BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF011L03

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP41542.1|  hypothetical protein JCGZ_15949                         255   1e-74   Jatropha curcas
ref|XP_009769216.1|  PREDICTED: receptor-like protein kinase HAIKU2     255   1e-74   Nicotiana sylvestris
gb|KDO81346.1|  hypothetical protein CISIN_1g047677mg                   237   1e-74   Citrus sinensis [apfelsine]
ref|XP_006356791.1|  PREDICTED: receptor-like protein kinase HAIK...    253   6e-74   Solanum tuberosum [potatoes]
ref|XP_004238042.1|  PREDICTED: receptor-like protein kinase HAIKU2     252   1e-73   Solanum lycopersicum
ref|XP_009591322.1|  PREDICTED: receptor-like protein kinase HAIKU2     247   7e-72   Nicotiana tomentosiformis
dbj|BAD94141.1|  leucine-rich repeat receptor-like kinase At1g09970     233   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KCW66704.1|  hypothetical protein EUGRSUZ_F00467                     246   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010060141.1|  PREDICTED: receptor-like protein kinase HAIKU2     246   2e-71   Eucalyptus grandis [rose gum]
gb|KHG17335.1|  Receptor-like protein kinase HAIKU2                     245   3e-71   Gossypium arboreum [tree cotton]
ref|XP_002283600.3|  PREDICTED: uncharacterized protein LOC100257433    248   6e-71   
ref|XP_006386429.1|  leucine-rich repeat transmembrane protein ki...    244   6e-71   Populus trichocarpa [western balsam poplar]
gb|KJB58765.1|  hypothetical protein B456_009G225300                    243   1e-70   Gossypium raimondii
emb|CDP00968.1|  unnamed protein product                                244   2e-70   Coffea canephora [robusta coffee]
ref|XP_006417507.1|  hypothetical protein EUTSA_v10006696mg             243   2e-70   Eutrema salsugineum [saltwater cress]
ref|XP_010667749.1|  PREDICTED: receptor-like protein kinase HAIKU2     243   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002510007.1|  Receptor protein kinase CLAVATA1 precursor, ...    242   5e-70   Ricinus communis
ref|XP_011016947.1|  PREDICTED: receptor-like protein kinase HAIKU2     242   6e-70   Populus euphratica
ref|XP_007018364.1|  Leucine-rich receptor-like protein kinase fa...    241   1e-69   
ref|XP_010490508.1|  PREDICTED: receptor-like protein kinase HAIKU2     239   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006433710.1|  hypothetical protein CICLE_v10000155mg             239   3e-69   Citrus clementina [clementine]
gb|KFK43299.1|  hypothetical protein AALP_AA1G106000                    239   5e-69   Arabis alpina [alpine rockcress]
ref|XP_010458318.1|  PREDICTED: receptor-like protein kinase HAIKU2     239   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010475857.1|  PREDICTED: receptor-like protein kinase HAIKU2     238   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006472374.1|  PREDICTED: receptor-like protein kinase HAIK...    238   1e-68   Citrus sinensis [apfelsine]
ref|XP_002889779.1|  hypothetical protein ARALYDRAFT_888250             237   3e-68   Arabidopsis lyrata subsp. lyrata
emb|CDY57935.1|  BnaA06g38030D                                          233   3e-68   Brassica napus [oilseed rape]
ref|XP_009357239.1|  PREDICTED: receptor-like protein kinase HAIKU2     236   4e-68   Pyrus x bretschneideri [bai li]
ref|XP_006306692.1|  hypothetical protein CARUB_v10008210mg             236   5e-68   Capsella rubella
ref|XP_008339015.1|  PREDICTED: receptor-like protein kinase HAIKU2     236   6e-68   
gb|KHG23504.1|  Receptor-like protein kinase HAIKU2                     236   6e-68   Gossypium arboreum [tree cotton]
emb|CDY62731.1|  BnaC05g49230D                                          236   8e-68   Brassica napus [oilseed rape]
gb|KJB29385.1|  hypothetical protein B456_005G097600                    236   8e-68   Gossypium raimondii
ref|XP_004136412.1|  PREDICTED: receptor-like protein kinase HAIK...    235   1e-67   Cucumis sativus [cucumbers]
ref|XP_010553669.1|  PREDICTED: receptor-like protein kinase HAIKU2     235   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_007227019.1|  hypothetical protein PRUPE_ppa001010mg             235   1e-67   
ref|XP_010104545.1|  Receptor-like protein kinase HAIKU2                234   3e-67   Morus notabilis
ref|XP_009148316.1|  PREDICTED: receptor-like protein kinase HAIKU2     234   3e-67   Brassica rapa
ref|NP_850942.1|  leucine-rich receptor-like protein kinase             234   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219159.1|  PREDICTED: receptor-like protein kinase HAIKU2     234   4e-67   Prunus mume [ume]
ref|XP_008378672.1|  PREDICTED: receptor-like protein kinase HAIKU2     233   9e-67   
ref|XP_010268649.1|  PREDICTED: receptor-like protein kinase HAIKU2     232   2e-66   Nelumbo nucifera [Indian lotus]
gb|KHG10020.1|  Receptor-like protein kinase HAIKU2                     229   4e-66   Gossypium arboreum [tree cotton]
emb|CDY22611.1|  BnaC08g42450D                                          230   6e-66   Brassica napus [oilseed rape]
gb|KJB64050.1|  hypothetical protein B456_010G030600                    230   8e-66   Gossypium raimondii
emb|CDY53829.1|  BnaA09g57210D                                          229   1e-65   Brassica napus [oilseed rape]
ref|XP_008466102.1|  PREDICTED: receptor-like protein kinase HAIKU2     229   1e-65   Cucumis melo [Oriental melon]
ref|NP_172468.3|  leucine-rich receptor-like protein kinase             229   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118284.1|  PREDICTED: receptor-like protein kinase HAIKU2     229   1e-65   Brassica rapa
gb|AAL12626.1|  leucine-rich repeat receptor-like kinase F21M12.36      229   1e-65   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36421.1|  hypothetical protein MIMGU_mgv1a000813mg                228   4e-65   Erythranthe guttata [common monkey flower]
ref|XP_003522732.1|  PREDICTED: receptor-like protein kinase HAIK...    228   7e-65   Glycine max [soybeans]
gb|KHN08204.1|  Receptor-like protein kinase HAIKU2-like protein        226   1e-64   Glycine soja [wild soybean]
ref|XP_003526519.1|  PREDICTED: receptor-like protein kinase HAIK...    226   2e-64   Glycine max [soybeans]
gb|KEH36109.1|  LRR receptor-like kinase                                226   2e-64   Medicago truncatula
emb|CDY20667.1|  BnaC08g13910D                                          226   2e-64   Brassica napus [oilseed rape]
ref|XP_011074301.1|  PREDICTED: receptor-like protein kinase HAIKU2     225   5e-64   Sesamum indicum [beniseed]
ref|XP_004501071.1|  PREDICTED: receptor-like protein kinase HAIK...    225   6e-64   Cicer arietinum [garbanzo]
ref|XP_004299841.2|  PREDICTED: receptor-like protein kinase HAIKU2     225   6e-64   Fragaria vesca subsp. vesca
ref|XP_009144482.1|  PREDICTED: receptor-like protein kinase HAIKU2     224   1e-63   Brassica rapa
emb|CDY31055.1|  BnaA08g26050D                                          224   1e-63   Brassica napus [oilseed rape]
ref|XP_010544042.1|  PREDICTED: receptor-like protein kinase HAIKU2     223   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_009335487.1|  PREDICTED: receptor-like protein kinase HAIKU2     222   5e-63   
ref|XP_007137286.1|  hypothetical protein PHAVU_009G114500g             221   9e-63   Phaseolus vulgaris [French bean]
ref|XP_009779240.1|  PREDICTED: receptor-like protein kinase HAIKU2     221   1e-62   Nicotiana sylvestris
ref|XP_009616818.1|  PREDICTED: receptor-like protein kinase HAIKU2     218   1e-61   Nicotiana tomentosiformis
gb|KJB16079.1|  hypothetical protein B456_002G211900                    217   3e-61   Gossypium raimondii
ref|XP_010061583.1|  PREDICTED: receptor-like protein kinase HAIKU2     217   3e-61   Eucalyptus grandis [rose gum]
gb|KJB16078.1|  hypothetical protein B456_002G211900                    217   3e-61   Gossypium raimondii
ref|XP_002271143.2|  PREDICTED: receptor-like protein kinase HAIKU2     216   8e-61   Vitis vinifera
emb|CAN65551.1|  hypothetical protein VITISV_033329                     215   6e-60   Vitis vinifera
ref|XP_003593346.1|  Receptor-like protein kinase HAIKU2                213   8e-60   Medicago truncatula
ref|XP_007041450.1|  Leucine-rich receptor-like protein kinase fa...    213   1e-59   
ref|XP_010271554.1|  PREDICTED: receptor-like protein kinase HAIKU2     213   1e-59   Nelumbo nucifera [Indian lotus]
gb|KHG18049.1|  Receptor-like protein kinase HAIKU2                     196   2e-59   Gossypium arboreum [tree cotton]
ref|XP_004230660.1|  PREDICTED: receptor-like protein kinase HAIKU2     211   5e-59   Solanum lycopersicum
ref|XP_006367082.1|  PREDICTED: receptor-like protein kinase HAIK...    210   1e-58   Solanum tuberosum [potatoes]
ref|XP_002313944.2|  hypothetical protein POPTR_0009s08540g             209   2e-58   
ref|XP_008236214.1|  PREDICTED: receptor-like protein kinase HAIKU2     208   4e-58   Prunus mume [ume]
gb|KDP35915.1|  hypothetical protein JCGZ_09887                         209   6e-58   Jatropha curcas
ref|XP_010065822.1|  PREDICTED: receptor-like protein kinase HAIKU2     208   6e-58   Eucalyptus grandis [rose gum]
gb|KCW63493.1|  hypothetical protein EUGRSUZ_G01123                     208   8e-58   Eucalyptus grandis [rose gum]
ref|XP_011002775.1|  PREDICTED: receptor-like protein kinase HAIKU2     207   2e-57   Populus euphratica
ref|XP_004292067.1|  PREDICTED: receptor-like protein kinase HAIKU2     207   2e-57   Fragaria vesca subsp. vesca
ref|XP_002889783.1|  hypothetical protein ARALYDRAFT_888256             205   2e-57   
ref|XP_004485648.1|  PREDICTED: receptor-like protein kinase HAIK...    206   5e-57   Cicer arietinum [garbanzo]
