRL 6337
ref|WP_035077204.1|  acetyl-CoA acetyltransferase                       178   4e-50   Anditalea andensis
gb|KHJ33766.1|  putative acetyl- acetyltransferase                      178   4e-50   Erysiphe necator
ref|XP_002844004.1|  acetyl-CoA acetyltransferase                       178   4e-50   Microsporum canis CBS 113480
ref|XP_003070800.1|  Acetyl-CoA acetyltransferase , putative            178   5e-50   Coccidioides posadasii C735 delta SOWgp
ref|XP_001248491.1|  hypothetical protein CIMG_02262                    178   5e-50   Coccidioides immitis RS
ref|XP_001587122.1|  hypothetical protein SS1G_12152                    178   5e-50   Sclerotinia sclerotiorum 1980 UF-70
gb|EWG41745.1|  acetyl-CoA C-acetyltransferase                          177   6e-50   Fusarium verticillioides 7600
gb|EPY53539.1|  acetyl-CoA C-acetyltransferase Erg10                    177   6e-50   Schizosaccharomyces cryophilus OY26
gb|EXX68470.1|  acetyl-CoA C-acetyltransferase                          177   6e-50   Rhizophagus irregularis DAOM 197198w
ref|XP_007779511.1|  acetyl-CoA C-acetyltransferase                     177   6e-50   Coniosporium apollinis CBS 100218
ref|WP_007649376.1|  Acetyl-CoA acetyltransferase                       177   7e-50   Xanthomarina gelatinilytica
gb|EGD95948.1|  acetyl-CoA acetyltransferase                            177   8e-50   Trichophyton tonsurans CBS 112818
ref|XP_002150866.1|  acetyl-CoA acetyltransferase, putative             177   8e-50   Talaromyces marneffei ATCC 18224
gb|KEQ65331.1|  thiolase                                                177   8e-50   Aureobasidium melanogenum CBS 110374
ref|XP_003237150.1|  acetyl-CoA acetyltransferase                       177   9e-50   Trichophyton rubrum CBS 118892
emb|CCJ29218.1|  unnamed protein product                                177   9e-50   Pneumocystis jirovecii
ref|WP_009185550.1|  acetyl-CoA acetyltransferase                       177   9e-50   Cecembia lonarensis
gb|EGE01205.1|  acetyl-CoA acetyltransferase                            177   9e-50   Trichophyton equinum CBS 127.97
ref|XP_003015269.1|  hypothetical protein ARB_06392                     176   9e-50   Trichophyton benhamiae CBS 112371
gb|EZF35979.1|  hypothetical protein H101_00494                         177   1e-49   Trichophyton interdigitale H6
gb|EZG03697.1|  hypothetical protein H106_06361                         177   1e-49   Trichophyton rubrum CBS 735.88
ref|XP_007914536.1|  putative acetyl- acetyltransferase protein         177   1e-49   
gb|EPX71259.1|  acetyl-CoA C-acetyltransferase Erg10                    177   1e-49   
ref|XP_003005784.1|  acetyl-CoA acetyltransferase                       177   1e-49   
gb|EWZ42896.1|  acetyl-CoA C-acetyltransferase                          177   1e-49   
gb|EGU82764.1|  hypothetical protein FOXB_06715                         177   1e-49   
ref|XP_008076853.1|  Thiolase-like protein                              177   1e-49   
ref|XP_007793005.1|  putative acetyl- acetyltransferase protein         177   1e-49   
emb|CCT64668.1|  probable acetoacetyl-CoA thiolase                      177   1e-49   
gb|KEZ42356.1|  Acetyl-CoA acetyltransferase                            177   1e-49   
ref|WP_026976734.1|  acetyl-CoA acetyltransferase                       176   2e-49   
ref|XP_009216982.1|  acetyl-CoA acetyltransferase                       176   2e-49   
ref|WP_019670031.1|  acetyl-CoA acetyltransferase                       176   2e-49   
gb|KIV91714.1|  hypothetical protein PV10_06227                         177   2e-49   
ref|WP_009583742.1|  Acetyl-CoA acetyltransferase                       176   2e-49   
ref|XP_011328435.1|  acetyl-CoA acetyltransferase IB                    176   2e-49   
ref|XP_009261111.1|  hypothetical protein FPSE_09719                    176   2e-49   
emb|CCU80048.1|  acetyl-CoA acetyltransferase/erg10                     176   2e-49   
gb|KIW51366.1|  hypothetical protein PV05_10096                         176   2e-49   
ref|WP_014033773.1|  acetyl-CoA acetyltransferase                       176   3e-49   
gb|KIM97976.1|  hypothetical protein OIDMADRAFT_168344                  176   3e-49   
ref|XP_007803315.1|  Acetyl-CoA acetyltransferase                       176   3e-49   
ref|WP_014783533.1|  acetyl-CoA acetyltransferase                       176   3e-49   
ref|WP_006987456.1|  acetyl-CoA acetyltransferase                       176   3e-49   
ref|XP_003054621.1|  predicted protein                                  176   4e-49   
ref|WP_007093027.1|  acetyl-CoA acetyltransferase                       176   4e-49   
ref|XP_003024790.1|  hypothetical protein TRV_01072                     176   4e-49   
ref|WP_008639903.1|  acetyl-CoA acetyltransferase                       175   4e-49   
ref|WP_002995933.1|  acetyl-CoA acetyltransferase                       175   4e-49   
ref|WP_039129170.1|  acetyl-CoA acetyltransferase                       175   4e-49   
ref|WP_003003203.1|  acetyl-CoA acetyltransferase                       175   4e-49   
gb|KIV77183.1|  hypothetical protein PV11_09005                         176   4e-49   
ref|WP_039347783.1|  acetyl-CoA acetyltransferase                       175   4e-49   
ref|WP_017495962.1|  acetyl-CoA acetyltransferase                       175   5e-49   
gb|KIW03890.1|  hypothetical protein PV09_04735                         175   5e-49   
gb|EPQ61678.1|  Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA t...    175   5e-49   
ref|WP_010519691.1|  acetyl-CoA acetyltransferase                       175   5e-49   
gb|KIY03573.1|  hypothetical protein Z520_00264                         175   5e-49   
ref|WP_026449924.1|  acetyl-CoA acetyltransferase                       175   5e-49   
ref|WP_035567509.1|  acetyl-CoA acetyltransferase                       175   6e-49   
gb|AFR32172.1|  acetyl-CoA acetyltransferase                            170   6e-49   
gb|AFR32182.1|  acetyl-CoA acetyltransferase                            170   6e-49   
ref|XP_003716277.1|  acetyl-CoA acetyltransferase                       175   7e-49   
gb|AFR32163.1|  acetyl-CoA acetyltransferase                            170   7e-49   
ref|XP_009648151.1|  acetyl-CoA acetyltransferase                       175   7e-49   
ref|WP_015363227.1|  acetoacetyl-CoA thiolase                           175   7e-49   
gb|KIL93171.1|  hypothetical protein FAVG1_03148                        175   7e-49   
ref|WP_020894851.1|  Acetyl-CoA acetyltransferase                       174   8e-49   
gb|ELQ36565.1|  acetyl-CoA acetyltransferase                            175   8e-49   
ref|WP_027879072.1|  acetyl-CoA acetyltransferase                       174   8e-49   
ref|XP_007759544.1|  acetyl-CoA C-acetyltransferase                     175   8e-49   
ref|WP_026991887.1|  acetyl-CoA acetyltransferase                       174   9e-49   
ref|WP_027075443.1|  acetyl-CoA acetyltransferase                       174   9e-49   
ref|WP_034044886.1|  acetyl-CoA acetyltransferase                       174   1e-48   
ref|WP_026810850.1|  acetyl-CoA acetyltransferase                       174   1e-48   
ref|XP_011121747.1|  hypothetical protein AOL_s00078g182                174   1e-48   
ref|WP_008271322.1|  acetyl-CoA acetyltransferase                       174   1e-48   
gb|ESZ89704.1|  acetyl-CoA acetyltransferase                            174   1e-48   
ref|XP_006398472.1|  hypothetical protein EUTSA_v10000897mg             174   1e-48   
dbj|GAL66988.1|  acetyl-CoA acetyltransferase                           172   1e-48   
ref|WP_035687956.1|  acetyl-CoA acetyltransferase                       174   1e-48   
ref|WP_022827934.1|  acetyl-CoA acetyltransferase                       174   1e-48   
ref|WP_020212724.1|  acetyl-CoA acetyltransferase                       174   1e-48   
ref|WP_026715840.1|  acetyl-CoA acetyltransferase                       174   2e-48   
ref|WP_013621977.1|  MULTISPECIES: acetyl-CoA acetyltransferase         174   2e-48   
gb|EKG22338.1|  Thiolase                                                171   2e-48   
gb|KIW38412.1|  hypothetical protein PV06_09378                         174   2e-48   
emb|CEG70626.1|  Putative Acetyl-CoA C-acetyltransferase                171   2e-48   
ref|XP_009160237.1|  acetyl-CoA C-acetyltransferase                     174   2e-48   
ref|WP_002663851.1|  acetyl-CoA acetyltransferase                       174   2e-48   
ref|WP_002665020.1|  acetyl-CoA acetyltransferase                       174   2e-48   
ref|WP_026709973.1|  acetyl-CoA acetyltransferase                       174   2e-48   
gb|KEQ82191.1|  thiolase                                                174   2e-48   
ref|WP_028890799.1|  acetyl-CoA acetyltransferase                       173   2e-48   
gb|KEQ98968.1|  hypothetical protein AUEXF2481DRAFT_45917               174   2e-48   
ref|WP_034258137.1|  acetyl-CoA acetyltransferase                       173   2e-48   
gb|KIW83871.1|  hypothetical protein Z517_03117                         174   2e-48   
ref|WP_014217866.1|  acetyl-CoA acetyltransferase                       173   2e-48   
ref|XP_011277086.1|  Acetyl-CoA acetyltransferase IB                    174   2e-48   
gb|EFA80763.1|  hypothetical protein PPL_06349                          175   2e-48   
gb|KIW65562.1|  hypothetical protein PV04_07812                         174   2e-48   
gb|KFH44424.1|  Acetyl-CoA acetyltransferase-like protein               173   2e-48   
gb|EFQ25513.1|  acetyl-CoA acetyltransferase                            173   2e-48   
ref|WP_028290392.1|  acetyl-CoA acetyltransferase                       173   2e-48   
ref|WP_028375928.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_028608122.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_013188110.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_024480161.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_025614672.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_026705598.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|XP_003656836.1|  acetyl-CoA C-acetyltransferase                     173   3e-48   
ref|XP_001550643.1|  hypothetical protein BC1G_11051                    173   3e-48   
gb|KEQ76920.1|  acetyl-CoA acetyltransferase IB                         173   3e-48   
ref|WP_041519196.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_034668608.1|  acetyl-CoA acetyltransferase                       173   3e-48   
ref|WP_044516645.1|  acetyl-CoA acetyltransferase                       173   4e-48   
ref|WP_044004763.1|  acetyl-CoA acetyltransferase                       173   4e-48   
ref|WP_007807467.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|XP_008725301.1|  hypothetical protein G647_02733                    173   4e-48   
ref|WP_042248191.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|WP_034684923.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|WP_034725410.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|XP_007748144.1|  acetyl-CoA C-acetyltransferase                     173   4e-48   
gb|KIW23519.1|  hypothetical protein PV07_11711                         173   4e-48   
gb|AHJ98230.1|  acetyl-CoA acetyltransferase                            172   4e-48   
ref|WP_026351419.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|WP_027385494.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|WP_034685179.1|  acetyl-CoA acetyltransferase                       172   4e-48   
ref|XP_007737475.1|  acetyl-CoA C-acetyltransferase                     173   4e-48   
ref|WP_038693895.1|  acetyl-CoA acetyltransferase                       172   5e-48   
ref|WP_014938126.1|  acetyl-CoA acetyltransferase                       172   5e-48   
gb|ACU07416.1|  Acetyl-CoA acetyltransferase                            172   5e-48   
dbj|BAN45674.1|  acetyl-CoA acetyltransferase                           172   5e-48   
ref|WP_041252540.1|  acetyl-CoA acetyltransferase                       172   5e-48   
ref|WP_015267459.1|  acetyl-CoA acetyltransferase                       172   5e-48   
ref|WP_035135233.1|  acetyl-CoA acetyltransferase                       172   5e-48   
ref|WP_038234520.1|  acetyl-CoA acetyltransferase                       172   5e-48   
emb|CDH59162.1|  acetyl-acetyltransferase                               172   5e-48   
emb|CCF41159.1|  acetyl-CoA acetyltransferase                           172   5e-48   
ref|XP_002959306.1|  hypothetical protein VOLCADRAFT_84837              173   6e-48   
gb|KIW20460.1|  hypothetical protein PV08_01035                         173   6e-48   
ref|WP_013551674.1|  acetyl-CoA acetyltransferase                       172   6e-48   
ref|XP_009834114.1|  hypothetical protein H257_09568                    172   6e-48   
ref|WP_026707430.1|  acetyl-CoA acetyltransferase                       172   6e-48   
ref|XP_003852634.1|  erg10, acetyl-CoA C-acetyltransferase              172   6e-48   
ref|XP_002837135.1|  hypothetical protein                               172   6e-48   
ref|WP_042279346.1|  acetyl-CoA acetyltransferase                       172   7e-48   
ref|WP_027372497.1|  MULTISPECIES: acetyl-CoA acetyltransferase         172   7e-48   
ref|WP_014773656.1|  acetyl-CoA acetyltransferase                       172   7e-48   
ref|WP_013072016.1|  acetyl-CoA acetyltransferase                       172   7e-48   
ref|XP_008598633.1|  acetyl-CoA acetyltransferase                       172   7e-48   
gb|ENH77330.1|  acetyl-acetyltransferase                                172   7e-48   
ref|XP_002171694.1|  acetyl-CoA C-acetyltransferase Erg10               172   8e-48   
ref|WP_037322484.1|  acetyl-CoA acetyltransferase                       172   8e-48   
ref|WP_008201390.1|  acetyl-CoA acetyltransferase                       172   8e-48   
gb|KFF74448.1|  acetyl-CoA acetyltransferase                            172   8e-48   
ref|XP_007599769.1|  acetyl-CoA acetyltransferase                       172   8e-48   
ref|XP_006672862.1|  acetyl-CoA acetyltransferase                       172   8e-48   
ref|WP_039109830.1|  acetyl-CoA acetyltransferase                       172   8e-48   
gb|KGQ06204.1|  Acetyl-CoA acetyltransferase                            173   8e-48   
ref|XP_002951856.1|  hypothetical protein VOLCADRAFT_81647              166   8e-48   
ref|WP_019598700.1|  acetyl-CoA acetyltransferase                       172   8e-48   
ref|WP_038985383.1|  acetyl-CoA acetyltransferase                       172   9e-48   
gb|KID93669.1|  acetyl-CoA acetyltransferase                            172   9e-48   
ref|WP_012026577.1|  acetyl-CoA acetyltransferase                       172   9e-48   
ref|XP_007825165.2|  Thiolase                                           171   9e-48   
ref|WP_040279763.1|  acetyl-CoA acetyltransferase                       172   9e-48   
gb|KID72079.1|  acetyl-CoA acetyltransferase                            172   9e-48   
ref|XP_007812948.1|  acetyl-CoA acetyltransferase                       172   9e-48   
ref|WP_042503846.1|  acetyl-CoA acetyltransferase                       172   1e-47   
ref|XP_007872306.1|  hypothetical protein PNEG_00428                    172   1e-47   
gb|KID84678.1|  acetyl-CoA acetyltransferase                            172   1e-47   
ref|XP_002951943.1|  hypothetical protein VOLCADRAFT_75176              172   1e-47   
ref|WP_034757717.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_029293462.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_003436677.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_027137433.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_027378013.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|XP_007840433.1|  Acetyl-CoA acetyltransferase                       172   1e-47   
emb|CBL88173.1|  acetoacetyl-CoA thiolase                               171   1e-47   
gb|EXU98749.1|  acetyl-CoA acetyltransferase                            171   1e-47   
ref|WP_020082106.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_027381559.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_014388329.1|  acetyl-CoA acetyltransferase                       171   1e-47   
gb|KIW97610.1|  hypothetical protein Z519_01194                         172   1e-47   
dbj|BAP31830.1|  acetyl-CoA acetyltransferase                           171   1e-47   
ref|WP_016989103.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_038029767.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_024981866.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_002979154.1|  acetyl-CoA acetyltransferase                       171   1e-47   
ref|WP_014165377.1|  acetyl-CoA acetyltransferase                       171   2e-47   
gb|KID70504.1|  acetyl-CoA acetyltransferase                            171   2e-47   
ref|WP_044625128.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_018676768.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_042562981.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_029448683.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_039372367.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_028873447.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_035647002.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|XP_006676566.1|  hypothetical protein BATDEDRAFT_18805              171   2e-47   
ref|WP_028282246.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_019039328.1|  acetyl-CoA acetyltransferase                       171   2e-47   
emb|CEG70625.1|  Putative Acetyl-CoA C-acetyltransferase                171   2e-47   
ref|WP_035463120.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_039117421.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_039112818.1|  acetyl-CoA acetyltransferase                       171   2e-47   
ref|WP_013307633.1|  acetyl-CoA acetyltransferase                       171   2e-47   
gb|KFG78563.1|  acetyl-CoA acetyltransferase                            171   2e-47   
gb|KEY68336.1|  hypothetical protein S7711_01115                        171   2e-47   
emb|CCE28798.1|  probable acetoacetyl-CoA thiolase                      171   2e-47   
ref|WP_029445981.1|  acetyl-CoA acetyltransferase                       171   2e-47   
gb|KDN64557.1|  putative acetyl-CoA acetyltransferase                   171   2e-47   
emb|CDS06165.1|  hypothetical protein LRAMOSA08693                      171   2e-47   
gb|EPB83074.1|  acetyl-CoA C-acetyltransferase                          171   3e-47   
gb|EEH06574.1|  acetyl-coa acetyltransferase                            166   3e-47   
ref|WP_008867723.1|  acetyl-CoA acetyltransferase                       171   3e-47   
ref|WP_008238601.1|  acetyl-CoA acetyltransferase                       171   3e-47   
ref|WP_036383602.1|  acetyl-CoA acetyltransferase                       171   3e-47   
ref|XP_008720960.1|  hypothetical protein HMPREF1541_08419              171   3e-47   
gb|EQB51626.1|  acetyl-CoA acetyltransferase                            171   3e-47   
ref|WP_026730226.1|  acetyl-CoA acetyltransferase                       171   3e-47   
dbj|BAA13846.1|  unnamed protein product                                171   3e-47   
ref|WP_031455803.1|  acetyl-CoA acetyltransferase                       170   3e-47   
ref|WP_036674127.1|  acetyl-CoA acetyltransferase                       170   3e-47   
ref|WP_040994874.1|  acetyl-CoA acetyltransferase                       170   3e-47   
dbj|BAO77546.1|  acetyl-CoA acetyltransferase                           170   3e-47   
ref|NP_596686.1|  acetyl-CoA C-acetyltransferase Erg10 (predicted)      171   3e-47   
gb|KDB12473.1|  acetyl-CoA acetyltransferase                            171   3e-47   
ref|XP_001220611.1|  hypothetical protein CHGG_01390                    171   3e-47   
ref|WP_035621375.1|  acetyl-CoA acetyltransferase                       170   3e-47   
ref|WP_038262486.1|  acetyl-CoA acetyltransferase                       170   3e-47   
ref|XP_001694888.1|  predicted protein                                  171   3e-47   
ref|XP_001908558.1|  hypothetical protein                               170   4e-47   
ref|WP_008623621.1|  Acetyl-CoA acetyltransferase                       170   4e-47   
ref|WP_008257139.1|  acetyl-CoA acetyltransferase                       170   4e-47   
ref|WP_026984513.1|  acetyl-CoA acetyltransferase                       170   4e-47   
ref|WP_042494758.1|  acetyl-CoA acetyltransferase                       170   4e-47   
gb|KHN94521.1|  acetyl-CoA acetyltransferase                            170   4e-47   
gb|EPB89923.1|  acetyl-CoA C-acetyltransferase                          170   4e-47   
ref|WP_006258744.1|  MULTISPECIES: acetyl-CoA acetyltransferase         170   4e-47   
gb|EGZ77936.1|  acetyl-CoA acetyltransferase                            170   4e-47   
ref|XP_965702.2|  acetyl-CoA acetyltransferase                          170   4e-47   