gb|EPS73238.1|  hypothetical protein M569_01518                         205   6e-57   Genlisea aurea
ref|XP_007199705.1|  hypothetical protein PRUPE_ppa000895mg             203   3e-56   Prunus persica
gb|KDO67927.1|  hypothetical protein CISIN_1g002250mg                   202   4e-56   Citrus sinensis [apfelsine]
ref|XP_009420699.1|  PREDICTED: receptor-like protein kinase HAIKU2     203   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006486805.1|  PREDICTED: receptor-like protein kinase HAIK...    203   5e-56   Citrus sinensis [apfelsine]
ref|XP_006422685.1|  hypothetical protein CICLE_v10027748mg             203   5e-56   Citrus clementina [clementine]
ref|XP_007148314.1|  hypothetical protein PHAVU_006G198200g             202   1e-55   Phaseolus vulgaris [French bean]
ref|XP_008787835.1|  PREDICTED: uncharacterized protein LOC103705762    204   1e-55   
ref|XP_009346454.1|  PREDICTED: receptor-like protein kinase HAIKU2     199   1e-54   
gb|KJB77870.1|  hypothetical protein B456_012G162000                    198   2e-54   Gossypium raimondii
ref|XP_007199391.1|  hypothetical protein PRUPE_ppa025898mg             196   2e-54   
ref|XP_008382378.1|  PREDICTED: receptor-like protein kinase HAIKU2     198   2e-54   Malus domestica [apple tree]
ref|XP_009378558.1|  PREDICTED: receptor-like protein kinase HAIKU2     198   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_008372891.1|  PREDICTED: receptor-like protein kinase HAIKU2     197   4e-54   
ref|XP_010107637.1|  Receptor-like protein kinase HAIKU2                197   7e-54   Morus notabilis
emb|CDO97335.1|  unnamed protein product                                197   8e-54   Coffea canephora [robusta coffee]
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2     195   3e-53   Elaeis guineensis
ref|XP_009407104.1|  PREDICTED: uncharacterized protein LOC103989885    197   3e-53   
ref|XP_004170874.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    194   8e-53   
ref|XP_009416779.1|  PREDICTED: receptor-like protein kinase HAIKU2     194   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN43819.1|  hypothetical protein Csa_7G069690                       192   3e-52   Cucumis sativus [cucumbers]
ref|XP_003541774.1|  PREDICTED: receptor-like protein kinase HAIK...    192   4e-52   Glycine max [soybeans]
ref|XP_006852741.1|  hypothetical protein AMTR_s00033p00104210          191   1e-51   
ref|XP_002522038.1|  Receptor protein kinase CLAVATA1 precursor, ...    190   2e-51   Ricinus communis
ref|XP_008455077.1|  PREDICTED: receptor-like protein kinase HAIKU2     190   3e-51   Cucumis melo [Oriental melon]
ref|XP_010668040.1|  PREDICTED: receptor-like protein kinase HAIKU2     184   2e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009631895.1|  PREDICTED: receptor-like protein kinase HSL1       180   5e-48   Nicotiana tomentosiformis
ref|XP_009764826.1|  PREDICTED: receptor-like protein kinase HSL1       179   1e-47   Nicotiana sylvestris
ref|XP_007227013.1|  hypothetical protein PRUPE_ppa001184mg             179   1e-47   
gb|ACI42311.1|  putative leucine rich repeat transmembrane protei...    179   2e-47   Corchorus olitorius [Nalta jute]
ref|XP_008219158.1|  PREDICTED: receptor-like protein kinase HSL1       179   2e-47   Prunus mume [ume]
ref|XP_007018366.1|  Leucine-rich repeat transmembrane protein ki...    178   3e-47   
gb|KDP41543.1|  hypothetical protein JCGZ_15950                         174   3e-47   Jatropha curcas
gb|AAB60752.1|  Similar to A. thaliana receptor-like protein kina...    178   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238044.1|  PREDICTED: receptor-like protein kinase HSL1       177   5e-47   Solanum lycopersicum
ref|XP_002526416.1|  serine-threonine protein kinase, plant-type,...    166   5e-47   
ref|XP_006356797.1|  PREDICTED: receptor-like protein kinase HSL1...    177   5e-47   Solanum tuberosum [potatoes]
ref|XP_009786287.1|  PREDICTED: receptor-like protein kinase HSL1       177   6e-47   Nicotiana sylvestris
ref|XP_009599063.1|  PREDICTED: receptor-like protein kinase HSL1       177   8e-47   Nicotiana tomentosiformis
ref|XP_006442751.1|  hypothetical protein CICLE_v10018723mg             177   8e-47   Citrus clementina [clementine]
emb|CDP00973.1|  unnamed protein product                                177   9e-47   Coffea canephora [robusta coffee]
ref|NP_188604.1|  leucine rich repeat kinase HAIKU 2                    177   9e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KHG16379.1|  Receptor-like protein kinase HSL1                       172   9e-47   Gossypium arboreum [tree cotton]
gb|AEP84281.1|  leucine rich repeat-containing protein                  177   1e-46   Corchorus capsularis [jute]
gb|KDO42901.1|  hypothetical protein CISIN_1g003199mg                   175   2e-46   Citrus sinensis [apfelsine]
ref|XP_004299842.1|  PREDICTED: receptor-like protein kinase HSL1       176   2e-46   Fragaria vesca subsp. vesca
gb|KJB59873.1|  hypothetical protein B456_009G278200                    176   2e-46   Gossypium raimondii
ref|XP_006487758.1|  PREDICTED: receptor-like protein kinase HSL1...    175   4e-46   Citrus sinensis [apfelsine]
ref|XP_002883200.1|  hypothetical protein ARALYDRAFT_479487             175   5e-46   
ref|XP_011074306.1|  PREDICTED: receptor-like protein kinase HSL1       175   5e-46   Sesamum indicum [beniseed]
ref|XP_010247922.1|  PREDICTED: receptor-like protein kinase HSL1       175   6e-46   Nelumbo nucifera [Indian lotus]
ref|XP_004136411.1|  PREDICTED: receptor-like protein kinase HSL1...    174   8e-46   Cucumis sativus [cucumbers]
ref|XP_008466101.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    174   9e-46   
gb|EYU36418.1|  hypothetical protein MIMGU_mgv1a000952mg                174   9e-46   Erythranthe guttata [common monkey flower]
ref|XP_006441549.1|  hypothetical protein CICLE_v10018710mg             174   9e-46   Citrus clementina [clementine]
ref|XP_010061584.1|  PREDICTED: receptor-like protein kinase HSL1       174   9e-46   Eucalyptus grandis [rose gum]
gb|KJB29386.1|  hypothetical protein B456_005G097700                    174   1e-45   Gossypium raimondii
gb|KDO45819.1|  hypothetical protein CISIN_1g002063mg                   172   4e-45   Citrus sinensis [apfelsine]
gb|AEX11047.1|  hypothetical protein 0_1169_01                          159   4e-45   Pinus taeda
ref|XP_006478192.1|  PREDICTED: receptor-like protein kinase HAIK...    172   4e-45   Citrus sinensis [apfelsine]
ref|XP_007020166.1|  Leucine-rich receptor-like protein kinase fa...    172   5e-45   
ref|XP_002510008.1|  receptor protein kinase, putative                  171   7e-45   Ricinus communis
gb|KJB58763.1|  hypothetical protein B456_009G225100                    171   8e-45   Gossypium raimondii
ref|XP_010667798.1|  PREDICTED: receptor-like protein kinase HSL1       171   9e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006300009.1|  hypothetical protein CARUB_v10016232mg             171   9e-45   Capsella rubella
ref|XP_009335485.1|  PREDICTED: receptor-like protein kinase HSL1       171   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_009357235.1|  PREDICTED: receptor-like protein kinase HSL1       171   1e-44   Pyrus x bretschneideri [bai li]
ref|XP_004148401.1|  PREDICTED: receptor-like protein kinase HSL1...    170   2e-44   Cucumis sativus [cucumbers]
gb|KJB60054.1|  hypothetical protein B456_009G287800                    170   3e-44   Gossypium raimondii
ref|XP_008444976.1|  PREDICTED: receptor-like protein kinase HSL1       169   4e-44   Cucumis melo [Oriental melon]
emb|CDY42201.1|  BnaA01g25940D                                          168   8e-44   Brassica napus [oilseed rape]
gb|KFK39298.1|  hypothetical protein AALP_AA3G226400                    169   9e-44   Arabis alpina [alpine rockcress]
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              169   1e-43   Selaginella moellendorffii
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              169   1e-43   Selaginella moellendorffii
ref|XP_003634589.1|  PREDICTED: receptor-like protein kinase HAIKU2     168   1e-43   Vitis vinifera
ref|XP_010103492.1|  Receptor-like protein kinase HSL1                  168   1e-43   Morus notabilis
ref|XP_010062414.1|  PREDICTED: receptor-like protein kinase HAIKU2     168   1e-43   Eucalyptus grandis [rose gum]
gb|KDP31632.1|  hypothetical protein JCGZ_14857                         168   2e-43   Jatropha curcas
ref|XP_010943249.1|  PREDICTED: receptor-like protein kinase HSL1...    167   2e-43   Elaeis guineensis
ref|XP_002521777.1|  Receptor protein kinase CLAVATA1 precursor, ...    167   2e-43   
ref|XP_009111593.1|  PREDICTED: receptor-like protein kinase HAIKU2     167   2e-43   Brassica rapa
gb|KHN37211.1|  Receptor-like protein kinase HSL1-like protein          167   2e-43   Glycine soja [wild soybean]
ref|XP_010943241.1|  PREDICTED: receptor-like protein kinase HSL1...    167   2e-43   
ref|XP_010268650.1|  PREDICTED: receptor-like protein kinase HSL1       167   2e-43   Nelumbo nucifera [Indian lotus]
gb|EPS67674.1|  hypothetical protein M569_07098                         167   3e-43   Genlisea aurea
ref|XP_008352752.1|  PREDICTED: receptor-like protein kinase HSL1       167   3e-43   
ref|XP_003526517.1|  PREDICTED: receptor-like protein kinase HSL1...    166   4e-43   Glycine max [soybeans]
ref|XP_006406469.1|  hypothetical protein EUTSA_v10022054mg             166   5e-43   Eutrema salsugineum [saltwater cress]
gb|ABF73316.1|  clavata-like receptor                                   166   5e-43   Picea glauca
ref|XP_009362411.1|  PREDICTED: receptor-like protein kinase HSL1       166   6e-43   Pyrus x bretschneideri [bai li]
ref|XP_007137285.1|  hypothetical protein PHAVU_009G114400g             166   9e-43   Phaseolus vulgaris [French bean]
gb|KHN08203.1|  Receptor-like protein kinase HSL1-like protein          165   9e-43   Glycine soja [wild soybean]
ref|XP_008787759.1|  PREDICTED: receptor-like protein kinase HSL1       166   9e-43   
ref|XP_011096686.1|  PREDICTED: receptor-like protein kinase HAIKU2     166   9e-43   Sesamum indicum [beniseed]
ref|XP_004501072.1|  PREDICTED: receptor-like protein kinase HSL1...    165   1e-42   Cicer arietinum [garbanzo]
ref|XP_006852742.1|  hypothetical protein AMTR_s00033p00105380          165   1e-42   
ref|XP_003523762.1|  PREDICTED: receptor-like protein kinase HSL1...    165   2e-42   Glycine max [soybeans]
ref|XP_008339164.1|  PREDICTED: receptor-like protein kinase HAIKU2     165   2e-42   
ref|XP_008361619.1|  PREDICTED: receptor-like protein kinase HAIKU2     165   2e-42   
ref|XP_006664773.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    164   2e-42   
ref|XP_010489950.1|  PREDICTED: receptor-like protein kinase HAIKU2     164   2e-42   Camelina sativa [gold-of-pleasure]
emb|CDX95422.1|  BnaC01g33140D                                          164   3e-42   
ref|XP_008378674.1|  PREDICTED: receptor-like protein kinase HSL1       164   3e-42   
gb|KFK40815.1|  hypothetical protein AALP_AA2G044900                    164   3e-42   Arabis alpina [alpine rockcress]
gb|EAY84008.1|  hypothetical protein OsI_39239                          164   4e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001067347.2|  Os12g0632800                                       164   4e-42   
ref|XP_002442601.1|  hypothetical protein SORBIDRAFT_08g022780          163   6e-42   Sorghum bicolor [broomcorn]
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561             163   6e-42   
ref|XP_007225361.1|  hypothetical protein PRUPE_ppa000880mg             163   6e-42   
gb|EEE52987.1|  hypothetical protein OsJ_35661                          161   8e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008218929.1|  PREDICTED: receptor-like protein kinase HAIKU2     163   9e-42   Prunus mume [ume]
gb|KHG27129.1|  Receptor-like protein kinase HAIKU2                     162   1e-41   Gossypium arboreum [tree cotton]
gb|KEH36108.1|  LRR receptor-like kinase family protein                 162   1e-41   Medicago truncatula
ref|XP_010468302.1|  PREDICTED: receptor-like protein kinase HAIKU2     162   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_006858563.1|  hypothetical protein AMTR_s00071p00174710          162   1e-41   
ref|XP_004309904.1|  PREDICTED: receptor-like protein kinase HSL1       162   1e-41   Fragaria vesca subsp. vesca
ref|XP_008456679.1|  PREDICTED: receptor-like protein kinase HAIKU2     162   1e-41   Cucumis melo [Oriental melon]
ref|NP_199777.1|  receptor like kinase                                  162   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402253.1|  hypothetical protein EUTSA_v10012576mg             162   2e-41   Eutrema salsugineum [saltwater cress]
dbj|BAC42540.1|  putative receptor protein kinase                       162   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420074.1|  PREDICTED: receptor-like protein kinase HAIKU2     162   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010271555.1|  PREDICTED: receptor-like protein kinase HSL1       162   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002301126.1|  hypothetical protein POPTR_0002s11230g             161   2e-41   
ref|XP_009123552.1|  PREDICTED: receptor-like protein kinase HSL1       161   2e-41   Brassica rapa
gb|KJB64049.1|  hypothetical protein B456_010G030500                    161   2e-41   Gossypium raimondii
ref|XP_004159444.1|  PREDICTED: LRR receptor-like serine/threonin...    161   3e-41   
ref|XP_004140933.1|  PREDICTED: LRR receptor-like serine/threonin...    161   3e-41   Cucumis sativus [cucumbers]
ref|XP_002865749.1|  hypothetical protein ARALYDRAFT_495025             161   3e-41   Arabidopsis lyrata subsp. lyrata
gb|EYU22821.1|  hypothetical protein MIMGU_mgv1a000956mg                161   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_008357591.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   4e-41   
ref|XP_008378748.1|  PREDICTED: receptor-like protein kinase HAIKU2     161   4e-41   
gb|EAZ21323.1|  hypothetical protein OsJ_36977                          161   4e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007131311.1|  hypothetical protein PHAVU_011G003200g             160   5e-41   Phaseolus vulgaris [French bean]
emb|CDX71602.1|  BnaC09g26430D                                          160   5e-41   
emb|CDY37769.1|  BnaA10g05520D                                          160   6e-41   Brassica napus [oilseed rape]
ref|XP_009416959.1|  PREDICTED: receptor-like protein kinase HSL1       160   8e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006350342.1|  PREDICTED: receptor-like protein kinase HAIK...    160   8e-41   Solanum tuberosum [potatoes]
ref|NP_001048946.2|  Os03g0145000                                       160   9e-41   
ref|XP_004963298.1|  PREDICTED: receptor-like protein kinase HAIK...    160   9e-41   
ref|XP_010482245.1|  PREDICTED: receptor-like protein kinase HSL1...    159   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010440851.1|  PREDICTED: receptor-like protein kinase HSL1       159   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009628481.1|  PREDICTED: receptor-like protein kinase HAIKU2     159   1e-40   Nicotiana tomentosiformis
ref|XP_010442431.1|  PREDICTED: receptor-like protein kinase HSL1       159   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010482244.1|  PREDICTED: receptor-like protein kinase HSL1...    159   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002465865.1|  hypothetical protein SORBIDRAFT_01g047250          159   1e-40   Sorghum bicolor [broomcorn]
gb|EAY88517.1|  hypothetical protein OsI_09989                          159   2e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009780300.1|  PREDICTED: receptor-like protein kinase HAIKU2     159   2e-40   Nicotiana sylvestris
ref|XP_010556500.1|  PREDICTED: receptor-like protein kinase HSL1       159   3e-40   Tarenaya hassleriana [spider flower]
ref|NP_001241340.1|  receptor-like protein kinase HSL1-like             159   3e-40   Glycine max [soybeans]
ref|XP_006279956.1|  hypothetical protein CARUB_v10025822mg             159   3e-40   
ref|XP_006591868.1|  PREDICTED: receptor-like protein kinase HSL1...    159   3e-40   Glycine max [soybeans]
ref|XP_006279955.1|  hypothetical protein CARUB_v10025822mg             158   3e-40   Capsella rubella
ref|XP_011017021.1|  PREDICTED: receptor-like protein kinase HSL1       158   3e-40   Populus euphratica
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    159   3e-40   
ref|XP_006353616.1|  PREDICTED: receptor-like protein kinase HAIK...    158   3e-40   
ref|XP_010322765.1|  PREDICTED: receptor-like protein kinase HAIKU2     158   4e-40   Solanum lycopersicum
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    158   4e-40   Setaria italica
ref|XP_004250411.1|  PREDICTED: receptor-like protein kinase HAIKU2     158   5e-40   Solanum lycopersicum
ref|XP_009379270.1|  PREDICTED: receptor-like protein kinase HAIKU2     158   5e-40   Pyrus x bretschneideri [bai li]
ref|XP_006837283.1|  hypothetical protein AMTR_s00111p00013770          158   5e-40   Amborella trichopoda
tpg|DAA54762.1|  TPA: putative leucine-rich repeat receptor-like ...    154   7e-40   
ref|XP_002325963.1|  leucine-rich repeat transmembrane protein ki...    157   8e-40   
ref|XP_011031514.1|  PREDICTED: receptor-like protein kinase HAIKU2     157   9e-40   Populus euphratica
ref|XP_003562099.1|  PREDICTED: leucine-rich repeat receptor-like...    157   1e-39   Brachypodium distachyon [annual false brome]
dbj|BAJ89535.1|  predicted protein                                      157   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010674258.1|  PREDICTED: leucine-rich repeat receptor-like...    156   2e-39   
ref|XP_009394880.1|  PREDICTED: leucine-rich repeat receptor-like...    156   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384053.1|  PREDICTED: leucine-rich repeat receptor-like...    156   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006651034.1|  PREDICTED: leucine-rich repeat receptor-like...    156   2e-39   Oryza brachyantha
ref|NP_001067348.1|  Os12g0632900                                       156   2e-39   
emb|CDP03798.1|  unnamed protein product                                155   3e-39   Coffea canephora [robusta coffee]
ref|XP_010062386.1|  PREDICTED: leucine-rich repeat receptor-like...    155   3e-39   Eucalyptus grandis [rose gum]
ref|XP_010936120.1|  PREDICTED: leucine-rich repeat receptor-like...    155   4e-39   Elaeis guineensis
ref|XP_009384188.1|  PREDICTED: leucine-rich repeat receptor-like...    155   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008674123.1|  PREDICTED: receptor-like protein kinase HAIKU2     155   5e-39   Zea mays [maize]
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                     154   7e-39   Eucalyptus grandis [rose gum]
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    154   8e-39   Glycine max [soybeans]
ref|XP_010918931.1|  PREDICTED: leucine-rich repeat receptor-like...    154   8e-39   Elaeis guineensis
gb|KHG27799.1|  Receptor-like protein kinase HSL1                       154   9e-39   Gossypium arboreum [tree cotton]