>ref|XP_010267979.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Nelumbo nucifera]
Length=407

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPELFTT+
Sbjct  247  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKAIQLGLQVIAKITGYADAAQAPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_010267976.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010267978.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
Length=417

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPELFTT+
Sbjct  247  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKAIQLGLQVIAKITGYADAAQAPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_011085410.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Sesamum indicum]
Length=403

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPELFTT+
Sbjct  243  PSFKETGGSVTAGNASSISDGAAALVLVSGEKAMKLGLEVIAKITGYADAAQAPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKNAGLE+SQ+DYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  303  PALAIPKAIKNAGLESSQIDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL TLLGVL+QKN
Sbjct  363  CSGARILATLLGVLRQKN  380



>emb|CDP18953.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSGK+A ELGL VIAKITGYADAAQAP+LFTT+
Sbjct  245  PSFKETGGSVTAGNASSISDGAAALVLVSGKKAVELGLQVIAKITGYADAAQAPDLFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+AS++DYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAISNAGLDASKIDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  365  CSGARILVTLLGVLKQKN  382



>gb|AID51434.1| acetoacetyl-coenzyme A thiolase [Astragalus membranaceus]
Length=384

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQ PELFTT+
Sbjct  224  PSFKESGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKISGYADAAQEPELFTTA  283

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVD+YEINEAFA VALANQKLLG+N++KVNVHGGAVS GHPLG
Sbjct  284  PALAIPKAIANAGLEASQVDFYEINEAFAVVALANQKLLGLNSEKVNVHGGAVSLGHPLG  343

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  344  CSGARILVTLLGVLKQKN  361



>ref|XP_010040361.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Eucalyptus 
grandis]
Length=221

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI  YADAAQAPELFTT+
Sbjct  61   PSFKETGGSVTAGNASSISDGAAALVLVSGEKALELGLQVIAKIRAYADAAQAPELFTTT  120

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAFA VALANQKLLGIN +K+NVHGGAVS GHPLG
Sbjct  121  PALAIPKAIANAGLEASQVDYYEINEAFAVVALANQKLLGINPEKINVHGGAVSLGHPLG  180

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+ TLLGVL+QK+
Sbjct  181  CSGARIIATLLGVLRQKS  198



>gb|AFK46877.1| unknown [Lotus japonicus]
Length=249

 Score =   235 bits (600),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQ PELFTT+
Sbjct  89   PSFKESGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKIAGYADAAQEPELFTTA  148

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE SQ+D+YEINEAF+ VALANQKLLG+N++KVNVHGGAVS GHPLG
Sbjct  149  PAIAIPKAIANAGLETSQIDFYEINEAFSVVALANQKLLGLNSEKVNVHGGAVSLGHPLG  208

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  209  CSGARILVTLLGVLKQKN  226



>ref|XP_002320528.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE98843.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=401

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL V+AK+TGYADAAQAPELFTTS
Sbjct  241  PSFKESGGSVTAGNASSISDGAAALVLVSGEKALQLGLKVLAKVTGYADAAQAPELFTTS  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQVDYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLDASQVDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQK+
Sbjct  361  CSGARILVTLLGVLKQKH  378



>ref|XP_010252788.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010252789.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
Length=406

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPELFTT+
Sbjct  246  PSFKEVGGSVTAGNASSISDGAAALVLVSGEKAIKLGLQVIAKITGYADAAQAPELFTTA  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PAL+IPKAI +AGLEASQ+DYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  306  PALSIPKAISSAGLEASQIDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  365

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  366  CSGARILVTLLGVLKQKN  383



>ref|XP_011008068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Populus 
euphratica]
Length=401

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL V+AK+TGYADAAQAPELFTT+
Sbjct  241  PSFKESGGSVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKVTGYADAAQAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQVDYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLDASQVDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQK 
Sbjct  361  CSGARILVTLLGVLKQKR  378



>ref|XP_002265690.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 ref|XP_010657485.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 emb|CBI28461.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL+VIAKI GYADAAQAPELFTT+
Sbjct  244  PSFKENGGSVTAGNASSISDGAAALVLVSGEKALQLGLSVIAKIAGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKAISNAGLEASQIDYYEINEAFAVVALANQKLLGLSPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK+
Sbjct  364  CSGARILVTLLGVLRQKD  381



>ref|XP_006447819.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 ref|XP_006447820.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61059.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61060.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
Length=405

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++  +LGL VIAKITGYADAAQAPE+FTT+
Sbjct  245  PSFKENGGTVTAGNASSISDGAAALVLVSGEKVLKLGLQVIAKITGYADAAQAPEMFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVD YEINEAFA VALANQKLLG+N DKVNVHGGAV+ GHPLG
Sbjct  305  PALAIPKAISNAGLEASQVDCYEINEAFAVVALANQKLLGLNPDKVNVHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  365  CSGARILVTLLGVLRQKN  382



>ref|XP_006469436.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Citrus 
sinensis]
Length=405

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++  +LGL VIAKITGYADAAQAPE+FTT+
Sbjct  245  PSFKENGGTVTAGNASSISDGAAALVLVSGEKVLKLGLQVIAKITGYADAAQAPEMFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVD YEINEAFA VALANQKLLG+N DKVNVHGGAV+ GHPLG
Sbjct  305  PALAIPKAISNAGLEASQVDCYEINEAFAVVALANQKLLGLNPDKVNVHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  365  CSGARILVTLLGVLRQKN  382



>ref|XP_010942603.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010942604.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=401

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL+VIAKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLSVIAKIRGYADAAQAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLEASQVDYYEINEAF+ VALANQKLLG+ A+KVNVHGGAVS GHPLG
Sbjct  301  PALAIPKALLNAGLEASQVDYYEINEAFSVVALANQKLLGLPAEKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ++
Sbjct  361  CSGARILVTLLGVLKQRD  378



>ref|XP_008384190.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Malus domestica]
Length=405

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N D+VN HGGAVS GHPLG
Sbjct  305  PALALPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPDRVNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  365  CSGARILVTLLGVLRHKN  382



>ref|XP_009374846.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Pyrus x bretschneideri]
Length=405

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N D+VN HGGAVS GHPLG
Sbjct  305  PALALPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPDRVNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  365  CSGARILVTLLGVLRHKN  382



>gb|ACU87560.2| acetyl-CoA C-acetyltransferase [Bacopa monnieri]
Length=405

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTTS
Sbjct  245  PSFKETGGTVTAGNASSISDGAAALVLVSGEKAVKLGLEVIAKIRGYADAAQAPELFTTS  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVD+YE+NEAFA VALANQKLLG+  +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAISNAGLEASQVDFYEVNEAFAVVALANQKLLGLAPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  365  CSGARILVTLLGVLRQKN  382



>ref|XP_009374845.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Pyrus x bretschneideri]
Length=416

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N D+VN HGGAVS GHPLG
Sbjct  305  PALALPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPDRVNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  365  CSGARILVTLLGVLRHKN  382



>gb|KCW58126.1| hypothetical protein EUGRSUZ_H00849 [Eucalyptus grandis]
Length=388

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI  YADAAQAPELFTT+
Sbjct  228  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALELGLQVIAKIRAYADAAQAPELFTTT  287

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAFA VALANQKLLGIN +K+NVHGGAVS GHPLG
Sbjct  288  PALAIPKAIANAGLEASQVDYYEINEAFAVVALANQKLLGINPEKINVHGGAVSLGHPLG  347

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+ TLLGVL+QK+
Sbjct  348  CSGARIIATLLGVLRQKS  365



>ref|XP_008384188.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
 ref|XP_008384189.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
Length=416

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+N D+VN HGGAVS GHPLG
Sbjct  305  PALALPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLNPDRVNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  365  CSGARILVTLLGVLRHKN  382



>gb|AAD44539.1| acetoacetyl CoA thiolase [Zea mays]
Length=214

 Score =   229 bits (584),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  44   PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIRGYADAAQAPELFTTT  103

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD++EINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  104  PALAIPKAISNAGLESSHVDFFEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  163

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  164  CSGARILVTLLGVLREK  180



>ref|XP_004491616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
Length=406

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  246  PSFKESGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE+S++D+YEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  306  PAIAIPKAIANAGLESSKIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  365

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  366  CSGARILVTLLGVLRQKN  383



>gb|AGH32909.1| acetyl-CoA C-acetyltransferase [Camellia chekiangoleosa]
Length=408

 Score =   235 bits (600),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG+ A +LGL VI KITGYADAAQAPELFTT+
Sbjct  248  PSFKETGGSVTAGNASSISDGAAALVLVSGETALKLGLHVIGKITGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAFA V+L+N KLLG+N +KVNVHGGAVS GHPLG
Sbjct  308  PALAIPKAISNAGLEASQVDYYEINEAFAVVSLSNMKLLGLNPEKVNVHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  368  CSGARILVTLLGVLKQKN  385



>ref|XP_007049380.1| Acetoacetyl-CoA thiolase 2 isoform 3 [Theobroma cacao]
 gb|EOX93537.1| Acetoacetyl-CoA thiolase 2 isoform 3 [Theobroma cacao]
Length=280

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPE FTT+
Sbjct  120  PSFKDNGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQAPEFFTTA  179

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  180  PALAIPKAISNAGLDASQIDYYEINEAFAVVALANQKLLDLNPEKVNVNGGAVSLGHPLG  239

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ+N
Sbjct  240  CSGARILVTLLGVLKQRN  257



>ref|XP_010069705.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Eucalyptus grandis]
Length=405

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI  YADAAQAPELFTT+
Sbjct  245  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALELGLQVIAKIRAYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAFA VALANQKLLGIN +K+NVHGGAVS GHPLG
Sbjct  305  PALAIPKAIANAGLEASQVDYYEINEAFAVVALANQKLLGINPEKINVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+ TLLGVL+QK+
Sbjct  365  CSGARIIATLLGVLRQKS  382



>gb|ADD10719.1| acetyl-CoA C-acetyltransferase protein [Camellia oleifera]
Length=408

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG+ A +LGL VI KITGYADAAQAPELFTT+
Sbjct  248  PSFKETGGSVTAGNASSISDGAAALVLVSGETALKLGLHVIGKITGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAFA V+L+N KLLG+N +KVNVHGGAVS GHPLG
Sbjct  308  PALAIPKAISNAGLEASQVDYYEINEAFAVVSLSNMKLLGLNPEKVNVHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  368  CSGARILVTLLGVLKQKN  385



>ref|XP_007142529.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
 gb|ESW14523.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
Length=407

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG+ A +LGL V+AKITG+ADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEMAVKLGLQVLAKITGFADAAQEPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+D+YEINEAFA VALANQKLLG+N++KVNVHGGAV+ GHPLG
Sbjct  307  PSLAIPKAISNAGLEASQIDFYEINEAFAVVALANQKLLGLNSEKVNVHGGAVALGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>gb|KDP29950.1| hypothetical protein JCGZ_18519 [Jatropha curcas]
Length=403

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+SSISDGAAALVLVSG+ A +LGL VIAKITGYADAAQAPELFTT+
Sbjct  243  PSFKQDGGTVTAGNASSISDGAAALVLVSGETALKLGLQVIAKITGYADAAQAPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ +AGL+ASQVDYYEINEAFA VAL+NQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  303  PALAIPKALSSAGLDASQVDYYEINEAFAVVALSNQKLLGLNPEKVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  363  CSGARILVTLLGVLRQRN  380



>ref|XP_003545555.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Glycine 
max]
Length=407

 Score =   235 bits (599),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLE SQ+D+YEINEAFA VALANQKLLG+N++KVNVHGGAV+ GHPLG
Sbjct  307  PSLAIPKAIAKAGLETSQIDFYEINEAFAVVALANQKLLGLNSEKVNVHGGAVALGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_009396114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396123.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSGK+A ELGL VIAKI GYADAA APELFTT+
Sbjct  241  PSFKDNGGTVTAGNASSISDGAAALVLVSGKKALELGLQVIAKIRGYADAAHAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQVDYYEINEAF+ VALANQKLL + +DKVNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLEASQVDYYEINEAFSVVALANQKLLSLPSDKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  361  CSGARILVTLLGVLRQRN  378



>gb|KHN46894.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLE SQ+D+YEINEAFA VALANQKLLG+N++KVNVHGGAV+ GHPLG
Sbjct  307  PSLAIPKAIAKAGLETSQIDFYEINEAFAVVALANQKLLGLNSEKVNVHGGAVALGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_008365553.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Malus domestica]
Length=408

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVL SG++  +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  248  PSFKESGGSVTAGNASSISDGAAALVLASGEKVLKLGLQVIAKISGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAFA VALANQKLLG+N +KVNVHGGAV+ GHPLG
Sbjct  308  PALAIPKAISNAGLEASQIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVALGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  368  CSGARILVTLLGVLKQKN  385



>gb|ABV08820.1| acetoacetyl-coenzyme A thiolase [Salvia miltiorrhiza]
Length=399

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A ELGLTVI KI+GYADAA APELFTT+
Sbjct  243  PSFKETGGTVTAGNASSISDGAAALVLVSGQKALELGLTVIGKISGYADAAHAPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+KNAGLEAS+VDYYEINEAFA VALANQKLL ++ ++VNVHGGAVS GHPLG
Sbjct  303  PALAIPKALKNAGLEASKVDYYEINEAFAVVALANQKLLDLSPERVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  363  CSGARILVTLLGVLRQKN  380



>ref|XP_007026385.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026386.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026387.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29007.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29008.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29009.1| Thiolase family protein isoform 1 [Theobroma cacao]
Length=422

 Score =   235 bits (599),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAA+VLVSG++A +LGL V+AKI GYADAAQAPELFTT+
Sbjct  252  PSFKEEGGSVTAGNASSISDGAAAIVLVSGEKATKLGLQVVAKIRGYADAAQAPELFTTA  311

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGLEASQ+DYYEINEAF+ VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  312  PALAIPKAISAAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  371

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGV++QKN
Sbjct  372  CSGARILVTLLGVMRQKN  389



>gb|KHG30083.1| Acetyl-CoA acetyltransferase, cytosolic 1 -like protein [Gossypium 
arboreum]
Length=407

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAAL+LVSG++A ELGL VIAKI GYADAAQAPE FTT+
Sbjct  247  PSFKDNGGTVTAGNASSISDGAAALILVSGEKALELGLQVIAKIAGYADAAQAPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQVDYYEINEAFA VALANQKLLG+N +KVNV+GGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLDASQVDYYEINEAFAVVALANQKLLGLNPEKVNVNGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_011100512.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Sesamum 
indicum]
Length=403