ref|XP_008450168.1|  PREDICTED: LRR receptor-like serine/threonin...    154   1e-38   Cucumis melo [Oriental melon]
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-38   Eucalyptus grandis [rose gum]
ref|XP_011036356.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-38   Populus euphratica
emb|CDP16506.1|  unnamed protein product                                154   1e-38   Coffea canephora [robusta coffee]
ref|XP_008808464.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-38   Phoenix dactylifera
emb|CBI39285.3|  unnamed protein product                                152   3e-38   Vitis vinifera
gb|KJB59645.1|  hypothetical protein B456_009G265300                    153   3e-38   Gossypium raimondii
ref|XP_002325782.2|  clavata1 receptor kinase family protein            153   3e-38   
ref|XP_010684496.1|  PREDICTED: receptor-like protein kinase HSL1       153   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    153   3e-38   Malus domestica [apple tree]
ref|XP_006664774.1|  PREDICTED: receptor-like protein kinase HSL1...    152   4e-38   
gb|EPS61889.1|  hypothetical protein M569_12898                         152   6e-38   Genlisea aurea
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    152   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_010930577.1|  PREDICTED: receptor-like protein kinase HSL1       151   8e-38   Elaeis guineensis
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    152   8e-38   
ref|XP_004963299.1|  PREDICTED: receptor-like protein kinase HAIK...    151   9e-38   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    152   9e-38   
ref|XP_010258856.1|  PREDICTED: leucine-rich repeat receptor-like...    151   9e-38   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             151   1e-37   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    150   1e-37   
ref|XP_010264363.1|  PREDICTED: leucine-rich repeat receptor-like...    151   2e-37   
ref|XP_004134272.1|  PREDICTED: LRR receptor-like serine/threonin...    150   2e-37   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    151   2e-37   
ref|XP_002975602.1|  hypothetical protein SELMODRAFT_30447              150   2e-37   
ref|XP_002973575.1|  hypothetical protein SELMODRAFT_30446              150   2e-37   
ref|XP_008796449.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
gb|KHN10782.1|  Leucine-rich repeat receptor-like protein kinase ...    150   2e-37   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-37   
ref|XP_010262458.1|  PREDICTED: leucine-rich repeat receptor-like...    150   3e-37   
ref|XP_011083069.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    150   3e-37   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    150   3e-37   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             150   3e-37   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             150   4e-37   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    150   4e-37   
gb|EMT01037.1|  Receptor-like protein kinase HSL1                       149   4e-37   
ref|XP_003520615.1|  PREDICTED: leucine-rich repeat receptor-like...    150   4e-37   
ref|NP_001288525.1|  uncharacterized protein LOC103652818 precursor     149   5e-37   
ref|XP_008786487.1|  PREDICTED: receptor-like protein kinase HSL1       149   5e-37   
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    149   7e-37   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    149   7e-37   
ref|XP_007149806.1|  hypothetical protein PHAVU_005G100400g             149   9e-37   
ref|XP_004237515.1|  PREDICTED: leucine-rich repeat receptor-like...    149   1e-36   
ref|XP_010912643.1|  PREDICTED: receptor-like protein kinase HSL1       148   1e-36   
emb|CDO99488.1|  unnamed protein product                                148   1e-36   
ref|XP_002301848.1|  leucine-rich repeat transmembrane protein ki...    148   1e-36   
emb|CBI30615.3|  unnamed protein product                                146   1e-36   
ref|XP_004247132.1|  PREDICTED: leucine-rich repeat receptor-like...    148   1e-36   
ref|XP_010540915.1|  PREDICTED: leucine-rich repeat receptor-like...    148   1e-36   
ref|XP_002278698.1|  PREDICTED: receptor-like protein kinase HSL1       148   1e-36   
ref|XP_011038464.1|  PREDICTED: leucine-rich repeat receptor-like...    148   1e-36   
gb|KDO60347.1|  hypothetical protein CISIN_1g001752mg                   148   1e-36   
ref|XP_006480075.1|  PREDICTED: leucine-rich repeat receptor-like...    148   1e-36   
ref|XP_002319664.1|  clavata1 receptor kinase family protein            148   2e-36   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    148   2e-36   
ref|XP_009768910.1|  PREDICTED: leucine-rich repeat receptor-like...    148   2e-36   
ref|XP_004506369.1|  PREDICTED: receptor-like protein kinase HAIK...    147   2e-36   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    147   2e-36   
emb|CBI19329.3|  unnamed protein product                                145   2e-36   
gb|KEH30979.1|  LRR receptor-like kinase                                147   2e-36   
ref|XP_001774832.1|  CLL3 clavata1-like receptor S/T protein kina...    147   2e-36   
ref|XP_004485839.1|  PREDICTED: receptor-like protein kinase HSL1...    147   2e-36   
gb|EYU46395.1|  hypothetical protein MIMGU_mgv1a000683mg                147   2e-36   
gb|KDO49231.1|  hypothetical protein CISIN_1g037197mg                   147   2e-36   
ref|XP_006484616.1|  PREDICTED: leucine-rich repeat receptor-like...    147   3e-36   
ref|XP_009343787.1|  PREDICTED: leucine-rich repeat receptor-like...    147   3e-36   
ref|XP_008372397.1|  PREDICTED: leucine-rich repeat receptor-like...    147   3e-36   
ref|XP_007131359.1|  hypothetical protein PHAVU_011G007200g             147   3e-36   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    147   3e-36   
gb|KJB10047.1|  hypothetical protein B456_001G181900                    147   3e-36   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    147   3e-36   
gb|KJB10046.1|  hypothetical protein B456_001G181900                    147   3e-36   
ref|XP_006648220.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
ref|XP_010036153.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
ref|XP_008795324.1|  PREDICTED: receptor-like protein kinase HSL1       147   4e-36   
ref|XP_010258857.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
ref|XP_006355906.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    147   4e-36   
ref|XP_007148116.1|  hypothetical protein PHAVU_006G181800g             147   4e-36   
ref|XP_008218358.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    147   4e-36   
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...    147   4e-36   
ref|XP_003625388.1|  Receptor-like protein kinase                       147   4e-36   
ref|XP_008662594.1|  PREDICTED: receptor-like protein kinase HSL1       147   4e-36   
ref|NP_001067561.1|  Os11g0232100                                       146   5e-36   
gb|EAY80442.1|  hypothetical protein OsI_35624                          146   5e-36   
ref|XP_011080119.1|  PREDICTED: leucine-rich repeat receptor-like...    146   5e-36   
ref|XP_009136481.1|  PREDICTED: leucine-rich repeat receptor-like...    146   5e-36   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    146   5e-36   
gb|KJB57488.1|  hypothetical protein B456_009G166500                    146   6e-36   
ref|XP_007025532.1|  HAESA-like 1 isoform 1                             146   6e-36   
emb|CBI38662.3|  unnamed protein product                                145   6e-36   
emb|CAN77471.1|  hypothetical protein VITISV_029764                     146   6e-36   
gb|KJB69554.1|  hypothetical protein B456_011G030400                    146   7e-36   
ref|XP_002449308.1|  hypothetical protein SORBIDRAFT_05g007490          146   7e-36   
gb|KHG18466.1|  Receptor-like protein kinase HSL1                       146   7e-36   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             146   7e-36   
gb|AES63900.2|  LRR receptor-like kinase family protein                 146   7e-36   
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...    146   8e-36   
ref|XP_002442602.1|  hypothetical protein SORBIDRAFT_08g022790          146   8e-36   
ref|XP_002971926.1|  hypothetical protein SELMODRAFT_96692              146   8e-36   
ref|XP_003553510.2|  PREDICTED: leucine-rich repeat receptor-like...    146   8e-36   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    146   8e-36   
ref|XP_010553768.1|  PREDICTED: leucine-rich repeat receptor-like...    146   8e-36   
ref|XP_009613205.1|  PREDICTED: leucine-rich repeat receptor-like...    145   9e-36   
ref|XP_004235172.1|  PREDICTED: leucine-rich repeat receptor-like...    145   9e-36   
ref|XP_002522003.1|  protein with unknown function                      145   1e-35   
ref|XP_008651021.1|  PREDICTED: leucine-rich repeat receptor-like...    145   1e-35   
gb|KDP41545.1|  hypothetical protein JCGZ_15952                         142   1e-35   
emb|CDP05348.1|  unnamed protein product                                145   1e-35   
gb|EPS70436.1|  hypothetical protein M569_04317                         145   1e-35   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    145   1e-35   
ref|XP_006443728.1|  hypothetical protein CICLE_v10023610mg             146   1e-35   
ref|XP_009393471.1|  PREDICTED: receptor-like protein kinase HAIKU2     145   1e-35   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315             145   1e-35   
gb|KHG03063.1|  Leucine-rich repeat receptor-like protein kinase ...    145   1e-35   
ref|XP_004967337.1|  PREDICTED: receptor-like protein kinase HSL1...    145   1e-35   