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VI KITGYADAAQAPELFTT+
Sbjct  243  PSFKETGGTVTAGNASSISDGAAALVLVSGEKALKLGLEVIGKITGYADAAQAPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL AS++DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHPLG
Sbjct  303  PALAIPKAISNAGLNASEIDYYEINEAFAVVALANQKLLGLSPEKVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  363  CSGARILVTLLGVLKQKN  380



>ref|XP_007215468.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
 gb|EMJ16667.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
Length=408

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++  +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  248  PSFKESGGSVTAGNASSISDGAAALVLVSGEKVLKLGLQVIAKISGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAFA VALANQKLLG+N +KVNVHGGAV+ GHPLG
Sbjct  308  PALAIPKAISNAGLEASQIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVALGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQK+
Sbjct  368  CSGARILVTLLGVLKQKS  385



>ref|XP_008811278.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008811280.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
Length=381

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  221  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLPVIAKIRGYADAAQAPELFTTA  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+  AGLEASQVDYYEINEAF+ VALANQKLLG+  DKVNVHGGAVS GHPLG
Sbjct  281  PALAIPKALLKAGLEASQVDYYEINEAFSVVALANQKLLGLPTDKVNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ++
Sbjct  341  CSGARILVTLLGVLKQRD  358



>gb|EYU42777.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=405

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  245  PSFKETGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKISGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEAS++DYYEINEAFA VALANQKLL ++ +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAISNAGLEASKIDYYEINEAFAVVALANQKLLTLSPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  365  CSGARILVTLLGVLKQKN  382



>ref|XP_003519682.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Glycine max]
 ref|XP_006575748.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Glycine max]
 gb|KHN43976.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLE SQ+D+YEINEAFA VALANQKLLG+N++KVN+HGGAV+ GHPLG
Sbjct  307  PSLAIPKAIAKAGLETSQIDFYEINEAFAVVALANQKLLGLNSEKVNLHGGAVALGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_011002352.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Populus euphratica]
Length=402

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVL+SG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  242  PSFKENGGSVTAGNASSISDGAAALVLMSGEKALKLGLQVIAKIRGYADAAQAPELFTTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAF+ VALANQKLLG+N  KVN HGGAVS GHPLG
Sbjct  302  PALAIPKAISNAGLEASQIDFYEINEAFSVVALANQKLLGLNPQKVNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK KN
Sbjct  362  CSGARILVTLLGVLKHKN  379



>ref|XP_009361536.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Pyrus x 
bretschneideri]
Length=408

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVL SG++  +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  248  PSFKESGGSVTAGNASSISDGAAALVLASGEKVLKLGLQVIAKISGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAFA VALANQKLLG+N +KVN+HGGAV+ GHPLG
Sbjct  308  PALAIPKAISNAGLEASQIDFYEINEAFAVVALANQKLLGLNPEKVNMHGGAVALGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  368  CSGARILVTLLGVLKQKN  385



>ref|XP_010441409.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=381

 Score =   233 bits (594),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  221  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++NVHGGAVS GHPLG
Sbjct  281  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  341  CSGARILVTLLGVLRAKK  358



>ref|XP_010445761.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
[Camelina sativa]
Length=319

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  149  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  208

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  209  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  268

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  269  CSGARILVTLLGVLRAKK  286



>ref|XP_008342241.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Malus domestica]
Length=408

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVL SG++  +LGL VIAKI+G+ADAAQAPELFTT+
Sbjct  248  PSFKESGGSVTAGNASSISDGAAALVLASGEKVLKLGLQVIAKISGFADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAFA VALANQKLLG+N +KVNVHGGAV+ GHPLG
Sbjct  308  PALAIPKAISNAGLEASQIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVALGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  368  CSGARILVTLLGVLKQKN  385



>ref|XP_008811276.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008811277.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
Length=401

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLPVIAKIRGYADAAQAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+  AGLEASQVDYYEINEAF+ VALANQKLLG+  DKVNVHGGAVS GHPLG
Sbjct  301  PALAIPKALLKAGLEASQVDYYEINEAFSVVALANQKLLGLPTDKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ++
Sbjct  361  CSGARILVTLLGVLKQRD  378



>ref|XP_010441408.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=391

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  221  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++NVHGGAVS GHPLG
Sbjct  281  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  341  CSGARILVTLLGVLRAKK  358



>ref|XP_003618040.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
Length=381

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  221  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQDPELFTTA  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE S++D+YEINEAFA VALANQKLLG+++ KVNVHGGAVS GHPLG
Sbjct  281  PAIAIPKAIANAGLETSKIDFYEINEAFAVVALANQKLLGLDSAKVNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  341  CSGARILVTLLGVLKQKN  358



>ref|XP_002308755.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE92278.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=412

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVL+SG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  242  PSFKENGGSVTAGNASSISDGAAALVLMSGEKALKLGLQVIAKIRGYADAAQAPELFTTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAF+ VALANQKLLG+N  KVN HGGAVS GHPLG
Sbjct  302  PALAIPKAISNAGLEASQIDFYEINEAFSVVALANQKLLGLNPQKVNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK KN
Sbjct  362  CSGARILVTLLGVLKHKN  379



>dbj|BAF98276.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=404

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAAL+LVSG+ A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  244  PSFKENGGTVTAGNASSISDGAAALILVSGETALKLGLQVIAKIRGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPK I NAGL+ASQVDYYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKTIANAGLDASQVDYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL++KN
Sbjct  364  CSGARILVTLLGVLRKKN  381



>ref|XP_011002351.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Populus euphratica]
Length=412

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVL+SG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  242  PSFKENGGSVTAGNASSISDGAAALVLMSGEKALKLGLQVIAKIRGYADAAQAPELFTTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAF+ VALANQKLLG+N  KVN HGGAVS GHPLG
Sbjct  302  PALAIPKAISNAGLEASQIDFYEINEAFSVVALANQKLLGLNPQKVNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK KN
Sbjct  362  CSGARILVTLLGVLKHKN  379



>ref|XP_009590926.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nicotiana 
tomentosiformis]
 gb|AAU95618.1| cytosolic acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=404

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  G+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  244  PSFKEKDGTVTAGNASSISDGAAALVLVSGEKAIKLGLNVIAKISGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+A LEASQ+DYYEINEAFA V+LANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKAIKSASLEASQIDYYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_010088359.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
 gb|EXB34477.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
Length=399

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  239  PSFKENSGTVTAGNASSISDGAAALVLVSGEKAIKLGLQVIAKISGYADAAQAPELFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLEA Q+D+YEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  299  PALAIPKAISHAGLEAFQIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  358

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  359  CSGARILVTLLGVLKQKN  376



>ref|XP_004293407.2| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Fragaria 
vesca subsp. vesca]
Length=414

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF + GGSVTAGN+S ISDGAAALVLVSG++A ELGL VIAKI G+ADAAQAPELFTT+
Sbjct  244  PSFKKSGGSVTAGNASIISDGAAALVLVSGEKALELGLQVIAKIKGFADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIP+AI NAGLEASQ+DYYEINEAFA VALANQKLLG+N ++VN HGGAVS GHPLG
Sbjct  304  PALAIPRAISNAGLEASQIDYYEINEAFAVVALANQKLLGLNPERVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_003618039.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
 gb|AET00998.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=407

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQDPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE S++D+YEINEAFA VALANQKLLG+++ KVNVHGGAVS GHPLG
Sbjct  307  PAIAIPKAIANAGLETSKIDFYEINEAFAVVALANQKLLGLDSAKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_007049379.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
 gb|EOX93536.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
Length=408

 Score =   232 bits (592),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPE FTT+
Sbjct  248  PSFKDNGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQAPEFFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  308  PALAIPKAISNAGLDASQIDYYEINEAFAVVALANQKLLDLNPEKVNVNGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ+N
Sbjct  368  CSGARILVTLLGVLKQRN  385



>gb|ACU19591.1| unknown [Glycine max]
Length=407

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGA ALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGATALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLE SQ+D+YEINEAFA VALANQKLLG+N++KVNVHGGAV+ GHP G
Sbjct  307  PSLAIPKAIAKAGLETSQIDFYEINEAFAVVALANQKLLGLNSEKVNVHGGAVALGHPFG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_007049378.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
 gb|EOX93535.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
Length=407

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQAPE FTT+
Sbjct  247  PSFKDNGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQAPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLDASQIDYYEINEAFAVVALANQKLLDLNPEKVNVNGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQ+N
Sbjct  367  CSGARILVTLLGVLKQRN  384



>dbj|BAF98277.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=408

 Score =   232 bits (592),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAA++LVSG+ A +LGL VIAKI GYADAAQAPELFTTS
Sbjct  248  PSFKENGGTVTAGNASSISDGAAAVILVSGETALKLGLQVIAKIGGYADAAQAPELFTTS  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPK I N GL+ASQVDYYEINEAFA VALANQKLLG+N +K+NVHGGAVS GHPLG
Sbjct  308  PALAIPKTIANGGLDASQVDYYEINEAFAVVALANQKLLGLNPEKINVHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  368  CSGARILVTLLGVLRQKN  385



>tpg|DAA45682.1| TPA: hypothetical protein ZEAMMB73_471357 [Zea mays]
Length=303

 Score =   229 bits (583),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  143  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGYADAAQAPELFTTT  202

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S+VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  203  PALAIPKAIANAGLESSRVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  262

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTL+GVL+ K+
Sbjct  263  CSGARILVTLIGVLRAKS  280



>gb|AFK39138.1| unknown [Medicago truncatula]
Length=407

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQDPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE S++D+YEINEAFA VALANQKLLG+++ KVNVHGGAVS GHPLG
Sbjct  307  PAIAIPKAIANAGLETSKIDFYEINEAFAVVALANQKLLGLDSAKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>gb|AEM42969.1| acetyl-CoA C-acetyltransferase [Siraitia grosvenorii]
Length=407

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAA+VLVSGK+A ELGL VIAKI+GYADAAQ PE FTT+
Sbjct  247  PSFKENGGTVTAGNASSISDGAAAIVLVSGKKALELGLEVIAKISGYADAAQEPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI NAGLEASQ+D+YEINEAFA VALANQKLLGI+ DKVNVHGGAV  GHPLG
Sbjct  307  PALAVPKAILNAGLEASQIDFYEINEAFAVVALANQKLLGISPDKVNVHGGAVFLGHPLG  366

Query  240  CSGARILVTLLGVLKQ  193
            CSGARILVTLLGVLKQ
Sbjct  367  CSGARILVTLLGVLKQ  382



>dbj|BAD22334.1| putative acetyl-CoA C-acyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ08304.1| hypothetical protein OsI_30555 [Oryza sativa Indica Group]
 gb|EAZ43919.1| hypothetical protein OsJ_28542 [Oryza sativa Japonica Group]
 dbj|BAG95604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIA+I G+ADAAQAPELFTTS
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVIARIKGFADAAQAPELFTTS  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S+VDYYEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKALANAGLESSRVDYYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  361  CSGARILVTLLGVLREK  377



>ref|XP_008229933.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=408

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++  +LGL VIAKI GYADAAQAPELFTT+
Sbjct  248  PSFKESGGSVTAGNASSISDGAAALVLVSGEKVLKLGLQVIAKIGGYADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEAS++D+YEINEAFA VALANQKLLG+N +KVNVHGGAV+ GHPLG
Sbjct  308  PALAIPKAISNAGLEASKIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVALGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQK+
Sbjct  368  CSGARILVTLLGVLKQKS  385



>gb|ABC74567.1| acetoacetyl-CoA thiolase [Picrorhiza kurrooa]
Length=404

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/136 (85%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +L L VIAKITGYADAAQAPELFTT+
Sbjct  244  PSFKETGGSVTAGNASSISDGAAALVLVSGEKALKLRLEVIAKITGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLEASQ+DYYEINEAFA VALANQKLL +N +KVNVHGGAVS GHPLG
Sbjct  304  PAIAIPKAISNAGLEASQIDYYEINEAFAVVALANQKLLSLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQ  193
            CSGARILVTLLGVL+Q
Sbjct  364  CSGARILVTLLGVLRQ  379



>gb|AEC13714.1| acetoacetyl-CoA thiolase [Catharanthus roseus]
Length=405

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PS  E GG+VTAGN+SSISDGAAALVLVSG+   +LGL V+AKITGYADAAQAPELFTT+
Sbjct  245  PSLKETGGTVTAGNASSISDGAAALVLVSGETVAKLGLVVLAKITGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLEAS+VDYYEINEAF+ VALANQKLLG+N +KVNVHGGAV+ GHPLG
Sbjct  305  PALAIPKAVSNAGLEASKVDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  365  CSGARILVTLLGVLKQKN  382



>ref|XP_010481278.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_010495013.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_010481277.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|NP_851150.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974900.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95558.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95561.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=405

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_010647165.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X4 [Vitis vinifera]
Length=401

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGGSVTAGN+SSISDGAAALVLVSGK+A EL L VIAKI GY DAAQAPELFTT+
Sbjct  242  PSF-KDGGSVTAGNASSISDGAAALVLVSGKKAVELRLQVIAKIAGYGDAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHP+G
Sbjct  301  PALAIPKAISNAGLKASQIDYYEINEAFAVVALANQKLLGLDPEKVNVHGGAVSLGHPIG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLG+L+QKN
Sbjct  361  CSGARILVTLLGILRQKN  378



>ref|XP_010495012.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|NP_199583.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974901.2| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q9FIK7.1|THIC2_ARATH RecName: Full=Probable acetyl-CoA acetyltransferase, cytosolic 
2; AltName: Full=Cytosolic acetoacetyl-CoA thiolase 2; Short=Thiolase 
2 [Arabidopsis thaliana]
 dbj|BAB11319.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|AAM67058.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|ABM06028.1| At5g47720 [Arabidopsis thaliana]
 dbj|BAH19561.1| AT5G47720 [Arabidopsis thaliana]
 gb|AED95559.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95560.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=415

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_006353096.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  G+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQ PELFT S
Sbjct  244  PSFKEKDGTVTAGNASSISDGAAALVLVSGEKAVKLGLDVIAKISGYADAAQEPELFTIS  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA AIPKAIK+AGLEASQ+DYYEINEAFA VALANQKLLG+N +K+NVHGGAVS GHPLG
Sbjct  304  PAKAIPKAIKSAGLEASQIDYYEINEAFAVVALANQKLLGLNPEKINVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_010647163.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Vitis vinifera]
Length=404

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGGSVTAGN+SSISDGAAALVLVSGK+A EL L VIAKI GY DAAQAPELFTT+
Sbjct  242  PSF-KDGGSVTAGNASSISDGAAALVLVSGKKAVELRLQVIAKIAGYGDAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHP+G
Sbjct  301  PALAIPKAISNAGLKASQIDYYEINEAFAVVALANQKLLGLDPEKVNVHGGAVSLGHPIG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLG+L+QKN
Sbjct  361  CSGARILVTLLGILRQKN  378



>ref|XP_008782420.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
 ref|XP_008782421.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
Length=415

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG +A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGAKARELGLQVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLL + A+K+NVHGGAVS GHPLG
Sbjct  305  PSLAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLRLPAEKLNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ +N
Sbjct  365  CSGARILVTLLGVLRHRN  382



>gb|KJB42690.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=407

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAAL+LVSG++A +LGL VIAKI GYADAAQAPE FTT+
Sbjct  247  PSFKDNGGTVTAGNASSISDGAAALILVSGEKALKLGLQVIAKIAGYADAAQAPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQVDYYEINEAFA VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLDASQVDYYEINEAFAVVALANQKLLDLNPEKVNVNGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_002865105.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41364.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKQAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_010039422.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Eucalyptus 
grandis]
 gb|KCW45974.1| hypothetical protein EUGRSUZ_L00148 [Eucalyptus grandis]
Length=413

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSGK+  ELGL VIAKI GYADAAQAPELFTT+
Sbjct  243  PSFKENGGSVTAGNASLISDGAAALVLVSGKKVLELGLRVIAKIKGYADAAQAPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAF+ V LANQKLL +  ++VNVHGGAVS GHPLG
Sbjct  303  PALAIPKAISNAGLDASQIDYYEINEAFSVVVLANQKLLALKPERVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  363  CSGARILVTLLGVLRQKN  380



>ref|NP_001062685.1| Os09g0252100 [Oryza sativa Japonica Group]
 dbj|BAF24599.1| Os09g0252100, partial [Oryza sativa Japonica Group]
Length=433

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIA+I G+ADAAQAPELFTTS
Sbjct  273  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVIARIKGFADAAQAPELFTTS  332

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S+VDYYEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  333  PALAIPKALANAGLESSRVDYYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  392

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  393  CSGARILVTLLGVLREK  409



>ref|NP_001032028.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95562.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=412

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  252  PSFKEDGGSVTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  311

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  312  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  371

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  372  CSGARILVTLLGVLRAKK  389



>ref|XP_010647164.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGGSVTAGN+SSISDGAAALVLVSGK+A EL L VIAKI GY DAAQAPELFTT+
Sbjct  242  PSF-KDGGSVTAGNASSISDGAAALVLVSGKKAVELRLQVIAKIAGYGDAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHP+G
Sbjct  301  PALAIPKAISNAGLKASQIDYYEINEAFAVVALANQKLLGLDPEKVNVHGGAVSLGHPIG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLG+L+QKN
Sbjct  361  CSGARILVTLLGILRQKN  378