ref|XP_004514509.1|  PREDICTED: leucine-rich repeat receptor-like...    145   1e-35   
ref|XP_006377415.1|  hypothetical protein POPTR_0011s05710g             145   1e-35   
ref|XP_009783572.1|  PREDICTED: leucine-rich repeat receptor-like...    145   1e-35   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g             145   2e-35   
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    145   2e-35   
ref|XP_010264856.1|  PREDICTED: leucine-rich repeat receptor-like...    145   2e-35   
ref|XP_002993050.1|  hypothetical protein SELMODRAFT_136413             145   2e-35   
ref|XP_008349015.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    141   2e-35   
gb|EAZ17908.1|  hypothetical protein OsJ_33455                          145   2e-35   
ref|XP_009621771.1|  PREDICTED: leucine-rich repeat receptor-like...    145   2e-35   
ref|XP_009769366.1|  PREDICTED: leucine-rich repeat receptor-like...    145   2e-35   
ref|XP_009375883.1|  PREDICTED: LRR receptor-like serine/threonin...    145   2e-35   
ref|XP_008674126.1|  PREDICTED: receptor-like protein kinase HSL1       145   2e-35   
gb|KDP24078.1|  hypothetical protein JCGZ_25735                         145   2e-35   
gb|KDP22440.1|  hypothetical protein JCGZ_26271                         145   2e-35   
emb|CDP15875.1|  unnamed protein product                                144   2e-35   
ref|XP_008235589.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   
ref|XP_009335228.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   
ref|XP_009611681.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   
ref|XP_008365946.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   
ref|XP_009623756.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-35   
ref|XP_007199694.1|  hypothetical protein PRUPE_ppa000726mg             144   2e-35   
ref|XP_002457041.1|  hypothetical protein SORBIDRAFT_03g000350          144   2e-35   
gb|KEH39191.1|  LRR receptor-like kinase family protein                 144   2e-35   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    144   3e-35   
ref|XP_011027770.1|  PREDICTED: receptor-like protein kinase HSL1       144   3e-35   
gb|KFK29405.1|  hypothetical protein AALP_AA7G129800                    144   3e-35   
ref|XP_002277475.1|  PREDICTED: receptor-like protein kinase HSL1       144   3e-35   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             144   3e-35   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             144   3e-35   
ref|XP_006837993.1|  hypothetical protein AMTR_s00102p00110610          144   3e-35   
ref|XP_002305776.1|  leucine-rich repeat receptor-like protein ki...    144   3e-35   
ref|XP_002453157.1|  hypothetical protein SORBIDRAFT_04g000920          144   3e-35   
ref|XP_011001223.1|  PREDICTED: receptor-like protein kinase HSL1       144   3e-35   
emb|CDY35204.1|  BnaA01g08270D                                          144   3e-35   
ref|XP_009372149.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    144   3e-35   
ref|XP_006340511.1|  PREDICTED: leucine-rich repeat receptor-like...    144   3e-35   
gb|EAZ21469.1|  hypothetical protein OsJ_05076                          144   3e-35   
gb|KHN42599.1|  LRR receptor-like serine/threonine-protein kinase...    141   3e-35   
ref|XP_006446707.1|  hypothetical protein CICLE_v10014127mg             144   3e-35   
dbj|BAJ97282.1|  predicted protein                                      144   4e-35   
dbj|BAJ87631.1|  predicted protein                                      144   4e-35   
ref|XP_006358242.1|  PREDICTED: leucine-rich repeat receptor-like...    144   5e-35   
ref|XP_007208420.1|  hypothetical protein PRUPE_ppa000734mg             144   5e-35   
ref|XP_004166710.1|  PREDICTED: leucine-rich repeat receptor-like...    144   5e-35   
gb|EAZ11200.1|  hypothetical protein OsJ_01050                          144   5e-35   
ref|XP_006412927.1|  hypothetical protein EUTSA_v10024302mg             144   5e-35   
ref|XP_008364044.1|  PREDICTED: leucine-rich repeat receptor-like...    144   5e-35   
ref|XP_004146946.1|  PREDICTED: leucine-rich repeat receptor-like...    144   5e-35   
ref|XP_006417669.1|  hypothetical protein EUTSA_v10006658mg             144   5e-35   
ref|XP_009345889.1|  PREDICTED: LRR receptor-like serine/threonin...    143   5e-35   
ref|NP_001042546.1|  Os01g0239700                                       143   6e-35   
ref|XP_007143951.1|  hypothetical protein PHAVU_007G116300g             143   6e-35   
ref|XP_002269886.3|  PREDICTED: leucine-rich repeat receptor-like...    144   6e-35   
ref|XP_002510009.1|  receptor protein kinase, putative                  143   6e-35   
ref|XP_002889704.1|  CLAVATA1 receptor kinase                           143   6e-35   
gb|EAY73225.1|  hypothetical protein OsI_01100                          143   6e-35   
emb|CBI37195.3|  unnamed protein product                                144   6e-35   
ref|XP_006364308.1|  PREDICTED: receptor-like protein kinase HSL1...    143   6e-35   
ref|XP_007162602.1|  hypothetical protein PHAVU_001G165100g             143   6e-35   
ref|XP_004232923.1|  PREDICTED: receptor-like protein kinase HSL1       143   6e-35   
ref|XP_004234101.1|  PREDICTED: receptor-like protein kinase HSL1...    143   7e-35   
gb|KFK43177.1|  hypothetical protein AALP_AA1G089800                    143   7e-35   
ref|XP_004493833.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
gb|KEH29421.1|  LRR receptor-like kinase family protein                 143   7e-35   
ref|XP_006285784.1|  hypothetical protein CARUB_v10007258mg             143   7e-35   
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
ref|NP_194594.1|  putative leucine-rich repeat transmembrane prot...    143   7e-35   
ref|XP_010438416.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
ref|XP_010447945.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
ref|XP_010433191.1|  PREDICTED: leucine-rich repeat receptor-like...    143   7e-35   
gb|EYU17948.1|  hypothetical protein MIMGU_mgv1a022168mg                143   7e-35   
ref|XP_003541722.1|  PREDICTED: receptor-like protein kinase HSL1...    143   7e-35   
ref|XP_002867439.1|  hypothetical protein ARALYDRAFT_328832             143   8e-35   
ref|XP_008453906.1|  PREDICTED: leucine-rich repeat receptor-like...    143   8e-35   
ref|XP_011100241.1|  PREDICTED: receptor-like protein kinase HSL1       143   8e-35   
ref|XP_002535195.1|  Receptor protein kinase CLAVATA1 precursor, ...    143   8e-35   
ref|XP_010443968.1|  PREDICTED: leucine-rich repeat receptor-like...    143   8e-35   
ref|XP_008645155.1|  PREDICTED: leucine-rich repeat receptor-like...    143   8e-35   
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...    144   8e-35   
ref|XP_008660516.1|  PREDICTED: leucine-rich repeat receptor-like...    143   8e-35   
ref|NP_001045656.1|  Os02g0111800                                       143   8e-35   
gb|EAY84170.1|  hypothetical protein OsI_05549                          143   8e-35   
ref|XP_009804629.1|  PREDICTED: LRR receptor-like serine/threonin...    143   9e-35   
ref|XP_006852745.1|  hypothetical protein AMTR_s00033p00111080          143   9e-35   
dbj|BAJ97909.1|  predicted protein                                      143   9e-35   
ref|XP_003593649.1|  Receptor-like protein kinase HSL1                  143   1e-34   
gb|KDP21014.1|  hypothetical protein JCGZ_21485                         143   1e-34   
gb|KHN08487.1|  Receptor-like protein kinase HSL1                       141   1e-34   
gb|KHN09963.1|  Receptor-like protein kinase HSL1                       142   1e-34   
gb|EYU44538.1|  hypothetical protein MIMGU_mgv1a002096mg                141   1e-34   
ref|XP_006470176.1|  PREDICTED: receptor-like protein kinase 5-like     142   1e-34   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    142   1e-34   
ref|XP_010091806.1|  Leucine-rich repeat receptor-like protein ki...    142   1e-34   
ref|XP_003528467.1|  PREDICTED: receptor-like protein kinase HSL1...    142   1e-34   
gb|KHN15495.1|  Receptor-like protein kinase HSL1                       142   1e-34   
gb|AEP14546.1|  clavata 1-like protein                                  142   1e-34   
emb|CDY02141.1|  BnaA03g40260D                                          142   1e-34   
ref|XP_004302107.1|  PREDICTED: leucine-rich repeat receptor-like...    142   1e-34   
gb|KDP26461.1|  hypothetical protein JCGZ_17619                         142   1e-34   
ref|XP_010489056.1|  PREDICTED: leucine-rich repeat receptor-like...    142   1e-34   
gb|KFK27903.1|  hypothetical protein AALP_AA8G445100                    142   1e-34   
ref|XP_010102197.1|  Leucine-rich repeat receptor-like protein ki...    142   2e-34   
ref|XP_010489073.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_009129466.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|NP_172335.1|  CLV1-like leucine rich repeat transmembrane rec...    142   2e-34   
emb|CDY23065.1|  BnaC07g31220D                                          142   2e-34   
ref|XP_006306655.1|  hypothetical protein CARUB_v10008171mg             142   2e-34   
ref|XP_010458102.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_010475663.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-34   
ref|XP_011096363.1|  PREDICTED: receptor-like protein kinase HSL1       142   2e-34   
ref|XP_009621303.1|  PREDICTED: receptor-like protein kinase HSL1       142   2e-34   
gb|KHN14714.1|  Leucine-rich repeat receptor-like protein kinase ...    142   2e-34   
ref|XP_003566237.1|  PREDICTED: receptor-like protein kinase HSL1       142   2e-34   



>gb|KDP41542.1| hypothetical protein JCGZ_15949 [Jatropha curcas]
Length=974

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q NS+ KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  809  DEFLKPRIADFGLAKIVQANSA-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  867

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGKKPIEAEYGEN DIV WVS+ LKS+ES+ S+VDS I + FKEDA+KVLRIAILC
Sbjct  868  MELVSGKKPIEAEYGENKDIVDWVSSNLKSRESVFSIVDSRIPQVFKEDAVKVLRIAILC  927

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T+ +P+ RPTMR VVQMLE AEPCKLV I++SKD A 
Sbjct  928  TSRVPSLRPTMRSVVQMLEQAEPCKLVGIVISKDGAN  964



>ref|XP_009769216.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=982

 Score =   255 bits (652),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKI Q +S+ KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DELFKPRIADFGLAKIAQADSN-KDSTHVIAGTHGYIAPEYGYTHKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL+SGK+PIE EYGEN++IV+WVS+KLKSKES+LS+VDS+I E FKEDAIKVLRIAI+C
Sbjct  874  MELISGKRPIEPEYGENSNIVTWVSSKLKSKESVLSIVDSSIPEAFKEDAIKVLRIAIVC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            T  LP+ RPTMR VV+MLEDAEPCKLV IIVSKD
Sbjct  934  TDRLPSLRPTMRNVVKMLEDAEPCKLVGIIVSKD  967



>gb|KDO81346.1| hypothetical protein CISIN_1g047677mg, partial [Citrus sinensis]
Length=200

 Score =   237 bits (605),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  30   DEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAPEYGYTSKVDEKSDVYSFGVVL  88

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIE EYGEN DIV WV +   SK+S+L++VDS+I E FKE+A+++LRIA+LC
Sbjct  89   MELVTGKKPIEPEYGENKDIVRWVCSHFNSKQSVLTLVDSSIPETFKENAVEILRIAVLC  148

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            T   P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  149  TTTQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  184



>ref|XP_006356791.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=984

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLA+I Q +S+ KDTTHVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  817  DEFCKPRIADFGLARIAQADST-KDTTHVIAGTHGYIAPEYGYTHKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL+SGK+PIE+EYGEN +IV+WVS+KLKSKES+LS+VDS+I E FKEDAIKVLRIAI+C
Sbjct  876  MELISGKRPIESEYGENGNIVTWVSSKLKSKESVLSIVDSSILEAFKEDAIKVLRIAIVC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKL  262
            T+ LP  RPTMR VV+MLE AEPC+LV IIVSKD   +
Sbjct  936  TSRLPTLRPTMRNVVKMLEKAEPCRLVGIIVSKDDGSI  973



>ref|XP_004238042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=984

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI Q +S+ KDTTHVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  817  DEFCKPRIADFGLAKIAQADST-KDTTHVIAGTHGYIAPEYGYTHKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL+SGK+PIE+EYGEN +IV+WVS+KLKSKES+LS+VDS+I E FKEDAI+VLRIAI+C
Sbjct  876  MELISGKRPIESEYGENGNIVTWVSSKLKSKESVLSIVDSSIPEAFKEDAIEVLRIAIVC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            T+ LP  RPTMR VV+MLE+AEPC+LV +IVSKD
Sbjct  936  TSRLPTLRPTMRNVVKMLENAEPCRLVGMIVSKD  969



>ref|XP_009591322.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=982

 Score =   247 bits (631),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KPRIADFGLAKI Q +S+ KD+THV+ GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DELLKPRIADFGLAKIAQADST-KDSTHVVAGTHGYIAPEYGYTHKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL+SGK+PIE EYGEN +IV+WVS+KLKSKES+LS+VDS+I E FKEDAIKVLRIAI+C
Sbjct  874  MELISGKRPIEPEYGENRNIVTWVSSKLKSKESVLSIVDSSIPESFKEDAIKVLRIAIVC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            T  LP+ RPTMR VV+MLEDAEP KLV IIVSKD
Sbjct  934  TDKLPSLRPTMRNVVKMLEDAEPFKLVGIIVSKD  967



>dbj|BAD94141.1| leucine-rich repeat receptor-like kinase At1g09970 [Arabidopsis 
thaliana]
Length=322

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  160  DEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  219

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+C
Sbjct  220  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAIIC  279

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  280  TARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  314



>gb|KCW66704.1| hypothetical protein EUGRSUZ_F00467 [Eucalyptus grandis]
Length=985

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q NSS  D+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  816  DEFLKPRIADFGLAKIVQANSS-NDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV GK+PIE EYGEN DIV+WVS+KLK+++ +  +VDS I EPFKE+AI VLRIAILC
Sbjct  875  MELVIGKRPIEPEYGENRDIVNWVSSKLKTRQDVFGIVDSRIPEPFKEEAINVLRIAILC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  LPN RP+MR VVQMLEDAEPC LV ++V KD 
Sbjct  935  TTKLPNLRPSMRSVVQMLEDAEPCNLVRVVVEKDG  969



>ref|XP_010060141.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=1050

 Score =   246 bits (628),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DEF KPRIADFGLAKI+Q NSS  D+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  881   DEFLKPRIADFGLAKIVQANSS-NDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  939

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV GK+PIE EYGEN DIV+WVS+KLK+++ +  +VDS I EPFKE+AI VLRIAILC
Sbjct  940   MELVIGKRPIEPEYGENRDIVNWVSSKLKTRQDVFGIVDSRIPEPFKEEAINVLRIAILC  999

Query  375   TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
             T  LPN RP+MR VVQMLEDAEPC LV ++V KD 
Sbjct  1000  TTKLPNLRPSMRSVVQMLEDAEPCNLVRVVVEKDG  1034



>gb|KHG17335.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=983

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 134/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  814  DEFLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE E+G+N DIVSWVS+KLK+KES+LS+VD  I   FKEDA+KVL+IAILC
Sbjct  873  MELVSGKRPIEPEFGDNKDIVSWVSSKLKNKESVLSIVDPRIPVAFKEDAVKVLKIAILC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  LP  RPTMR VVQMLE+AEPCKLVSI+++KD 
Sbjct  933  TTQLPALRPTMRSVVQMLEEAEPCKLVSIVINKDG  967



>ref|XP_002283600.3| PREDICTED: uncharacterized protein LOC100257433 [Vitis vinifera]
Length=2026

 Score =   248 bits (633),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  814  DEFLKPRIADFGLAKIVQANGGGKDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE +YGEN DIVSWV + +K++ES+LS+VDS I E  KEDA+KVLRIAILC
Sbjct  874  MELVTGKRPIEPDYGENRDIVSWVCSNIKTRESVLSIVDSRIPEALKEDAVKVLRIAILC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+E+AEPC+LV IIV+KD 
Sbjct  934  TARLPALRPTMRGVVQMIEEAEPCRLVGIIVNKDG  968


 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 112/150 (75%), Gaps = 3/150 (2%)
 Frame = -3