>ref|XP_009759542.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=404

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  G+VTAGN+SSISDGAAALVLVSG++A  LGL VIAKI+GYADAAQAPELFTT+
Sbjct  244  PSFKEKDGTVTAGNASSISDGAAALVLVSGEKAINLGLNVIAKISGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+A LEASQ+D+YEINEAFA V+LANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKAIKSATLEASQIDFYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_003635396.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Vitis vinifera]
 emb|CBI33249.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGGSVTAGN+SSISDGAAALVLVSGK+A EL L VIAKI GY DAAQAPELFTT+
Sbjct  242  PSF-KDGGSVTAGNASSISDGAAALVLVSGKKAVELRLQVIAKIAGYGDAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAFA VALANQKLLG++ +KVNVHGGAVS GHP+G
Sbjct  301  PALAIPKAISNAGLKASQIDYYEINEAFAVVALANQKLLGLDPEKVNVHGGAVSLGHPIG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLG+L+QKN
Sbjct  361  CSGARILVTLLGILRQKN  378



>ref|XP_004977186.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
 ref|XP_004977187.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=401

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKAIANAGLESSHVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  361  CSGARILVTLLGVLREK  377



>gb|ACJ84564.1| unknown [Medicago truncatula]
 gb|AFK36455.1| unknown [Medicago truncatula]
Length=407

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGA ALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  247  PSFKETGGSVTAGNASSISDGATALVLVSGEKALKLGLQVIAKITGYADAAQDPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+A+PKAI NAGLE S++D+YEINEAFA VALANQKLLG+++ KVNVHGGAVS GHPLG
Sbjct  307  PAIAVPKAIANAGLETSKIDFYEINEAFAVVALANQKLLGLDSAKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  367  CSGARILVTLLGVLKQKN  384



>ref|XP_006398473.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39926.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=405

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGS+TAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSLTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>gb|AIK21787.1| acetyl-CoA C-acetyltransferase [Panax notoginseng]
Length=408

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDG AALVLVSG+ A +LGL V+AKI+GY DAAQ+PELFTTS
Sbjct  248  PSFKETGGTVTAGNASSISDGGAALVLVSGETAVKLGLQVLAKISGYGDAAQSPELFTTS  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AG+EASQVD+YEINEAFA VALANQKLLG+N +KVN+HGGAVS GHPLG
Sbjct  308  PALAIPKAISSAGIEASQVDFYEINEAFAVVALANQKLLGLNPEKVNIHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  368  CSGARILVTLLGVLRQKN  385



>gb|ACX47470.1| acetoacetyl-CoA thiolase [Medicago sativa]
Length=403

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGA  LVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  243  PSFKETGGTVTAGNASSISDGATPLVLVSGEKALKLGLQVIAKITGYADAAQDPELFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+A+PKAI NAGLE S++DYYEINEAFA VALANQKLLG+++ KVNVHGGAVS GHPLG
Sbjct  303  PAIAVPKAIANAGLETSKIDYYEINEAFAVVALANQKLLGLDSHKVNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  363  CSGARILVTLLGVLKQKN  380



>tpg|DAA47710.1| TPA: hypothetical protein ZEAMMB73_220204 [Zea mays]
Length=394

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  234  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIRGYADAAQAPELFTTT  293

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD++EINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  294  PALAIPKAISNAGLESSHVDFFEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  353

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  354  CSGARILVTLLGVLREK  370



>ref|XP_004303573.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++  +LGL VIAKI+G+ADAAQAPELFTT+
Sbjct  245  PSFKETGGSVTAGNASSISDGAAALVLVSGEKVLKLGLQVIAKISGFADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+DYYEINEAFA VALANQKLLG++  KVNVHGGAV+ GHPLG
Sbjct  305  PSLAIPKAISNAGLEASQIDYYEINEAFAVVALANQKLLGLDPAKVNVHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQK+
Sbjct  365  CSGARILVTLLGVLKQKS  382



>ref|XP_006398474.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39927.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=415

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGS+TAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSLTAGNASSISDGAAALVLVSGEKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  305  PALAIPKAIKRAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_010538441.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Tarenaya hassleriana]
Length=404

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SS+SDGAAALVLVSG++A ELGL +IAKI GYADAAQAPELFTT+
Sbjct  244  PSFKEDGGSVTAGNASSMSDGAAALVLVSGEKAIELGLHIIAKIRGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P LAIPKAI  AGL+ SQVDYYEINEAF+ VALANQKLLG++ ++VNVHGGAVS GHPLG
Sbjct  304  PTLAIPKAISRAGLDPSQVDYYEINEAFSVVALANQKLLGLDPERVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGAR+LVTLLGVL+QK 
Sbjct  364  CSGARVLVTLLGVLRQKK  381



>ref|NP_001266315.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34735.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIRGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD++EINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLESSHVDFFEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  361  CSGARILVTLLGVLREK  377



>gb|ACF85124.1| unknown [Zea mays]
 tpg|DAA47708.1| TPA: acetoacetyl CoA thiolase isoform 1 [Zea mays]
 tpg|DAA47709.1| TPA: acetoacetyl CoA thiolase isoform 2 [Zea mays]
Length=401

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIRGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD++EINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLESSHVDFFEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  361  CSGARILVTLLGVLREK  377



>ref|XP_006660462.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006660463.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Oryza brachyantha]
Length=401

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 129/137 (94%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIA+I G+ADAAQAPELFTTS
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVIARIKGFADAAQAPELFTTS  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S VDYYEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKALMNAGLESSCVDYYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTL+GVL++K
Sbjct  361  CSGARILVTLIGVLREK  377



>ref|XP_010538440.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Tarenaya hassleriana]
Length=414

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SS+SDGAAALVLVSG++A ELGL +IAKI GYADAAQAPELFTT+
Sbjct  244  PSFKEDGGSVTAGNASSMSDGAAALVLVSGEKAIELGLHIIAKIRGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P LAIPKAI  AGL+ SQVDYYEINEAF+ VALANQKLLG++ ++VNVHGGAVS GHPLG
Sbjct  304  PTLAIPKAISRAGLDPSQVDYYEINEAFSVVALANQKLLGLDPERVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGAR+LVTLLGVL+QK 
Sbjct  364  CSGARVLVTLLGVLRQKK  381



>ref|XP_009399886.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL +IAKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLQIIAKIRGYADAAQAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAF+ VALANQKLL + ++KVNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLEASQIDFYEINEAFSVVALANQKLLSLPSEKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTL+GVL++++
Sbjct  361  CSGARILVTLIGVLRERH  378



>ref|NP_001148667.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 ref|XP_008676213.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Zea mays]
 gb|ACF78705.1| unknown [Zea mays]
 gb|ACF87104.1| unknown [Zea mays]
 gb|ACG32450.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34415.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 tpg|DAA45681.1| TPA: acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S+VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKAIANAGLESSRVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTL+GVL+ K+
Sbjct  361  CSGARILVTLIGVLRAKS  378



>ref|XP_009412135.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=391

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+AKI GYADAAQAPELFTT+
Sbjct  221  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLQVVAKIRGYADAAQAPELFTTT  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLEASQVDYYEINEAF+ VALANQKLL + +++VNVHGGAVS GHPLG
Sbjct  281  PALAIPKAISSAGLEASQVDYYEINEAFSVVALANQKLLSLPSERVNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ ++
Sbjct  341  CSGARILVTLLGVLRHRS  358



>ref|XP_004236650.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
[Solanum lycopersicum]
Length=414

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSGK+A ELGL VI +I G+ADAAQAPELF T+
Sbjct  244  PSFKENGGSVTAGNASIISDGAAALVLVSGKKAIELGLQVIGRIRGFADAAQAPELFPTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VALANQ+LL +N+ K+N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALANQRLLNLNSGKLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  364  CSGARILVTLLGVLKQKN  381



>ref|XP_009399870.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009399878.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL +IAKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLQIIAKIRGYADAAQAPELFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+D+YEINEAF+ VALANQKLL + ++KVNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISNAGLEASQIDFYEINEAFSVVALANQKLLSLPSEKVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTL+GVL++++
Sbjct  361  CSGARILVTLIGVLRERH  378



>ref|XP_009114255.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Brassica rapa]
Length=405

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSGK+A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGKKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQVDYYEINEAF+ VALANQKLLG++  ++N HGGAV+ GHPLG
Sbjct  305  PALAIPKAIMRAGLDASQVDYYEINEAFSVVALANQKLLGLDPARLNAHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK K 
Sbjct  365  CSGARILVTLLGVLKAKK  382



>ref|XP_007154060.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 ref|XP_007154061.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26054.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26055.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
Length=409

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF + GGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  240  PSFKQVGGSVTAGNASSISDGAAALVLVSGEKARELGLHVIAKIKGYGDAAKAPELFTTA  299

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLL +N +KVNVHGGAVS GHPLG
Sbjct  300  PALAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLSLNPEKVNVHGGAVSLGHPLG  359

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  360  CSGARILVTLLGVLRHKR  377



>ref|XP_009114253.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 ref|XP_009114254.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 emb|CDY41065.1| BnaA09g18440D [Brassica napus]
Length=415

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSGK+A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGKKALELGLHVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQVDYYEINEAF+ VALANQKLLG++  ++N HGGAV+ GHPLG
Sbjct  305  PALAIPKAIMRAGLDASQVDYYEINEAFSVVALANQKLLGLDPARLNAHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK K 
Sbjct  365  CSGARILVTLLGVLKAKK  382



>ref|XP_009412114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412121.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+AKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLQVVAKIRGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLEASQVDYYEINEAF+ VALANQKLL + +++VNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISSAGLEASQVDYYEINEAFSVVALANQKLLSLPSERVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ ++
Sbjct  361  CSGARILVTLLGVLRHRS  378



>ref|XP_009412128.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+AKI GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALELGLQVVAKIRGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLEASQVDYYEINEAF+ VALANQKLL + +++VNVHGGAVS GHPLG
Sbjct  301  PALAIPKAISSAGLEASQVDYYEINEAFSVVALANQKLLSLPSERVNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ ++
Sbjct  361  CSGARILVTLLGVLRHRS  378



>ref|XP_006357655.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +  G+VTAGN+SSISDGAAALVLVSG++A +LGL VI KI+GYADAAQ PELFTT+
Sbjct  244  PSFKDKDGTVTAGNASSISDGAAALVLVSGEKAIKLGLNVIGKISGYADAAQEPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+A LEASQ+DYYEINEAFA V+LANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKAIKSASLEASQIDYYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_004243582.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323907.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323908.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +  G+VTAGN+SSISDGAAALVLVSG++A +LGL VI KI+GYADAAQ PELFTT+
Sbjct  244  PSFKDKDGTVTAGNASSISDGAAALVLVSGEKAIKLGLNVIGKISGYADAAQEPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+A LEASQ+DYYEINEAFA V+LANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PALAIPKAIKSASLEASQIDYYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_007211795.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
 gb|EMJ12994.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
Length=415

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+S ISDGAAALVLVSG++A +LGL VIAKI G++DAAQAPELFTT+
Sbjct  245  PSFKKNGGTVTAGNASLISDGAAALVLVSGEKARQLGLQVIAKIKGFSDAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLEASQ+DYYEINEAF+ VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAVSNAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRHKK  382



>emb|CDY25950.1| BnaC09g20370D [Brassica napus]
Length=415

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDGGSVTAGN+SSISDGAAALVLVSGK+A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDGGSVTAGNASSISDGAAALVLVSGKKAIELGLNVIAKIRGYADAAQAPELFTTT  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQVDYYEINEAF+ VALANQKLLG++  ++N HGGAV+ GHPLG
Sbjct  305  PALAIPKAIMRAGLDASQVDYYEINEAFSVVALANQKLLGLDPARLNAHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRAKK  382



>ref|XP_009761989.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761990.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761991.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761992.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761993.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761994.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761995.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
Length=404

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  G+VTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQ PELFT S
Sbjct  244  PSFKEKDGTVTAGNASSISDGAAALVLVSGEKAVELGLDVIAKIRGYADAAQEPELFTIS  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA AIPK+IK+AGLEASQ+ YYEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  304  PAKAIPKSIKSAGLEASQIYYYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_004144550.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Cucumis 
sativus]
 ref|XP_004172131.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Cucumis 
sativus]
Length=407

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAA+VLVSGK+A ELGL VI KI GYADAA  PE FTT+
Sbjct  247  PSFKDNGGTVTAGNASSISDGAAAIVLVSGKKALELGLEVIGKIKGYADAAHEPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI +AGLEASQ+D+YEINEAFA VALANQKLLGI+ DKVNVHGGAVS GHPLG
Sbjct  307  PALAVPKAISHAGLEASQIDFYEINEAFAVVALANQKLLGISPDKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQ  193
            CSGARILVTLLGVLKQ
Sbjct  367  CSGARILVTLLGVLKQ  382



>ref|XP_008462041.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Cucumis 
melo]
Length=406

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 124/136 (91%), Gaps = 0/136 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAA+VLVSGK+A ELGL VI KI GYADAA  PE FTT+
Sbjct  246  PSFKDNGGTVTAGNASSISDGAAAIVLVSGKKALELGLEVIGKIKGYADAAHEPEFFTTA  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI +AGLEASQ+D+YEINEAFA VALANQKLLGI+ DKVNVHGGAVS GHPLG
Sbjct  306  PALAVPKAISHAGLEASQIDFYEINEAFAVVALANQKLLGISPDKVNVHGGAVSLGHPLG  365

Query  240  CSGARILVTLLGVLKQ  193
            CSGARILVTLLGVLKQ
Sbjct  366  CSGARILVTLLGVLKQ  381



>ref|XP_008224638.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=415

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+S ISDGAAALVLVSG++A +LGL VIAKI G++DAAQAPELFTT+
Sbjct  245  PSFKKNGGTVTAGNASLISDGAAALVLVSGEKALQLGLQVIAKIKGFSDAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLEASQ+DYYEINEAF+ VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAVSNAGLEASQIDYYEINEAFSVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  365  CSGARILVTLLGVLRHKK  382



>gb|EMS56611.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=367

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E  G+VTAGN+SSISDGAAALVLVSGK+A ELGL V+A+I G+ADAAQAPELFTT+
Sbjct  207  PAFKESAGTVTAGNASSISDGAAALVLVSGKKAQELGLQVLARIKGFADAAQAPELFTTT  266

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S+VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  267  PALAIPKALTNAGLESSRVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  326

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL++K+
Sbjct  327  CSGARILVTLLGVLREKS  344



>ref|XP_004969865.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Setaria 
italica]
Length=401

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  241  PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIRGYADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD+YEINEAF+AV LANQKLLGI ++K NVHGGAVS GHPLG
Sbjct  301  PALAIPKAIANAGLESSNVDFYEINEAFSAVVLANQKLLGIPSEKTNVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL++K
Sbjct  361  CSGARILVTLLGVLREK  377



>ref|XP_004239258.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  G+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQ PELFT S
Sbjct  244  PSFKEKDGTVTAGNASSISDGAAALVLVSGEKAVKLGLDVIAKISGYADAAQEPELFTIS  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA AIPKAIK+AGLE SQ+DYYEINEAFA VALANQKLLG+N +K+NVHGGAVS GHPLG
Sbjct  304  PAKAIPKAIKSAGLEESQIDYYEINEAFAVVALANQKLLGLNPEKINVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK+
Sbjct  364  CSGARILVTLLGVLRQKD  381



>ref|XP_006350251.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Solanum tuberosum]
Length=414

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSG++A ELGL VI +I G+ADAAQAPELF T+
Sbjct  244  PSFKENGGSVTAGNASIISDGAAALVLVSGQKAIELGLQVIGRIRGFADAAQAPELFPTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VALANQ+LL +N+ K+N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALANQRLLNLNSGKLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  364  CSGARILVTLLGVLKQKN  381



>ref|XP_010936771.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010936772.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=415

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG +A ELGL VIAKI GYADAAQAPELF T+
Sbjct  245  PSFKENGGSVTAGNASSISDGAAALVLVSGAKARELGLEVIAKIKGYADAAQAPELFPTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI N+GLEASQ+DYYEINEAF+ VALANQKLL + A+K+NVHGGAVS GHPLG
Sbjct  305  PSLAIPKAISNSGLEASQIDYYEINEAFSVVALANQKLLRLPAEKLNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ +N
Sbjct  365  CSGARILVTLLGVLRHRN  382



>gb|AFI23434.1| thiolase II [Betula platyphylla]
Length=400

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG+ A +LGL VIAKITGYADAAQAPE FTT+
Sbjct  240  PSFKESGGSVTAGNASSISDGAAALVLVSGETALKLGLQVIAKITGYADAAQAPEFFTTA  299

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGLE SQ+D+YEINEAFA VALANQKLLG+N + VNVHGGAV  GHPLG
Sbjct  300  PALAIPKAISKAGLEPSQIDFYEINEAFAVVALANQKLLGLNPETVNVHGGAVGLGHPLG  359

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLG LKQK+
Sbjct  360  CSGARILVTLLGYLKQKH  377



>ref|XP_004159110.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Cucumis sativus]
Length=404

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL VIA I GYADAAQAPELFTT+
Sbjct  244  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEVIAVIKGYADAAQAPELFTTT  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L  SQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  304  PALAIPKAISNACLHHSQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>gb|ABV02024.1| peroxisomal acetoacetyl-coenzyme A thiolase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=325

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSG++A ELGL VI +I G+ADAAQAPELFTT+
Sbjct  155  PSFKENGGSVTAGNASIISDGAAALVLVSGQKALELGLQVIGRIRGFADAAQAPELFTTA  214

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VALANQ+LL +N+ K+N HGGAVS GHPL 
Sbjct  215  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALANQRLLNLNSGKLNAHGGAVSLGHPLW  274

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILV+LLGVLK KN
Sbjct  275  CSGARILVSLLGVLKHKN  292



>ref|XP_004139514.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Cucumis sativus]
Length=404

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL VIA I GYADAAQAPELFTT+
Sbjct  244  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEVIAVIKGYADAAQAPELFTTT  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L  SQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  304  PALAIPKAISNACLHHSQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>gb|KGN64993.1| hypothetical protein Csa_1G173130 [Cucumis sativus]
Length=414

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL VIA I GYADAAQAPELFTT+
Sbjct  244  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEVIAVIKGYADAAQAPELFTTT  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L  SQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  304  PALAIPKAISNACLHHSQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>ref|XP_010092017.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB49753.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=407

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF + GG+VTAGN+S ISDGAAA VLVSG++A +LGL VIAKI G+ADAAQAPELFTT+
Sbjct  247  PSFKKKGGTVTAGNASIISDGAAAFVLVSGEKALQLGLQVIAKIKGFADAAQAPELFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG+  +K+NVHGGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLEASQIDYYEINEAFSVVALANQKLLGLEPEKLNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  367  CSGARILVTLLGVLRHKN  384



>ref|XP_002865618.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41877.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
Length=403

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSGK+A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGKKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE SQVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLEFSQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>emb|CDY05693.1| BnaC02g38440D [Brassica napus]
Length=327

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAK+ GY DAAQ PE FTT+
Sbjct  167  PSFKVNGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKVKGYGDAAQEPEFFTTA  226

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  227  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITPEKVNVNGGAVSLGHPLG  286

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  287  CSGARILITLLGILKNRN  304



>ref|XP_003637597.1| Acetyl-CoA acetyltransferase cytosolic [Medicago truncatula]
 gb|KEH32694.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=408

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F + GG+VTAGN+SSISDGAAALVLVS K+A ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  238  PNFKKVGGTVTAGNASSISDGAAALVLVSEKKAHELGLHVIAKIKGFADAAQAPEFFTTA  297

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+AVALANQKLLG++ +K+NVHGGAVS GHPLG
Sbjct  298  PALAIPKAISNAGLEASQIDYYEINEAFSAVALANQKLLGLDPEKLNVHGGAVSLGHPLG  357

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL+ K
Sbjct  358  CSGARILVTLLGVLRHK  374



>gb|AFQ62006.1| acetyl-CoA acetyltransferase, partial [Euphorbia lathyris]
Length=365

 Score =   224 bits (571),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG+ A +LGL VI KITGYADAAQAPELFTT+
Sbjct  205  PSFKETGGTVTAGNASSISDGAAALVLVSGETALKLGLEVIGKITGYADAAQAPELFTTA  264

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+  A ++AS+VDYYEINEAFA VAL+NQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  265  PALAIPKALSKACMDASEVDYYEINEAFAVVALSNQKLLGLNPEKVNVHGGAVSLGHPLG  324

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  325  CSGARILVTLLGVLRHKN  342



>ref|XP_004491615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
Length=423

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKITGYADAAQ PELFTT+
Sbjct  246  PSFKESGGSVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKITGYADAAQEPELFTTA  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI NAGLE+S++D+YEINEAFA VALANQKLLG+N +KVNVHGGAVS GHPLG
Sbjct  306  PAIAIPKAIANAGLESSKIDFYEINEAFAVVALANQKLLGLNPEKVNVHGGAVSLGHPLG  365

Query  240  CSGARILVTLLGV  202
            CSGARILVTLLGV
Sbjct  366  CSGARILVTLLGV  378



>ref|XP_009129716.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Brassica rapa]
Length=403

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAK+ GY DAAQ PE FTT+
Sbjct  243  PSFKESGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKVKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI ++KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITSEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  363  CSGARILITLLGILKNRN  380



>gb|EMT20974.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=409

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++ G+VTAGN+SSISDGAAALVLVSGK+A ELGL V+A+I G+ADAAQAPELFTT+
Sbjct  249  PAFKDNAGTVTAGNASSISDGAAALVLVSGKKAQELGLHVLARIKGFADAAQAPELFTTT  308

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S+VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  309  PALAIPKALTNAGLESSRVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  368

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL++K+
Sbjct  369  CSGARILVTLLGVLREKS  386



>ref|XP_002522876.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF39476.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=402

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E  GSVTAGN+SSISDGAAALVLVSG+ A +LGL VIA+I GY DAAQAPELFTT+
Sbjct  242  PSFKEKDGSVTAGNASSISDGAAALVLVSGEMAIKLGLQVIARIKGYGDAAQAPELFTTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ SQ+DYYEINEAF+ VALANQKLLG+N +KVN HGGAVS GHPLG
Sbjct  302  PALAIPKAISNAGLDKSQIDYYEINEAFSVVALANQKLLGLNPEKVNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  362  CSGARILVTLLGVLRHKN  379



>ref|XP_010493636.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>ref|XP_010482068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Camelina 
sativa]
Length=403

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>emb|CDY48742.1| BnaA02g30030D [Brassica napus]
Length=403

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAK+ GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKVKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  363  CSGARILITLLGILKNRN  380



>ref|XP_003551110.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=409

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  240  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  299

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLLG++ +KVN HGGAVS GHPLG
Sbjct  300  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLGLDPEKVNAHGGAVSLGHPLG  359

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  360  CSGARILVTLLGVLRQKR  377



>gb|KJB68524.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=403

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSGK+A ELGL V+AKI GYADAAQAPE FTT+
Sbjct  243  PSFKANGGTVTAGNASSISDGAAALVLVSGKKAVELGLQVVAKIRGYADAAQAPEWFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQ+DYYEINEAF+ VALANQKLL +N +K+NVHGGAVS GHPLG
Sbjct  303  PALAIPKAISAAGLDASQIDYYEINEAFSVVALANQKLLHLNPEKLNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  363  CSGARILVTLLGVLRHKK  380



>emb|CDY00071.1| BnaC09g02300D [Brassica napus]
Length=403

 Score =   224 bits (572),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>ref|XP_010442239.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>ref|XP_009111830.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brassica 
rapa]
Length=403

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIGPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>gb|KEH32695.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=415

 Score =   224 bits (572),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F + GG+VTAGN+SSISDGAAALVLVS K+A ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PNFKKVGGTVTAGNASSISDGAAALVLVSEKKAHELGLHVIAKIKGFADAAQAPEFFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+AVALANQKLLG++ +K+NVHGGAVS GHPLG
Sbjct  305  PALAIPKAISNAGLEASQIDYYEINEAFSAVALANQKLLGLDPEKLNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL+ K
Sbjct  365  CSGARILVTLLGVLRHK  381



>gb|KJB68523.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=415

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSGK+A ELGL V+AKI GYADAAQAPE FTT+
Sbjct  243  PSFKANGGTVTAGNASSISDGAAALVLVSGKKAVELGLQVVAKIRGYADAAQAPEWFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQ+DYYEINEAF+ VALANQKLL +N +K+NVHGGAVS GHPLG
Sbjct  303  PALAIPKAISAAGLDASQIDYYEINEAFSVVALANQKLLHLNPEKLNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  363  CSGARILVTLLGVLRHKK  380



>gb|KHN03551.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=422

 Score =   225 bits (573),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  253  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  312

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLLG++ +KVN HGGAVS GHPLG
Sbjct  313  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLGLDPEKVNAHGGAVSLGHPLG  372

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  373  CSGARILVTLLGVLRQKR  390



>ref|XP_009787709.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=414

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSG++A ELGL VI +I G+ADAAQAPELFTT+
Sbjct  244  PSFKENGGSVTAGNASIISDGAAALVLVSGQKALELGLQVIGRIRGFADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VAL NQ+LL +N+ K+N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALVNQRLLNLNSGKLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILV+LLGVLK KN
Sbjct  364  CSGARILVSLLGVLKHKN  381



>ref|XP_009608453.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
tomentosiformis]
Length=414

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSG++A ELGL VI +I G+ADAAQAPELFTT+
Sbjct  244  PSFKENGGSVTAGNASIISDGAAALVLVSGQKALELGLQVIGRIRGFADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VALAN++LL +N+ K+N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALANKRLLNLNSGKLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILV+LLGVLK KN
Sbjct  364  CSGARILVSLLGVLKHKN  381



>emb|CDY19963.1| BnaA09g02880D [Brassica napus]
Length=403

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIGPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>gb|AAU95619.1| peroxisomal acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=414

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S ISDGAAALVLVSG++A ELGL VI +I G+ADAAQAPELFTT+
Sbjct  244  PSFKENGGSVTAGNASIISDGAAALVLVSGQKALELGLQVIGRIRGFADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GLE+SQ+DYYEINEAF+ VALAN++LL +N+ K+N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKNSGLESSQIDYYEINEAFSVVALANKRLLNLNSGKLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILV+LLGVLK KN
Sbjct  364  CSGARILVSLLGVLKHKN  381



>ref|XP_006600286.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X3 [Glycine max]
Length=423

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  263  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  322

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLLG++ +KVN HGGAVS GHPLG
Sbjct  323  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLGLDPEKVNAHGGAVSLGHPLG  382

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  383  CSGARILVTLLGVLRQKR  400



>ref|XP_009129715.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Brassica rapa]
Length=435

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAK+ GY DAAQ PE FTT+
Sbjct  275  PSFKESGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVIAKVKGYGDAAQEPEFFTTA  334

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI ++KVNV+GGAVS GHPLG
Sbjct  335  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITSEKVNVNGGAVSLGHPLG  394

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  395  CSGARILITLLGILKNRN  412



>ref|XP_006279490.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
 gb|EOA12388.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
Length=414

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF EDG SVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKEDG-SVTAGNASSISDGAAALVLVSGEKAIELGLHVIAKIRGYADAAQAPELFTTT  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK AGL+ASQVDYYEINEAF+ VALANQKLLG++ +++N HGGAVS GHPLG
Sbjct  304  PALAIPKAIKQAGLDASQVDYYEINEAFSVVALANQKLLGLDPERLNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRAKK  381



>gb|AHZ96597.1| acetyl-CoA C-acetyl transferase [Aquilaria sinensis]
Length=411

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPE FTT+
Sbjct  241  PSFKENGGSVTAGNASSISDGAAALVLVSGEKARKLGLQVIAKIRGYADAAQAPEWFTTA  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGLEASQ+DYYEINEAF+ VALANQKLLG+N  ++NVHGG VS GHP+G
Sbjct  301  PALAIPKAISCAGLEASQIDYYEINEAFSVVALANQKLLGLNPGRLNVHGGGVSLGHPIG  360

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  361  CSGARILVTLLGVLRHKK  378



>ref|XP_008464274.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Cucumis melo]
Length=439

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL  IA I GYADAAQAPELFTT+
Sbjct  269  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEAIAVIKGYADAAQAPELFTTA  328

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L ASQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  329  PALAIPKAISNACLHASQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  388

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  389  CSGARILVTLLGVLRQRN  406



>ref|XP_006600285.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=432

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  263  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  322

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLLG++ +KVN HGGAVS GHPLG
Sbjct  323  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLGLDPEKVNAHGGAVSLGHPLG  382

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  383  CSGARILVTLLGVLRQKR  400



>ref|XP_003580738.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=401

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I G+ADAAQAPELFTT+
Sbjct  241  PSFKENAGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGFADAAQAPELFTTT  300

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGLE+S VD+YEINEAF+AVALANQKLLGI ++K+NVHGGAVS GHPLG
Sbjct  301  PALAIPKALSNAGLESSSVDFYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG  360

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTL+GVL++K
Sbjct  361  CSGARILVTLIGVLREK  377



>ref|NP_568694.2| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q8S4Y1.1|THIC1_ARATH RecName: Full=Acetyl-CoA acetyltransferase, cytosolic 1; AltName: 
Full=Cytosolic acetoacetyl-CoA thiolase 1; Short=Thiolase 
1; AltName: Full=Protein EMBRYO DEFECTIVE 1276 [Arabidopsis 
thaliana]
 gb|AAM00280.1|AF364059_1 acetoacetyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAH19918.1| AT5G48230 [Arabidopsis thaliana]
 gb|AED95638.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=403

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLLVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIAPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>ref|XP_003529679.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=400

 Score =   223 bits (569),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  240  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  299

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  300  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLALNPEKVNVYGGAVSLGHPLG  359

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  360  CSGARILVTLLGVLRQKR  377



>ref|XP_008661103.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Zea 
mays]
Length=410

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAAL LVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  250  PSFKENCGTVTAGNASSISDGAAALALVSGQKAQELGLQVLARIKGYADAAQAPELFTTT  309

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD+YEINEAF+AVALANQKLLGI ++K NVHGGAVS GHPLG
Sbjct  310  PALAIPKAITNAGLESSHVDFYEINEAFSAVALANQKLLGIPSEKTNVHGGAVSLGHPLG  369

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K+
Sbjct  370  CSGARILVTLLGVLRAKS  387



>ref|NP_851154.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL24148.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AAM14210.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AED95639.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=398

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  238  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLLVLAKIKGYGDAAQEPEFFTTA  297

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  298  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIAPEKVNVNGGAVSLGHPLG  357

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  358  CSGARILITLLGILKKRN  375



>ref|XP_006584106.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=409

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVS ++A ELGL VIAKI GY DAA+APELFTT+
Sbjct  240  PSFKEVGGSVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGYGDAAKAPELFTTA  299

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLL +N +KVNV+GGAVS GHPLG
Sbjct  300  PSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLALNPEKVNVYGGAVSLGHPLG  359

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QK 
Sbjct  360  CSGARILVTLLGVLRQKR  377



>ref|XP_008464273.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cucumis melo]
Length=451

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL  IA I GYADAAQAPELFTT+
Sbjct  291  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEAIAVIKGYADAAQAPELFTTA  350

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L ASQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  351  PALAIPKAISNACLHASQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  410

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  411  CSGARILVTLLGVLRQRN  428



>ref|XP_010547202.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Tarenaya 
hassleriana]
Length=403

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+ K+ GYADAAQ PE FTT+
Sbjct  243  PSFKDNGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLGKVKGYADAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLEASQ+D+YEINEAF+ VALANQKLLG+N +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIGHAGLEASQIDFYEINEAFSVVALANQKLLGLNPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  363  CSGARILVTLLGVLRQRN  380



>ref|XP_006395207.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
 gb|ESQ32493.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
Length=403

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVFAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+L+++N
Sbjct  363  CSGARILITLLGILRKRN  380



>ref|XP_009151624.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Brassica 
rapa]
Length=403

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AK+ GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKVKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  363  CSGARILITLLGILKNRN  380



>gb|ACN41149.1| unknown [Picea sitchensis]
Length=404

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E GGSVTAGN+S+ISDGAAALVLVSG++A ELGL VIAKITGYADAAQAPELFTT+
Sbjct  245  PAFKE-GGSVTAGNASTISDGAAALVLVSGEKALELGLEVIAKITGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLEASQ+DYYEINEAF+ VALANQK+L +  + VNVHGGAVS GHPLG
Sbjct  304  PSLAIPKAISRAGLEASQIDYYEINEAFSVVALANQKILDLKPETVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLGVL+QKN
Sbjct  364  CSGARIMVTLLGVLRQKN  381



>ref|XP_008464272.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cucumis melo]
Length=461

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF +DGG+VTAGN+S ISDGAAALVLVSGK+A ELGL  IA I GYADAAQAPELFTT+
Sbjct  291  PSFKKDGGTVTAGNASIISDGAAALVLVSGKKALELGLEAIAVIKGYADAAQAPELFTTA  350

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L ASQ+DYYEINEAF+ VALANQK+LG++ D+VN HGGAVS GHPLG
Sbjct  351  PALAIPKAISNACLHASQIDYYEINEAFSVVALANQKILGLDPDRVNAHGGAVSLGHPLG  410

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  411  CSGARILVTLLGVLRQRN  428



>gb|KGN43403.1| hypothetical protein Csa_7G031640 [Cucumis sativus]
Length=360

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAA+VLVSGK+A ELGL VI KI GYADAA  PE FTT+
Sbjct  221  PSFKDNGGTVTAGNASSISDGAAAIVLVSGKKALELGLEVIGKIKGYADAAHEPEFFTTA  280

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI +AGLEASQ+D+YEINEAFA VALANQKLLGI+ DKVNVHGGAVS GHPLG
Sbjct  281  PALAVPKAISHAGLEASQIDFYEINEAFAVVALANQKLLGISPDKVNVHGGAVSLGHPLG  340

Query  240  CSGARILVTLLGVLK  196
            CSGARILVTLLG+++
Sbjct  341  CSGARILVTLLGLVR  355



>emb|CDX86320.1| BnaA06g30370D [Brassica napus]
Length=425

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AK+ GY DAAQ PE FTT+
Sbjct  265  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVLAKVKGYGDAAQEPEFFTTA  324

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  325  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGITPEKVNVNGGAVSLGHPLG  384

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  385  CSGARILITLLGILKNRN  402



>ref|XP_011095903.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095904.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095905.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
Length=417