Query  726   FKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLME  550
             ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APEY Y+ K   K DVYSFGVVLME
Sbjct  1861  YQPKVADFGIAKVLQ--ARGKDFTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLME  1918

Query  549   LVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTA  370
             L++GKKP+EAE+GEN +I+ WV+TK+ + E  + ++D  +   F+++ +++LRI + CT+
Sbjct  1919  LITGKKPVEAEFGENKNIIYWVATKVGTMEGAMEVLDKRLSGSFRDEMLQMLRIGLRCTS  1978

Query  369   ALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
             + P  RPTM  V Q+L +A+PC++ S  +S
Sbjct  1979  SSPALRPTMNEVAQLLTEADPCRVDSCKLS  2008



>ref|XP_006386429.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP64226.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=986

 Score =   244 bits (624),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAK++Q N   KD+T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DELFKPRIADFGLAKMIQANGG-KDSTQVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+ IE EYG+NNDIV WVS+KLK+K+++LS+VDS I E FKEDA+ VLRIAILC
Sbjct  874  MELVSGKRAIEPEYGDNNDIVDWVSSKLKTKQNVLSIVDSRIPEAFKEDAVNVLRIAILC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA LP  RP MR VVQMLE AEPCKLVSI +SKD A
Sbjct  934  TARLPAMRPAMRSVVQMLEAAEPCKLVSIAISKDGA  969



>gb|KJB58765.1| hypothetical protein B456_009G225300 [Gossypium raimondii]
Length=983

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N   KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  814  DEFLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE E+G+N DIVSWVS+KLK+KES+L +VD  I   FKEDA+KVL+IAILC
Sbjct  873  MELVSGKRPIEPEFGDNKDIVSWVSSKLKNKESVLRIVDPRIPVAFKEDAVKVLKIAILC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  LP  RPTMR VVQMLE+AEPCKLVSI+++KD 
Sbjct  933  TTQLPALRPTMRSVVQMLEEAEPCKLVSIVINKDG  967



>emb|CDP00968.1| unnamed protein product [Coffea canephora]
Length=1051

 Score =   244 bits (622),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DE  KPRIADFGLAKI+Q N++ KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  885   DEDLKPRIADFGLAKIVQANAT-KDSTHVIAGTHGYIAPEYGYTHKVNEKSDVYSFGVVL  943

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+GK+PIE E+G+N DIVSWVS+KLKSKE++LS+VDSAI + +KE+A+KVL+IAILC
Sbjct  944   MELVTGKRPIEPEFGDNKDIVSWVSSKLKSKETVLSIVDSAILDGYKEEALKVLKIAILC  1003

Query  375   TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
             TA  P  RPTMR VV MLEDAEPCKLV II+SKD
Sbjct  1004  TARQPVQRPTMRTVVHMLEDAEPCKLVGIIISKD  1037



>ref|XP_006417507.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
 dbj|BAJ34167.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35860.1| hypothetical protein EUTSA_v10006696mg [Eutrema salsugineum]
Length=975

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEFFKPRIADFGLAKILQ N+   D+THV+ GT+GYIAPEYGY+ KV EK DVYSFGVVL
Sbjct  813  DEFFKPRIADFGLAKILQANNGGLDSTHVVAGTYGYIAPEYGYSSKVNEKCDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LR+AILC
Sbjct  873  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKILRVAILC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  933  TARLPGQRPTMRSVVQMIEDAEPCRLMGIVISKES  967



>ref|XP_010667749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=979

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N+S +++THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DEFLKPRIADFGLAKIVQANAS-RESTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+GK+PIE E+GE+ DI++WVS+KLK++ES+  ++DS I  P KE+AIK+L+IAILC
Sbjct  874  IELVTGKRPIEPEFGESKDIINWVSSKLKNRESVFDIIDSTIASPLKEEAIKILKIAILC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA LP  RPTMR VVQMLE+AEPC+LVSI+V KD AK
Sbjct  934  TARLPELRPTMRSVVQMLEEAEPCQLVSIVVGKDGAK  970



>ref|XP_002510007.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52194.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=973

 Score =   242 bits (617),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KPRIADFGLAKI       KD+T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  810  DELLKPRIADFGLAKIKA--DGGKDSTQVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  867

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE EYG+N DIV W+S+ LKSKE +LS+VDS I E F+EDA+KVLRIAILC
Sbjct  868  MELVSGKRPIEPEYGDNKDIVDWISSNLKSKERVLSIVDSRIPEVFREDAVKVLRIAILC  927

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA LP  RPTMR VVQMLEDAEPCKLV I++SKD A
Sbjct  928  TARLPTLRPTMRSVVQMLEDAEPCKLVGIVISKDGA  963



>ref|XP_011016947.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=987

 Score =   242 bits (617),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAK++Q  S  KD+T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DELFKPRIADFGLAKMIQA-SGGKDSTQVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+ IE EYG+N DIV WVS+KLK+K+S+LS+VDS I E FKEDA+KVLRIAILC
Sbjct  874  MELVSGKRAIEPEYGDNTDIVDWVSSKLKTKQSVLSIVDSRIPEAFKEDAVKVLRIAILC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA LP  RP MR VVQMLE  EPCKLVSI +SKD A
Sbjct  934  TARLPAMRPAMRSVVQMLEAVEPCKLVSIAISKDGA  969



>ref|XP_007018364.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
 gb|EOY15589.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7 
[Theobroma cacao]
Length=987

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KPRIADFGLAKI+Q N   KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  816  DEVLKPRIADFGLAKIVQANGG-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE EYG+N DIVSWV +KLK+KES+LS VD  I +  KE+A+KVLRIAILC
Sbjct  875  MELVSGKRPIEPEYGDNKDIVSWVCSKLKNKESVLSTVDPRIPDALKEEAVKVLRIAILC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T ALP  RPTMR VVQMLE+AEPCKLV  ++SKD 
Sbjct  935  TTALPALRPTMRNVVQMLEEAEPCKLVGFVISKDG  969



>ref|XP_010490508.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  812  DEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAEYGE+ DIV+WVS  LKSKES++ +VD  + E +KEDAIK+LRIAILC
Sbjct  872  MELVTGKKPIEAEYGESKDIVNWVSNNLKSKESVMEIVDKKLGEMYKEDAIKLLRIAILC  931

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  932  TARLPGQRPTMRSVVQMIEDAEPCRLMGIVISKES  966



>ref|XP_006433710.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
 gb|ESR46950.1| hypothetical protein CICLE_v10000155mg [Citrus clementina]
Length=982

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  812  DEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAPEYGYTSKVDEKSDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIE EYGEN DIV WV +   SKES+L++VDS+I E FKE+A+++LRIA+LC
Sbjct  871  MELVTGKKPIEPEYGENKDIVIWVCSHFNSKESVLTLVDSSIPETFKENAVEILRIAVLC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA  P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  931  TARQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  966



>gb|KFK43299.1| hypothetical protein AALP_AA1G106000 [Arabis alpina]
Length=974

 Score =   239 bits (610),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ N+   D+THV+ GT+GYIAPEYGY+ KV EK DVYSFGVVL
Sbjct  811  DEFLKPRIADFGLAKILQANNGGLDSTHVVAGTYGYIAPEYGYSSKVTEKCDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV WVS  LKSKES++ +VD  I E +K+DAIK+LRIAILC
Sbjct  871  MELVTGKKPIEAEFGESKDIVDWVSNNLKSKESVMEIVDKKIGEMYKDDAIKILRIAILC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  931  TARLPALRPTMRSVVQMIEDAEPCRLMGIVISKES  965



>ref|XP_010458318.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=974

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  812  DEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAEYGE+ DIV+WVS  LKSKES++ +VD  + E +KEDAIK+LRIAILC
Sbjct  872  MELVTGKKPIEAEYGESKDIVNWVSNNLKSKESVMEIVDKKLGEMYKEDAIKLLRIAILC  931

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK +
Sbjct  932  TARLPGQRPTMRSVVQMIEDAEPCRLMGIVISKGS  966



>ref|XP_010475857.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=975

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/155 (72%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  813  DEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAEYGE+ DIV WVS  LKSKES++ +VD  + E +KEDAIK+LRIAILC
Sbjct  873  MELVTGKKPIEAEYGESKDIVDWVSNNLKSKESVMEIVDKKLGEMYKEDAIKLLRIAILC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  933  TARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  967



>ref|XP_006472374.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=982

 Score =   238 bits (607),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 112/156 (72%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLA+I+Q N   KDTTHVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  812  DEFLKPRIADFGLARIVQSNGG-KDTTHVIAGTTGYIAPEYGYTSKVDEKSDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIE EYGEN DIV WV +   SK+S+L++VDS+I E FKE+A+++LRIA+LC
Sbjct  871  MELVTGKKPIEPEYGENKDIVRWVCSHFNSKQSVLTLVDSSIPETFKENAVEILRIAVLC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            T   P  RPTMR VVQMLE+AEPC LV I++SKD A
Sbjct  931  TTTQPALRPTMRSVVQMLEEAEPCNLVGIVISKDGA  966



>ref|XP_002889779.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66038.1| hypothetical protein ARALYDRAFT_888250 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE+ KPRIADFGLAKILQ ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  814  DEYLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LRIAILC
Sbjct  874  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKILRIAILC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  934  TARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  968