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG  A +LGL VIA+I GYADAAQAPELFTT+
Sbjct  244  PSFKEKGGSVTAGNASSISDGAAALVLVSGAMAVKLGLKVIARIRGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI N+GL+AS +D+YEINEAF+ VALANQKLL I+ +K+NVHGGAVS GHP+G
Sbjct  304  PAIAIPKAISNSGLKASNIDFYEINEAFSVVALANQKLLNIDPEKLNVHGGAVSLGHPIG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  364  CSGARILVTLLGVLRQKN  381



>gb|KJB42689.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=405

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAAL+LVSG++A +LGL VIAKI GYADAAQAPE FTT+
Sbjct  247  PSFKDNGGTVTAGNASSISDGAAALILVSGEKALKLGLQVIAKIAGYADAAQAPEFFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQVDYYEINEAFA VALANQKLL +N   VNV+GGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLDASQVDYYEINEAFAVVALANQKLLDLN--PVNVNGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLKQKN
Sbjct  365  CSGARILVTLLGVLKQKN  382



>ref|XP_011095902.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Sesamum indicum]
Length=428

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG  A +LGL VIA+I GYADAAQAPELFTT+
Sbjct  255  PSFKEKGGSVTAGNASSISDGAAALVLVSGAMAVKLGLKVIARIRGYADAAQAPELFTTA  314

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI N+GL+AS +D+YEINEAF+ VALANQKLL I+ +K+NVHGGAVS GHP+G
Sbjct  315  PAIAIPKAISNSGLKASNIDFYEINEAFSVVALANQKLLNIDPEKLNVHGGAVSLGHPIG  374

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+QKN
Sbjct  375  CSGARILVTLLGVLRQKN  392



>ref|XP_004507588.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X2 [Cicer arietinum]
Length=408

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F + GG+VTAGN+SSISDGAAALVLVS ++A ELGL VIAKI G+ADAAQAPELF T+
Sbjct  238  PNFKKVGGTVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGFADAAQAPELFPTA  297

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEASQ+DYYEINEAF+ VALANQKLLG++ +KVNVHGGAVS GHPLG
Sbjct  298  PALAIPKAITNAGLEASQIDYYEINEAFSVVALANQKLLGLDPEKVNVHGGAVSLGHPLG  357

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTLLGVL+ K
Sbjct  358  CSGARILVTLLGVLRHK  374



>gb|EYU42778.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=401

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GG+VTAGN+SSISDGAAALVLVSG++A +LGL VIAKI+GYADAAQAPELFTT+
Sbjct  245  PSFKETGGTVTAGNASSISDGAAALVLVSGEKALKLGLQVIAKISGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLEAS++DYYEINEAFA VALANQKLL ++ +KVNVHGGAVS GHPLG
Sbjct  305  PALAIPKAISNAGLEASKIDYYEINEAFAVVALANQKLLTLSPEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLG  205
            CSGARILVTLLG
Sbjct  365  CSGARILVTLLG  376



>gb|ACN40771.1| unknown [Picea sitchensis]
Length=404

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E GG+VTAGN+S+ISDGAAALVLVSG++A ELGL VIAKITGYADAAQAPELFTT+
Sbjct  245  PAFKE-GGTVTAGNASTISDGAAALVLVSGEKALELGLQVIAKITGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI  AGLEASQ+DYYEINEAF+ VALANQK+L +  + VNVHGGAVS GHPLG
Sbjct  304  PSLAIPKAISRAGLEASQIDYYEINEAFSVVALANQKILDLKPETVNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLGVL+Q+N
Sbjct  364  CSGARIMVTLLGVLRQRN  381



>ref|XP_006280568.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
 gb|EOA13466.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
Length=403

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG +A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  243  PSFKENGGTVTAGNASSISDGAAALVLVSGAKALQLGLQVLAKIKGYGDAAQEPEFFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLL I+ +KVNV+GGAVS GHPLG
Sbjct  303  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLAISPEKVNVNGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  363  CSGARILITLLGILKKRN  380



>emb|CDX85319.1| BnaC07g26300D [Brassica napus]
Length=425

 Score =   222 bits (566),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AK+ GY DAAQ PE FTT+
Sbjct  265  PSFKDNGGTVTAGNASSISDGAAALVLVSGEKALQLGLKVLAKVKGYGDAAQEPEFFTTA  324

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  325  PALAIPKAIADAGLESSQVDYYEINEAFAVVALANQKLLGITREKVNVNGGAVSLGHPLG  384

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK +N
Sbjct  385  CSGARILITLLGILKNRN  402



>dbj|BAA97003.1| acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
Length=486

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V+AKI GY DAAQ PE FTT+
Sbjct  326  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLLVLAKIKGYGDAAQEPEFFTTA  385

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  386  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIAPEKVNVNGGAVSLGHPLG  445

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+LK++N
Sbjct  446  CSGARILITLLGILKKRN  463



>gb|KHG07894.1| hypothetical protein F383_03812 [Gossypium arboreum]
Length=415

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSGK+A ELGL V+AKI GYADAAQAPE FTT+
Sbjct  243  PSFKANGGTVTAGNASSISDGAAALVLVSGKKAVELGLQVVAKIRGYADAAQAPEWFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQ+D+YEINEAF+ VAL NQKLL +N +K+NVHGGAVS GHPLG
Sbjct  303  PALAIPKAISAAGLDASQIDFYEINEAFSVVALVNQKLLHLNPEKLNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  363  CSGARILVTLLGVLRHKK  380



>ref|XP_006857772.1| hypothetical protein AMTR_s00061p00203040 [Amborella trichopoda]
 gb|ERN19239.1| hypothetical protein AMTR_s00061p00203040 [Amborella trichopoda]
Length=459

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E GGSVTAGN+S+ISDGAAA+VLVSG++A  LGL VIAKITGYADAAQAPELFTT+
Sbjct  300  PAFKE-GGSVTAGNASTISDGAAAMVLVSGEKALNLGLHVIAKITGYADAAQAPELFTTA  358

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NA LEASQ+DYYEINEAF+ VALANQKLL +N DKVNVHGGAVS GHPLG
Sbjct  359  PALAIPKAVSNAHLEASQIDYYEINEAFSVVALANQKLLTLNPDKVNVHGGAVSLGHPLG  418

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+V+LLGVLKQ++
Sbjct  419  CSGARIIVSLLGVLKQRS  436



>gb|KJB68526.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=379

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSGK+A ELGL V+AKI GYADAAQAPE FTT+
Sbjct  243  PSFKANGGTVTAGNASSISDGAAALVLVSGKKAVELGLQVVAKIRGYADAAQAPEWFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQ+DYYEINEAF+ VALANQKLL +N +K+NVHGGAVS GHPLG
Sbjct  303  PALAIPKAISAAGLDASQIDYYEINEAFSVVALANQKLLHLNPEKLNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLGVLKQ  193
            CSGARILVTLLGV+ +
Sbjct  363  CSGARILVTLLGVIHR  378



>ref|XP_010675964.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Beta 
vulgaris subsp. vulgaris]
Length=417

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GGSVTAGNSS ISDGAAALVLVSG++A +LGL VIA+I G+ADAAQ PE FTT+
Sbjct  247  PSFKKNGGSVTAGNSSLISDGAAALVLVSGEKAKKLGLHVIARIKGFADAAQDPEWFTTA  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE SQ+D+YEINEAF+ VALANQKLLG++ +KVNVHGGAVS GHPLG
Sbjct  307  PALAIPKAISNAGLEPSQIDFYEINEAFSVVALANQKLLGLDPEKVNVHGGAVSLGHPLG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGAR+LVTLLGVL QK 
Sbjct  367  CSGARVLVTLLGVLNQKR  384



>gb|EYU27653.1| hypothetical protein MIMGU_mgv1a007243mg [Erythranthe guttata]
Length=414

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GGSVTAGN+S+ISDGAAALVLVSG  A +LGL VIA+I GYADAAQAPELFTT+
Sbjct  244  PSFKENGGSVTAGNASTISDGAAALVLVSGVVAIKLGLNVIARIRGYADAAQAPELFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI N+GL+AS +D+YEINEAF+ VALANQ+LL I+ +++NVHGGAVS GHPLG
Sbjct  304  PALAIPKAISNSGLKASDIDFYEINEAFSVVALANQRLLNIDPERLNVHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q+N
Sbjct  364  CSGARILVTLLGVLRQRN  381



>gb|AAL18924.1|AF429383_1 acetyl Co-A acetyltransferase [Hevea brasiliensis]
Length=411

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  579  GSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTSPALAIPK  400
            GSVTAGN+S ISDGAAALVLVSG++A ELGL VIA+I GY DAAQAPELFTT+PALAIPK
Sbjct  248  GSVTAGNASIISDGAAALVLVSGEKAIELGLQVIARIRGYGDAAQAPELFTTAPALAIPK  307

Query  399  AIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLGCSGARIL  220
            AI NAGLEASQ+DYYEINEAF+ VALANQK+LG+N +K+NVHGGAVS GHPLGCSGARIL
Sbjct  308  AISNAGLEASQIDYYEINEAFSVVALANQKILGLNPEKLNVHGGAVSLGHPLGCSGARIL  367

Query  219  VTLLGVLKQKN  187
            VTLLGVL+ KN
Sbjct  368  VTLLGVLRHKN  378



>gb|KFK31312.1| hypothetical protein AALP_AA6G096400 [Arabis alpina]
Length=404

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAALVLVSG++A +LGL V AK+ GY DAAQ PE FTT+
Sbjct  244  PSFKENGGTVTAGNASSISDGAAALVLVSGEKALQLGLQVFAKVKGYGDAAQEPEFFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGLE+SQVDYYEINEAFA VALANQKLLGI  +KVNV+GGAVS GHPLG
Sbjct  304  PALAIPKAIAHAGLESSQVDYYEINEAFAVVALANQKLLGIVPEKVNVNGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARIL+TLLG+L++++
Sbjct  364  CSGARILITLLGILRKRS  381



>gb|ACX46381.1| acetoacetyl-CoA thiolase [Helianthus annuus]
Length=411

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GGSVTAGN+SSISDGAAALVLVSG++A +LGL VIAKI G+ADAAQAPELFTT+
Sbjct  242  PSFKVEGGSVTAGNASSISDGAAALVLVSGEKALKLGLKVIAKIRGFADAAQAPELFTTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGL ASQ+DYYEINEAF+ VALANQKLL I   ++N HGGAVS GHPLG
Sbjct  302  PSLAIPKAISNAGLTASQIDYYEINEAFSVVALANQKLLKIGDSQLNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+Q N
Sbjct  362  CSGARILVTLLGVLRQNN  379



>gb|EMS66391.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=523

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I G+ADAAQAPELFTT+
Sbjct  363  PSFKENAGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGFADAAQAPELFTTT  422

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NA LE+S VD+YEINEAFAAVALANQK+LGI ++K+NVHGGAVS GHPLG
Sbjct  423  PALAIPKALSNASLESSSVDFYEINEAFAAVALANQKILGIPSEKINVHGGAVSLGHPLG  482

Query  240  CSGARILVTLLGVLKQK  190
            CSGARILVTL+GVL++K
Sbjct  483  CSGARILVTLIGVLREK  499



>gb|KDO78588.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=404

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +A ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKALELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG++ ++VN HGGAVS GHPLG
Sbjct  304  PSLAIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGLDPEQVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRHKK  381



>ref|XP_001773218.1| predicted protein [Physcomitrella patens]
 gb|EDQ61908.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  DGGSVTAGN+SSISDGAAALVLVSG +A ELGL VIAKI GYADAAQAPELFTTS
Sbjct  244  PAFKSDGGSVTAGNASSISDGAAALVLVSGAKAKELGLQVIAKIRGYADAAQAPELFTTS  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA+AIPKAI  AG++ SQVD+YEINEAFA V++ANQ++L +  + VN HGGAVS GHPLG
Sbjct  304  PAIAIPKAISRAGIDQSQVDFYEINEAFAVVSVANQQILKLKPESVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK+KN
Sbjct  364  CSGARILVTLLGVLKEKN  381



>gb|KJB68525.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=375

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTAGN+SSISDGAAALVLVSGK+A ELGL V+AKI GYADAAQAPE FTT+
Sbjct  243  PSFKANGGTVTAGNASSISDGAAALVLVSGKKAVELGLQVVAKIRGYADAAQAPEWFTTA  302

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI  AGL+ASQ+DYYEINEAF+ VALANQKLL +N +K+NVHGGAVS GHPLG
Sbjct  303  PALAIPKAISAAGLDASQIDYYEINEAFSVVALANQKLLHLNPEKLNVHGGAVSLGHPLG  362

Query  240  CSGARILVTLLG  205
            CSGARILVTLLG
Sbjct  363  CSGARILVTLLG  374



>gb|KDO78587.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=414

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +A ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKALELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG++ ++VN HGGAVS GHPLG
Sbjct  304  PSLAIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGLDPEQVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRHKK  381



>ref|XP_006467262.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Citrus sinensis]
Length=414

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +A ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKALELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG++ ++VN HGGAVS GHPLG
Sbjct  304  PSLAIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGLDPEQVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRHKK  381



>gb|EMT07958.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=424

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 128/142 (90%), Gaps = 5/142 (4%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAALVLVSG++A ELGL V+A+I G+ADAAQAPELFTT+
Sbjct  259  PSFKENAGTVTAGNASSISDGAAALVLVSGQKAQELGLQVLARIKGFADAAQAPELFTTT  318

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINA-----DKVNVHGGAVSX  256
            PALAIPKA+ NAGLE+S VD+YEINEAFAAVALANQK+LGI +     +K+NVHGGAVS 
Sbjct  319  PALAIPKALSNAGLESSSVDFYEINEAFAAVALANQKILGIPSQVYLQEKINVHGGAVSL  378

Query  255  GHPLGCSGARILVTLLGVLKQK  190
            GHPLGCSGARILVTL+GVL++K
Sbjct  379  GHPLGCSGARILVTLIGVLREK  400



>ref|XP_010689228.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF + GG+VTAGN+SSISDGAAALVLVSG++A ELGL VIAKI+GY DAAQAPE FTT+
Sbjct  245  PSFKDVGGTVTAGNASSISDGAAALVLVSGQKALELGLEVIAKISGYGDAAQAPEKFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKAI +AGL ASQ+DYYEINEAF+ VA+AN KLL + A+KVNVHGGAVS GHPLG
Sbjct  305  PALAVPKAISHAGLNASQIDYYEINEAFSVVAVANMKLLEVPAEKVNVHGGAVSLGHPLG  364

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLGVL+QK+
Sbjct  365  CSGARIIVTLLGVLRQKS  382



>ref|XP_002968816.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
 gb|EFJ29932.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
Length=419

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E GGSVTAGN+SSISDGAAALVLVSG +A ELGL VI KI GY DA Q+PELFTTS
Sbjct  249  PAFKE-GGSVTAGNASSISDGAAALVLVSGAKALELGLKVIGKIIGYGDAEQSPELFTTS  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ SQV+YY+INEAFA VALANQKLL ++ +KVNVHGGAVS GHPLG
Sbjct  308  PALAIPKAIKHAGIDPSQVEYYDINEAFAVVALANQKLLNLDPEKVNVHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK KN
Sbjct  368  CSGARILVTLLGVLKHKN  385



>gb|KDP35512.1| hypothetical protein JCGZ_08950 [Jatropha curcas]
Length=412

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+G SVTAGN+S ISDGAAALVLVSG++A +LGL VIA+I GYADAAQAPELF T+
Sbjct  243  PSFKENG-SVTAGNASIISDGAAALVLVSGEKAIKLGLQVIARIRGYADAAQAPELFPTA  301

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ SQ+DYYEINEAF+ VALANQKLL +  +KVNVHGGAVS GHPLG
Sbjct  302  PALAIPKAISNAGLKTSQIDYYEINEAFSVVALANQKLLNLKPEKVNVHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  362  CSGARILVTLLGVLRHKN  379



>ref|XP_010087672.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB29565.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=434

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF + GG+VTAGN+S ISDGAAA VLVSG++A +L L VIAKI G+ADAAQAPELFTT+
Sbjct  275  PSF-KKGGTVTAGNASIISDGAAAFVLVSGEKALQLSLQVIAKIKGFADAAQAPELFTTA  333

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLLG+  +K+NVHGGAVS GHPLG
Sbjct  334  PALAIPKAISNAGLKASQIDYYEINEAFSVVALANQKLLGLEPEKLNVHGGAVSLGHPLG  393

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ KN
Sbjct  394  CSGARILVTLLGVLRHKN  411



>gb|ABD57973.1| acetoacetyl-coenzyme A thiolase [Arnebia euchroma]
Length=419

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  DGGSVTAGN+SSISDGAAALVLVSG++A   GL VIAKI G+ADAAQAPELFTT+
Sbjct  248  PTFKPDGGSVTAGNASSISDGAAALVLVSGEKAIFFGLHVIAKIRGFADAAQAPELFTTA  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKN+GL ASQ+DYYEINEAF+ VAL NQ+LL + ++++N+HGGAVS GHPLG
Sbjct  308  PALAIPKAIKNSGLVASQIDYYEINEAFSVVALVNQRLLNLKSEQLNLHGGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CS ARILVTLLGVL+ KN
Sbjct  368  CSDARILVTLLGVLRHKN  385



>emb|CDP04540.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF ++GG+VTAGN+S ISDGAAALVLVSG++A +LGL VIAKI GYADAAQAPELFTT+
Sbjct  245  PSFKQNGGTVTAGNASIISDGAAALVLVSGEKALKLGLKVIAKIKGYADAAQAPELFTTA  304

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI ++GLE SQ+DYYEINEAF+ VAL NQKLL I+ +K+N HGGAV+ GHPLG
Sbjct  305  PALAIPKAISSSGLEQSQIDYYEINEAFSVVALVNQKLLNIDPEKLNAHGGAVALGHPLG  364

Query  240  CSGARILVTLLGVLKQK  190
            CSGARIL+TLLGV+++K
Sbjct  365  CSGARILITLLGVMREK  381



>ref|XP_006449940.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63180.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=404

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +  ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+L IPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG++ ++VN HGGAVS GHPLG
Sbjct  304  PSLVIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGLDPEQVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRHKK  381



>ref|XP_006449941.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63181.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=414

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +  ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+L IPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG++ ++VN HGGAVS GHPLG
Sbjct  304  PSLVIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGLDPEQVNAHGGAVSLGHPLG  363

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  364  CSGARILVTLLGVLRHKK  381



>ref|XP_002536874.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF25509.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=173

 Score =   207 bits (527),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -1

Query  543  DGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTSPALAIPKAIKNAGLEASQV  364
            DGAAALVLVSG+ A +LGL VIAKITGYADAAQAPELFTT+PALA+PKAI NAGL+ASQV
Sbjct  32   DGAAALVLVSGETALKLGLQVIAKITGYADAAQAPELFTTAPALAVPKAISNAGLDASQV  91

Query  363  DYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLGCSGARILVTLLGVLKQKN  187
            DYYEINEAFA VALANQKLLGIN +K+NVHGGAVS GHPLGCSGARILVTLLG L+QKN
Sbjct  92   DYYEINEAFAVVALANQKLLGINPEKINVHGGAVSLGHPLGCSGARILVTLLGALRQKN  150



>gb|KDO50953.1| hypothetical protein CISIN_1g0154951mg, partial [Citrus sinensis]
Length=142

 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -1

Query  543  DGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTSPALAIPKAIKNAGLEASQV  364
            DGAAALVLVSG++  +LGL VIAKITGYADAAQAPE+FTT+PALAIPKAI NAGLEASQV
Sbjct  1    DGAAALVLVSGEKVLKLGLQVIAKITGYADAAQAPEMFTTAPALAIPKAISNAGLEASQV  60

Query  363  DYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLGCSGARILVTLLGVLKQKN  187
            D YEINEAFA VALANQKLLG+N DKVNVHGGAV+ GHPLGCSGARILVTLLGVL+QKN
Sbjct  61   DCYEINEAFAVVALANQKLLGLNPDKVNVHGGAVALGHPLGCSGARILVTLLGVLRQKN  119



>gb|KHN42262.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=419

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 124/148 (84%), Gaps = 10/148 (7%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSIS----------DGAAALVLVSGKRAXELGLTVIAKITGYADA  451
            PSF E GGSVTAGN+SSI           DGAAALVLVS ++A ELGL VIAKI GY DA
Sbjct  240  PSFKEVGGSVTAGNASSIRTFLLFVSPHIDGAAALVLVSEEKARELGLHVIAKIKGYGDA  299

Query  450  AQAPELFTTSPALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHG  271
            A+APELFTT+P+LAIPKAI NAGL+ASQ+DYYEINEAF+ VALANQKLL +N +KVNV+G
Sbjct  300  AKAPELFTTAPSLAIPKAISNAGLDASQIDYYEINEAFSVVALANQKLLALNPEKVNVYG  359

Query  270  GAVSXGHPLGCSGARILVTLLGVLKQKN  187
            GAVS GHPLGCSGARILVTLLGVL+QK 
Sbjct  360  GAVSLGHPLGCSGARILVTLLGVLRQKR  387



>ref|XP_006643659.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Oryza 
brachyantha]
Length=351

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  182  PTFKKNG-SVTAGNSSSISDGAAAIVLVSGQKANSLGLQVIARIRGYADAAQAPELFTTA  240

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPK+I NAGL+ SQVDY+EINEAF+ VALANQKLLGI + K+NV+GG VS GHP+G
Sbjct  241  PALAIPKSISNAGLQTSQVDYFEINEAFSVVALANQKLLGIPSGKLNVNGGGVSLGHPIG  300

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+ KN
Sbjct  301  CSGARIVVTLLGILRHKN  318



>ref|XP_002974156.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
 gb|EFJ25111.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
Length=409

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E GGSVTAGN+SSISDGAAALVLVSG +A ELGL VIAKI GY DA Q+PELFTTS
Sbjct  249  PAFKE-GGSVTAGNASSISDGAAALVLVSGAKALELGLKVIAKIIGYGDAEQSPELFTTS  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ SQV+YY+INEAFA VALANQKLL ++ +KVNV  GAVS GHPLG
Sbjct  308  PALAIPKAIKHAGIDPSQVEYYDINEAFAVVALANQKLLNLDPEKVNVIDGAVSLGHPLG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVLK KN
Sbjct  368  CSGARILVTLLGVLKHKN  385



>ref|NP_001041797.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAB39872.1| putative acetoacetyl-coenzyme A thiolase [Oryza sativa Japonica 
Group]
 dbj|BAF03711.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAG95946.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53732.1| hypothetical protein OsJ_00082 [Oryza sativa Japonica Group]
Length=416

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  247  PTFKKNG-SVTAGNSSSISDGAAAIVLVSGQKAKSLGLQVIARIRGYADAAQAPELFTTT  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGL+ SQ+DYYEINEAF+ VALANQKLLGI + K+N+ GG VS GHP+G
Sbjct  306  PALAIPKAVSNAGLQTSQIDYYEINEAFSVVALANQKLLGIPSGKLNLSGGGVSLGHPIG  365

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+ KN
Sbjct  366  CSGARIIVTLLGILRHKN  383



>gb|EEC69797.1| hypothetical protein OsI_00091 [Oryza sativa Indica Group]
Length=416

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  247  PTFKKNG-SVTAGNSSSISDGAAAIVLVSGQKAKSLGLQVIARIRGYADAAQAPELFTTT  305

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+ NAGL+ SQ+DYYEINEAF+ VALANQKLLGI + K+N+ GG VS GHP+G
Sbjct  306  PALAIPKAVSNAGLQTSQIDYYEINEAFSVVALANQKLLGIPSGKLNLSGGGVSLGHPIG  365

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+ KN
Sbjct  366  CSGARIIVTLLGILRHKN  383



>ref|NP_001141874.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 ref|XP_008654617.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X1 [Zea mays]
 gb|ACF87213.1| unknown [Zea mays]
 gb|ACG39847.1| acetyl-CoA acetyltransferase, cytosolic 2 [Zea mays]
 gb|ACR34643.1| unknown [Zea mays]
 gb|AFW79796.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 gb|AFW79797.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 2 [Zea mays]
Length=421

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+ITGYADAAQAPELFTT+
Sbjct  252  PTFKTNG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLEVIARITGYADAAQAPELFTTA  310

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L+ SQ+DYYE+NEAF+ VA+ANQ+LLGI + K+N+ GGAVS GHP+G
Sbjct  311  PALAIPKAISNAALQTSQIDYYEVNEAFSVVAIANQRLLGIPSGKLNLSGGAVSLGHPIG  370

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QKN
Sbjct  371  CSGARIIVTLLGILRQKN  388



>gb|EMS54102.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=341

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  182  PAFKKNG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVIARIRGYADAAQAPELFTTT  240

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI N+GL  SQ+DYYEINEAF+ VA+ANQ+LLGI+  K+N+ GGAVS GHP+G
Sbjct  241  PALAIPKAISNSGLRDSQIDYYEINEAFSVVAVANQRLLGISPGKLNISGGAVSLGHPIG  300

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QK 
Sbjct  301  CSGARIIVTLLGILRQKQ  318



>ref|XP_006449942.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63182.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=412

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 3/138 (2%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+S ISDGAAALVLVSG +  ELGL VIAKI G+ADAAQAPE FTT+
Sbjct  245  PSFKE-GGSVTAGNASIISDGAAALVLVSGVKVLELGLQVIAKIRGFADAAQAPEWFTTA  303

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+L IPKAI NAGLEASQ+DYYEINEAF+ VA+ANQKLLG+  D VN HGGAVS GHPLG
Sbjct  304  PSLVIPKAIANAGLEASQIDYYEINEAFSVVAIANQKLLGL--DPVNAHGGAVSLGHPLG  361

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLLGVL+ K 
Sbjct  362  CSGARILVTLLGVLRHKK  379



>gb|AFW88030.1| hypothetical protein ZEAMMB73_639334 [Zea mays]
Length=390

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+ G+VTAGN+SSISDGAAAL LVSG++A ELGL V+A+I GYADAAQAPELFTT+
Sbjct  203  PSFKENCGTVTAGNASSISDGAAALALVSGQKAQELGLQVLARIKGYADAAQAPELFTTT  262

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGLE+S VD+YEINEAF+AVALANQKLLGI ++K NVHGGAVS GHPLG
Sbjct  263  PALAIPKAITNAGLESSHVDFYEINEAFSAVALANQKLLGIPSEKTNVHGGAVSLGHPLG  322

Query  240  CSGARILV  217
            CSGARILV
Sbjct  323  CSGARILV  330



>ref|XP_008654616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X3 [Zea mays]
Length=451

 Score =   211 bits (537),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+ITGYADAAQAPELFTT+
Sbjct  252  PTFKTNG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLEVIARITGYADAAQAPELFTTA  310

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L+ SQ+DYYE+NEAF+ VA+ANQ+LLGI + K+N+ GGAVS GHP+G
Sbjct  311  PALAIPKAISNAALQTSQIDYYEVNEAFSVVAIANQRLLGIPSGKLNLSGGAVSLGHPIG  370

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QKN
Sbjct  371  CSGARIIVTLLGILRQKN  388



>ref|XP_004967970.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
Length=421

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  252  PTFKANG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVIARIRGYADAAQAPELFTTA  310

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PAL+IPKAI +AGL+ SQ+DYYEINEAFA VALANQ+LLGI ++K+N+ GGAVS GHP+G
Sbjct  311  PALSIPKAISSAGLQTSQIDYYEINEAFAVVALANQRLLGIPSEKLNLSGGAVSLGHPIG  370

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+VTLLG+L+QK
Sbjct  371  CSGARIIVTLLGILRQK  387



>ref|XP_008654615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X2 [Zea mays]
Length=467

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+ITGYADAAQAPELFTT+
Sbjct  252  PTFKTNG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLEVIARITGYADAAQAPELFTTA  310

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NA L+ SQ+DYYE+NEAF+ VA+ANQ+LLGI + K+N+ GGAVS GHP+G
Sbjct  311  PALAIPKAISNAALQTSQIDYYEVNEAFSVVAIANQRLLGIPSGKLNLSGGAVSLGHPIG  370

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QKN
Sbjct  371  CSGARIIVTLLGILRQKN  388



>dbj|BAJ96752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=299

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL V+A+I GYADAAQAPELFTT+
Sbjct  130  PAFKKNG-SVTAGNSSSISDGAAAVVLVSGEKAKSLGLQVLARIRGYADAAQAPELFTTT  188

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI N+GL  SQ+DYYEINEAF+ VA ANQ+LLGI+  K+N+ GGAVS GHP+G
Sbjct  189  PALAIPKAISNSGLRDSQIDYYEINEAFSVVAAANQRLLGISPGKLNISGGAVSLGHPIG  248

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QK+
Sbjct  249  CSGARIIVTLLGILRQKH  266



>ref|XP_004967971.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=413

 Score =   210 bits (534),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 124/137 (91%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  252  PTFKANG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVIARIRGYADAAQAPELFTTA  310

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PAL+IPKAI +AGL+ SQ+DYYEINEAFA VALANQ+LLGI ++K+N+ GGAVS GHP+G
Sbjct  311  PALSIPKAISSAGLQTSQIDYYEINEAFAVVALANQRLLGIPSEKLNLSGGAVSLGHPIG  370

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+VTLLG+L+QK
Sbjct  371  CSGARIIVTLLGILRQK  387



>emb|CAA55006.1| Acetoacetyl-coenzyme A thiolase [Raphanus sativus]
Length=406

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E+GG+VTAGN+SSISDGAAA+VLVSG++A +LGL V+AK+ GY DAAQ PE FTT+
Sbjct  244  PSFKENGGTVTAGNASSISDGAAAIVLVSGEKALQLGLQVLAKVKGYGDAAQEPEFFTTA  303

Query  420  PALAIPKAI--KNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHP  247
            PALAIPKAI   +   E+ QVDYYEINEAFA VALANQKLLGI+ +KVNV+GGAVS GHP
Sbjct  304  PALAIPKAIAPNSPYSESYQVDYYEINEAFAVVALANQKLLGISPEKVNVNGGAVSLGHP  363

Query  246  LGCSGARILVTLLGVLKQKN  187
            LGCSGARIL+TLLG+LK++N
Sbjct  364  LGCSGARILITLLGILKKRN  383



>ref|XP_004507587.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X1 [Cicer arietinum]
Length=433

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 125/162 (77%), Gaps = 25/162 (15%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F + GG+VTAGN+SSISDGAAALVLVS ++A ELGL VIAKI G+ADAAQAPELF T+
Sbjct  238  PNFKKVGGTVTAGNASSISDGAAALVLVSEEKARELGLHVIAKIKGFADAAQAPELFPTA  297

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFA-------------------------AVALAN  316
            PALAIPKAI NAGLEASQ+DYYEINEAF+                          VALAN
Sbjct  298  PALAIPKAITNAGLEASQIDYYEINEAFSVWNPSHILFVEALLFYANHCLTSMQVVALAN  357

Query  315  QKLLGINADKVNVHGGAVSXGHPLGCSGARILVTLLGVLKQK  190
            QKLLG++ +KVNVHGGAVS GHPLGCSGARILVTLLGVL+ K
Sbjct  358  QKLLGLDPEKVNVHGGAVSLGHPLGCSGARILVTLLGVLRHK  399



>emb|CDM80037.1| unnamed protein product [Triticum aestivum]
 emb|CDM80063.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   207 bits (526),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G +VTAGNSSSISDGAAA+VLVSG++A  LGL V+A+I GYADAAQAPELFTT+
Sbjct  249  PAFKKNG-AVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVLARIRGYADAAQAPELFTTT  307

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI NAGL  SQ+DYYEINEAF+ VA+ANQ+LLGI+  K+N+ GGAVS GHP+G
Sbjct  308  PALAIPKAISNAGLRDSQIDYYEINEAFSVVAVANQRLLGISPGKLNLSGGAVSLGHPIG  367

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QK 
Sbjct  368  CSGARIIVTLLGILRQKQ  385



>gb|EMT15552.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=452

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL V+A+I GYADAAQAPELFTT+
Sbjct  283  PAFKKNG-SVTAGNSSSISDGAAAIVLVSGEKAKNLGLQVLARIRGYADAAQAPELFTTT  341

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI N+GL  SQ+DYYEINEAF+ VA+ANQ+LLGI+  K+N+ GGAVS GHP+G
Sbjct  342  PALAIPKAISNSGLRDSQIDYYEINEAFSVVAVANQRLLGISPGKLNISGGAVSLGHPIG  401

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QK 
Sbjct  402  CSGARIIVTLLGILRQKQ  419



>ref|XP_003565785.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=417

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F ++G SVTAGNSSSISDGAAA+VLVSG++A  LGL VIA+I GYADAAQAPELFTT+
Sbjct  248  PAFKKNG-SVTAGNSSSISDGAAAVVLVSGEKAKNLGLQVIARIRGYADAAQAPELFTTT  306

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI N+GL+ SQ+DYYEINEAF+ VA+ANQ+LL I   K+N  GGAVS GHP+G
Sbjct  307  PALAIPKAISNSGLQTSQIDYYEINEAFSVVAVANQRLLDIPPGKLNASGGAVSLGHPIG  366

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+VTLLG+L+QK+
Sbjct  367  CSGARIIVTLLGILRQKH  384



>gb|AEZ55671.1| acetyl-CoA C-acetyltransferase 2 [Salvia miltiorrhiza]
Length=403

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -1

Query  597  SFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTSP  418
            SF E+GGSVTAGN+SSISDGAAALV+VSG  A +LGL VIA+I GYADAAQAPELFTT+P
Sbjct  241  SFKENGGSVTAGNASSISDGAAALVVVSGAMAVKLGLDVIARIRGYADAAQAPELFTTAP  300

Query  417  ALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLGC  238
            A+AIP+AI  +GL++S +++YEINEAF+ VALANQ+LL I+  ++NVHGG VS GHP+GC
Sbjct  301  AIAIPRAISQSGLKSSDIEFYEINEAFSVVALANQQLLSIDPARLNVHGGGVSLGHPIGC  360

Query  237  SGARILVTLLGVLKQ  193
            SGARILVTLLGVL+Q
Sbjct  361  SGARILVTLLGVLRQ  375



>gb|EIM78382.1| acetyl-CoA acetyltransferase [Nitritalea halalkaliphila LW7]
Length=225

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P F +DG +VTA N+S+++DGA+ALVLVS ++A ELGL  IAKI G+ADAAQ P  FTT+
Sbjct  66   PVFTKDG-TVTAANASTMNDGASALVLVSKEKAQELGLQPIAKIRGFADAAQDPLWFTTA  124

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIKNAG+E + VD+YEINEAF+AVALANQK L ++ADK+NV+GGAVS GHPLG
Sbjct  125  PALAIPKAIKNAGIEENDVDFYEINEAFSAVALANQKQLNLDADKLNVYGGAVSLGHPLG  184

Query  240  CSGARILVTLLGVLKQK  190
             SGARI+ TL  VL QK
Sbjct  185  ASGARIISTLCSVLGQK  201



>ref|WP_026898359.1| acetyl-CoA acetyltransferase [Pedobacter oryzae]
Length=392

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P F +DG +VTA N+S+++DG+AALVL+S ++A ELGL  +AKI GYADA QAPE FTT+
Sbjct  232  PVFKKDG-TVTAANASTLNDGSAALVLMSKEKAEELGLKPLAKIIGYADAQQAPEWFTTA  290

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+ AIP+A+KNAG+ A QVD+YEINEAF+ V+LAN K L ++A KVNV+GGAVS GHPLG
Sbjct  291  PSKAIPRALKNAGISAEQVDFYEINEAFSVVSLANNKELQLDAQKVNVNGGAVSMGHPLG  350

Query  240  CSGARILVTLLGVLKQKN  187
             SGARI+VTLL VL+Q N
Sbjct  351  ASGARIVVTLLNVLQQNN  368



>gb|EWC45148.1| acetyl-CoA acetyltransferase [Drechslerella stenobrocha 248]
Length=398

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F    G+VTA N+S +SDGAAAL+LVS  +  ELGLT IAKI G+ +AAQ P  FTT+
Sbjct  238  PAFKPADGTVTAPNASPLSDGAAALILVSEAKLAELGLTPIAKILGWGEAAQKPSKFTTA  297

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            P+LAIPKA+K++GL   QV+YYE+NEAF+ VALANQKLL ++++KVNVHGGAV+ GHPLG
Sbjct  298  PSLAIPKALKHSGLAQEQVEYYEVNEAFSVVALANQKLLSLDSEKVNVHGGAVALGHPLG  357

Query  240  CSGARILVTLLGVLKQKN  187
             SGAR+LVTL+GVL+QK 
Sbjct  358  ASGARVLVTLIGVLEQKQ  375



>gb|KFY13686.1| hypothetical protein V491_06314 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=399

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVLVS  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLVSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANLKLLGLDASKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>gb|EFX00901.1| acetyl-acetyltransferase [Grosmannia clavigera kw1407]
Length=400

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG+VTA N++ I+DGAAA+VLVS  +  ELGL  +AKI G+ DAAQ PE FTT+
Sbjct  239  PAFKPNGGTVTAANAAPINDGAAAVVLVSEAKLKELGLKPLAKILGWGDAAQEPERFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAI +AGL A+ VDYYEINEAF+ VALAN K+LG++ DKVNV GGAV+ GHPLG
Sbjct  299  PALAIPKAIAHAGLTAADVDYYEINEAFSVVALANAKILGLDVDKVNVFGGAVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL  VL++K
Sbjct  359  CSGARIVATLTTVLREK  375



>ref|WP_026879909.1| acetyl-CoA acetyltransferase [Hymenobacter norwichensis]
Length=392

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F +DGG+VTA N+S+++DGAAA++L+S ++A ELG+  +A+I G+ADA QAPE FTTS
Sbjct  232  PAFLKDGGTVTAANASTLNDGAAAVLLMSREKADELGIKPLARIRGFADAEQAPEWFTTS  291

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+K+AGLEA  VD+YEINEAF+ V+LAN KLL +   KVNV+GGAVS GHPLG
Sbjct  292  PALAIPKALKHAGLEAKDVDFYEINEAFSVVSLANNKLLNLEGTKVNVYGGAVSLGHPLG  351

Query  240  CSGARILVTLLGVLKQK  190
             SGARI+ TL+ VL  +
Sbjct  352  ASGARIVTTLVNVLHNE  368



>gb|KFY07615.1| hypothetical protein V492_06978 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY33649.1| hypothetical protein V494_07442 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=399

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVLVS  +  ELGL  +AKI G+ DAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLVSEAKVKELGLKPLAKILGWGDAAQKPNKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKLLGLDASKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>gb|ESA09717.1| hypothetical protein GLOINDRAFT_202383, partial [Rhizophagus 
irregularis DAOM 181602]
Length=220

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 112/139 (81%), Gaps = 2/139 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F E G SVTA NSS +SDGAAA+VL+SG++  ELG+  +AKI G+ DAAQ P  FTTS
Sbjct  60   PAFTEKG-SVTAPNSSPLSDGAAAIVLISGEKVKELGIKTLAKINGWGDAAQTPSKFTTS  118

Query  420  PALAIPKAIKNAG-LEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPL  244
            P+LAIPKA+ +AG +  SQVDY+EINEAF+ VALAN KLL ++ DKVNV GGAV+ GHPL
Sbjct  119  PSLAIPKALAHAGNIPISQVDYFEINEAFSVVALANLKLLELSKDKVNVFGGAVAMGHPL  178

Query  243  GCSGARILVTLLGVLKQKN  187
            GCSGARI+ TL+ VL+ KN
Sbjct  179  GCSGARIICTLISVLQNKN  197



>ref|XP_002483239.1| acetyl-CoA acetyltransferase, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED16005.1| acetyl-CoA acetyltransferase, putative [Talaromyces stipitatus 
ATCC 10500]
Length=300

 Score =   180 bits (456),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F    G+VTA NSS ++DGAAA+VLVS  +  EL L  IAKI G+ADAAQ P  FTTS
Sbjct  139  PAFIPGSGTVTAPNSSPLNDGAAAVVLVSEAKLKELNLKPIAKILGFADAAQQPSKFTTS  198

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+K AG+   Q+D +EINEAF+ VALAN KLLG++ DKVN+HGGAV+ GHPLG
Sbjct  199  PALAIPKALKKAGVTQDQIDAFEINEAFSVVALANMKLLGLSEDKVNIHGGAVAIGHPLG  258

Query  240  CSGARILVTLLGVLKQK  190
             SGARILVTLLGVLK K
Sbjct  259  ASGARILVTLLGVLKAK  275



>gb|ELR09971.1| acetyl-CoA C-acetyltransferase [Pseudogymnoascus destructans 
20631-21]
Length=399

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVL+S  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLMSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN K+LG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKILGLDAAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TLL VLK++
Sbjct  359  CSGARIVTTLLHVLKEQ  375



>gb|KFY70134.1| hypothetical protein V499_09436 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ00736.1| hypothetical protein V501_10497 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=399

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVL+S  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLMSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN K+LG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKILGLDAAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>gb|KCW45285.1| hypothetical protein EUGRSUZ_L01056 [Eucalyptus grandis]
Length=166

 Score =   174 bits (442),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 94/102 (92%), Gaps = 0/102 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF E GGSVTAGN+SSISDGAAALVLVSG++A ELGL VIAKI  YADAAQAPELFTT+
Sbjct  35   PSFKETGGSVTAGNASSISDGAAALVLVSGEKALELGLQVIAKIRAYADAAQAPELFTTT  94

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGIN  295
            PALAIPKAI NAGLEASQVDYYEINEAFA VALANQKLLGIN
Sbjct  95   PALAIPKAIANAGLEASQVDYYEINEAFAVVALANQKLLGIN  136



>gb|KFY46917.1| hypothetical protein V495_02185 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY64567.1| hypothetical protein V497_01662 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=399

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG+VTA N++ ++DGA+ALVL+S  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTVTAPNAAPLNDGASALVLMSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YE+NEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEVNEAFSVVALANIKLLGLDASKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VL+Q+
Sbjct  359  CSGARIVTTLIHVLQQQ  375



>gb|KFY01072.1| hypothetical protein V490_01093 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=399

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG+VTA N++ ++DGA+ALVL+S  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTVTAPNAAPLNDGASALVLMSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YE+NEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEVNEAFSVVALANIKLLGLDASKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VL+Q+
Sbjct  359  CSGARIVTTLIHVLQQQ  375



>gb|KFY05043.1| hypothetical protein O988_00301 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=399

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG+VTA N++ ++DGA+ALVL+S  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFQPNGGTVTAPNAAPLNDGASALVLMSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YE+NEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEVNEAFSVVALANIKLLGLDASKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VL+Q+
Sbjct  359  CSGARIVTTLIHVLQQQ  375



>ref|WP_010855680.1| Acetyl-CoA acetyltransferase [Cyclobacteriaceae bacterium AK24]
 gb|EON75960.1| Acetyl-CoA acetyltransferase [Cyclobacteriaceae bacterium AK24]
Length=397

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P F  + G+VTA N+S++SDGAAALVL+SG +  E G+  IAKI G+ADAAQ P  FTT+
Sbjct  235  PVFQPENGTVTAANASTLSDGAAALVLMSGDKLAEHGIKPIAKILGFADAAQDPLWFTTA  294

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+K+AG+   +V YYEINEAFAAVA+ANQ+LLGI +D++NV GGAV+ GHPLG
Sbjct  295  PALAIPKALKHAGISPEEVGYYEINEAFAAVAIANQRLLGIPSDRLNVFGGAVALGHPLG  354

Query  240  CSGARILVTLLGVLKQK  190
            CSGARIL TL  VL QK
Sbjct  355  CSGARILCTLNSVLSQK  371



>gb|KFY87056.1| hypothetical protein V500_07216 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=399

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVLVS  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFLPNGGTITAPNAAPINDGASALVLVSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN K+LG++  KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKILGLDPAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>ref|WP_013991848.1| acetyl-CoA acetyltransferase [Zobellia galactanivorans]
 ref|YP_004734927.1| acetyl-CoA acetyltransferase [Zobellia galactanivorans]
 emb|CAZ94536.1| Acetyl-CoA acetyltransferase [Zobellia galactanivorans]
Length=390

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F +DG +VTA N+S+I+DGAAALVL+S  +A ELGLT +A I  YADAAQ P+ FTT+
Sbjct  232  PAFSKDG-TVTAANASTINDGAAALVLMSADKAKELGLTPLATIKSYADAAQEPKWFTTA  290

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PA A+PKAI  AG+  + +D++E NEAF+ V LAN KLLG+  DKVNV+GGAVS GHPLG
Sbjct  291  PAKALPKAIAKAGISINDIDFFEFNEAFSVVGLANMKLLGLTDDKVNVNGGAVSLGHPLG  350

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARILVTLL VL+Q N
Sbjct  351  CSGARILVTLLNVLEQNN  368



>gb|EWG41746.1| acetyl-CoA C-acetyltransferase [Fusarium verticillioides 7600]
 gb|EWG41747.1| acetyl-CoA C-acetyltransferase [Fusarium verticillioides 7600]
Length=291

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  DG +VTA N++ I+DGAAA+VLVS  +  EL L  +AKI G+ DA + PE FT +
Sbjct  131  PAFKPDG-TVTAPNAAPINDGAAAVVLVSEAKLKELNLKPVAKILGWGDAEREPERFTIA  189

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AGL A QV+YYEINEAF+AVALAN KLLG+N D+VNV+GG+V+ GHPLG
Sbjct  190  PALAIPKAIKHAGLTADQVEYYEINEAFSAVALANMKLLGLNPDQVNVYGGSVAIGHPLG  249

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL  VLK+K
Sbjct  250  CSGARIVTTLTSVLKEK  266



>gb|KFZ10783.1| hypothetical protein V502_07930 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=399

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVLVS  +  ELGL  +AKI G+ADAAQ P  FTT+
Sbjct  239  PAFLPNGGTITAPNAAPINDGASALVLVSEAKVKELGLKPLAKILGWADAAQKPSKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN K+LG++  KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKILGLDPAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>emb|CDS14271.1| Putative Acetyl-CoA C-acetyltransferase [Absidia idahoensis var. 
thermophila]
Length=395

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P F +DG SVTA N+S +SDGAAA+VLVS + A +  L ++AKI G+ADAAQAP LFT S
Sbjct  236  PVFKKDG-SVTAPNASPLSDGAAAIVLVSREAAEKYNLPLLAKIRGWADAAQAPNLFTDS  294

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AGL    + +YEINEAF+ VA AN KLLG++ADKVN++GGAV+ GHPLG
Sbjct  295  PALAIPKAIKHAGLTPEDISFYEINEAFSVVACANLKLLGLSADKVNIYGGAVAMGHPLG  354

Query  240  CSGARILVTLLGVLKQKN  187
            CSGARI+ TLL VLKQK+
Sbjct  355  CSGARIIATLLTVLKQKD  372



>gb|KFY24540.1| hypothetical protein V493_05181 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=399

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVL+S  +  ELG+  +AKI G+ DAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLMSEAKVKELGIKPLAKILGWGDAAQKPNKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKLLGLDAAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>ref|XP_002483238.1| acetyl-CoA acetyltransferase, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED16004.1| acetyl-CoA acetyltransferase, putative [Talaromyces stipitatus 
ATCC 10500]
Length=398

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F    G+VTA NSS ++DGAAA+VLVS  +  EL L  IAKI G+ADAAQ P  FTTS
Sbjct  237  PAFIPGSGTVTAPNSSPLNDGAAAVVLVSEAKLKELNLKPIAKILGFADAAQQPSKFTTS  296

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKA+K AG+   Q+D +EINEAF+ VALAN KLLG++ DKVN+HGGAV+ GHPLG
Sbjct  297  PALAIPKALKKAGVTQDQIDAFEINEAFSVVALANMKLLGLSEDKVNIHGGAVAIGHPLG  356

Query  240  CSGARILVTLLGVLKQK  190
             SGARILVTLLGVLK K
Sbjct  357  ASGARILVTLLGVLKAK  373



>dbj|GAM82703.1| hypothetical protein ANO11243_006870 [fungal sp. No.11243]
Length=398

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            PSF  +GG+VTA N+S +SDGAAALVLVS  +  ELGL  I KI G+ DA ++P  FTT+
Sbjct  237  PSFKPNGGTVTAANASPLSDGAAALVLVSEAKVKELGLKPIGKILGWGDAEKSPSKFTTA  296

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALA+PKA+K+AG+E   VD +EINEAF+ VAL+N KLLG+  DKVN+HGGAV+ GHPLG
Sbjct  297  PALAVPKALKHAGVEQDAVDAFEINEAFSVVALSNMKLLGVKEDKVNLHGGAVALGHPLG  356

Query  240  CSGARILVTLLGVLKQKN  187
             SGARI+ TLLGVL++K 
Sbjct  357  ASGARIVTTLLGVLREKK  374



>gb|KFY58963.1| hypothetical protein V496_05895 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY96105.1| hypothetical protein V498_02898 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=399

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  +GG++TA N++ I+DGA+ALVL+S  +  ELG+  +AKI G+ DAAQ P  FTT+
Sbjct  239  PAFQPNGGTITAPNAAPINDGASALVLMSEAKVKELGIKPLAKILGWGDAAQKPNKFTTA  298

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AG++ASQVD YEINEAF+ VALAN KLLG++A KVN++GG+V+ GHPLG
Sbjct  299  PALAIPKAIKHAGIDASQVDAYEINEAFSVVALANMKLLGLDAAKVNINGGSVAIGHPLG  358

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL+ VLK++
Sbjct  359  CSGARIVTTLIHVLKEQ  375



>gb|EWZ42897.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum Fo47]
 gb|EWZ42898.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum Fo47]
 gb|EWZ42899.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum Fo47]
 gb|EXA00021.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA00022.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA00023.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. lycopersici 
MN25]
Length=291

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  DG +VTA N++ I+DGAAA+VLVS  +  EL L  +AKI G+ DA + PE FT +
Sbjct  131  PAFKPDG-TVTAPNAAPINDGAAAVVLVSEAKLKELNLKPVAKILGWGDAEREPERFTIA  189

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AGL A QV+YYEINEAF+AVALAN K+LG+N D+VNV+GG+V+ GHPLG
Sbjct  190  PALAIPKAIKHAGLTADQVEYYEINEAFSAVALANMKILGLNPDQVNVYGGSVAIGHPLG  249

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL  VLK+K
Sbjct  250  CSGARIVTTLTSVLKEK  266



>gb|EWY95310.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum FOSC 3-a]
 gb|EWY95311.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum FOSC 3-a]
 gb|EWY95312.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum FOSC 3-a]
 gb|EXA46834.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA46835.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA46836.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK32990.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK32991.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK32992.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK87867.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK87868.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK87869.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL58691.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL58692.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL58693.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL85671.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL85672.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL85673.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM03382.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM03383.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM03384.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM23169.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23170.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23171.1| acetyl-CoA C-acetyltransferase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=291

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = -1

Query  600  PSFXEDGGSVTAGNSSSISDGAAALVLVSGKRAXELGLTVIAKITGYADAAQAPELFTTS  421
            P+F  DG +VTA N++ I+DGAAA+VLVS  +  EL L  +AKI G+ DA + PE FT +
Sbjct  131  PAFKPDG-TVTAPNAAPINDGAAAVVLVSEAKLKELNLKPVAKILGWGDAEREPERFTIA  189

Query  420  PALAIPKAIKNAGLEASQVDYYEINEAFAAVALANQKLLGINADKVNVHGGAVSXGHPLG  241
            PALAIPKAIK+AGL A QV+YYEINEAF+AVALAN K+LG+N D+VNV+GG+V+ GHPLG
Sbjct  190  PALAIPKAIKHAGLTADQVEYYEINEAFSAVALANMKILGLNPDQVNVYGGSVAIGHPLG  249

Query  240  CSGARILVTLLGVLKQK  190
            CSGARI+ TL  VLK+K
Sbjct  250  CSGARIVTTLTSVLKEK  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940