>emb|CDY57935.1| BnaA06g38030D, partial [Brassica napus]
Length=623

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+   D++HV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  464  DESFKPRIADFGLAKILQTNNGGLDSSHVVAGTYGYIAPEYGYASKVNEKCDVYSFGVVL  523

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  524  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKMLRVAILC  583

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T   P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  584  TGRQPGVRPTMRSVVQMIEDAEPCRLMGIVISKES  618



>ref|XP_009357239.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=983

 Score =   236 bits (603),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 117/157 (75%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q  +  KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  814  DEFLKPRIADFGLAKIVQATAG-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWVS+ LKS+ESILSMVDS I E +KE+AIKVLRIA+LC
Sbjct  873  MELVTGKRPIEPEFGENKDIVSWVSSMLKSRESILSMVDSFIPELYKEEAIKVLRIAVLC  932

Query  375  TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAA  268
            TA LP  RP+MR VVQMLE+A E  KL+ I++ KD A
Sbjct  933  TARLPELRPSMRSVVQMLEEAHETFKLLKIVIGKDDA  969



>ref|XP_006306692.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
 gb|EOA39590.1| hypothetical protein CARUB_v10008210mg [Capsella rubella]
Length=968

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  806  DEFLKPRIADFGLAKILQASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  865

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LRIAILC
Sbjct  866  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKMLRIAILC  925

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR +VQM+EDAEPC+L+ I++SK++
Sbjct  926  TARLPGLRPTMRSLVQMIEDAEPCRLMGIVISKES  960



>ref|XP_008339015.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q  ++ KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  817  DEFLKPRIADFGLAKIVQA-TAGKDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIEAE+GEN DIVSWVS+ LKS+ESILSMVDS I E +KE+AIKVLRIA+LC
Sbjct  876  MELVTGKRPIEAEFGENKDIVSWVSSMLKSRESILSMVDSYIPEVYKEEAIKVLRIAVLC  935

Query  375  TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAA  268
            TA LP  RP+MR VVQMLE+A E  KL+ I++ KD A
Sbjct  936  TARLPELRPSMRSVVQMLEEAHETFKLLKIVIGKDDA  972



>gb|KHG23504.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=962

 Score =   236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 130/155 (84%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N + KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  795  DEFMKPRIADFGLAKIVQSNGA-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  853

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE E+G+N DIVSWV +K+ +KESILS+VD  I E  KED IKVLR+AILC
Sbjct  854  MELVSGKRPIEPEFGDNKDIVSWVCSKMNNKESILSIVDPRIPEVLKEDVIKVLRVAILC  913

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  LP  RPTMR VV ML++AEPCKLV I++SK+ 
Sbjct  914  TTRLPAVRPTMRTVVHMLKEAEPCKLVGIVISKEG  948



>emb|CDY62731.1| BnaC05g49230D [Brassica napus]
Length=951

 Score =   236 bits (601),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  792  DESFKPRIADFGLAKILQTNNGGLDSTHVVAGTYGYIAPEYGYASKVNEKCDVYSFGVVL  851

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  852  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKMLRVAILC  911

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  912  TARQPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  946



>gb|KJB29385.1| hypothetical protein B456_005G097600 [Gossypium raimondii]
Length=975

 Score =   236 bits (601),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N + KD+THVI GT+GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  808  DEFMKPRIADFGLAKIVQSNGA-KDSTHVIAGTYGYIAPEYGYTYKVNEKSDVYSFGVVL  866

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGK+PIE E+G+N DIVSWV +K+ +KES+LS+VD  I E  KEDAIKVLR+AILC
Sbjct  867  MELVSGKRPIEPEFGDNKDIVSWVCSKINNKESVLSIVDPRIPEVLKEDAIKVLRVAILC  926

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  LP  RPTMR VVQMLE+A+PCKLV I++SK+ 
Sbjct  927  TTRLPAIRPTMRTVVQMLEEAKPCKLVGIVISKEG  961



>ref|XP_004136412.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cucumis 
sativus]
 ref|XP_004165068.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cucumis 
sativus]
 gb|KGN60296.1| Receptor protein kinase CLAVATA1 [Cucumis sativus]
Length=981

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKIL   +S  DT+HVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  815  DEFLKPRIADFGLAKILHTTASSNDTSHVIAGTPGYIAPEYGYTYKVDEKSDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGKK IE EYGEN +IV WVS  LK++ESILS++DS I + +KEDAIKVLRI ILC
Sbjct  875  MELVSGKKAIEGEYGENKEIVQWVSKNLKTRESILSIIDSRIPDAYKEDAIKVLRIGILC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSKM  232
            TA LPN RP MR VVQMLE A+P  L+ II++KD     + +DN  K+
Sbjct  935  TARLPNLRPNMRSVVQMLEGAQPSPLLGIIITKDVG---SNNDNVKKV  979



>ref|XP_010553669.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=977

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKIL+ +++  D+TH+I GT+GYIAPEYGYT +V EK DVYSFGVVL
Sbjct  815  DEKFKPRIADFGLAKILRADNTGLDSTHIIAGTYGYIAPEYGYTSRVNEKCDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GEN DIV WVS  LKSK  +  MVD  I E ++ DA+KVLRI ILC
Sbjct  875  MELVTGKKPIEAEFGENKDIVKWVSDNLKSKGRVTEMVDKRIPETYRADAVKVLRIGILC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            T  +P+SRPTMRRVVQM+E+AEPCKLV I+VSKD
Sbjct  935  TGKIPSSRPTMRRVVQMIEEAEPCKLVGIVVSKD  968



>ref|XP_007227019.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
 gb|EMJ28218.1| hypothetical protein PRUPE_ppa001010mg [Prunus persica]
Length=934

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q  S+ KD+THV+ GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  765  DEFLKPRIADFGLAKIVQA-SAGKDSTHVVAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  823

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWV + LKS+ESILSMVDS + E +KE+AIKVLRIAILC
Sbjct  824  MELVTGKRPIEPEFGENKDIVSWVCSMLKSRESILSMVDSYLPEAYKEEAIKVLRIAILC  883

Query  375  TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAA  268
            TA LP  RP+MR VVQMLE+A E  KL+ I++SKD  
Sbjct  884  TARLPELRPSMRSVVQMLEEAHETFKLMGIVISKDGT  920



>ref|XP_010104545.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
 gb|EXC01146.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
Length=1030

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSC-KDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
             DEF KPRIADFGLAK++Q N++  +++THVI GTHGYIAPEYGYT KV EKSDVYSFGVV
Sbjct  857   DEFLKPRIADFGLAKMVQANNNGGQNSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVV  916

Query  558   LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
             LMELV+GK+PIE E+GEN DIVSWV + LKS+ES+L++VD  I E  K +AIKVLRIA+L
Sbjct  917   LMELVTGKRPIEPEFGENKDIVSWVFSNLKSRESVLNLVDQDIPEALKGEAIKVLRIAVL  976

Query  378   CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             CT  LP  RPTMR VVQMLE+AEPC+LV IIV+KD  
Sbjct  977   CTDRLPEMRPTMRSVVQMLEEAEPCELVEIIVTKDGG  1013



>ref|XP_009148316.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=964

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+   D++HV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  805  DESFKPRIADFGLAKILQTNNGGLDSSHVVAGTYGYIAPEYGYASKVNEKCDVYSFGVVL  864

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  865  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKMLRVAILC  924

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  925  TARQPGVRPTMRSVVQMIEDAEPCRLMGIVISKES  959



>ref|NP_850942.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL32758.1| Unknown protein [Arabidopsis thaliana]
 gb|ACN59227.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE28522.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=976

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAPEYGY  KV EK DVYSFGVVL
Sbjct  814  DEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+C
Sbjct  874  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAIIC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  934  TARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  968



>ref|XP_008219159.1| PREDICTED: receptor-like protein kinase HAIKU2 [Prunus mume]
Length=1017

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DEF KPRIADFGLAKI+Q  S+ KD+THV+ GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  848   DEFLKPRIADFGLAKIVQA-SAGKDSTHVVAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  906

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+GK+PIE E+GEN DIVSWV + LKS+ESILSMVDS + E +KE+AIKVLRIAILC
Sbjct  907   MELVTGKRPIEPEFGENKDIVSWVCSMLKSRESILSMVDSYLPEAYKEEAIKVLRIAILC  966

Query  375   TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAA  268
             TA LP  RP+MR VVQMLE+A E  KL+ I++SKD  
Sbjct  967   TARLPELRPSMRSVVQMLEEAHETFKLMGIVISKDGT  1003



>ref|XP_008378672.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=987

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KP+IADFGLAKI+Q  +  KD+THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  818  DEFLKPKIADFGLAKIVQATAD-KDSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWVS+ L S+ESILSMVDS I E +KE+AIKVLRIAILC
Sbjct  877  MELVTGKRPIEPEFGENKDIVSWVSSMLGSRESILSMVDSYIPEVYKEEAIKVLRIAILC  936

Query  375  TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAAKLD  259
            TA +P  RP+MR VVQMLE+A E  KL+ I++SKD A  D
Sbjct  937  TARVPELRPSMRSVVQMLEEAHETFKLLKIVISKDGAAAD  976



>ref|XP_010268649.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=1004

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+Q N   KD+T VIPGTHGYIAPEY YT KV EK DVYSFGVVL
Sbjct  819  DEFLKPRIADFGLAKIVQANGG-KDSTQVIPGTHGYIAPEYAYTCKVNEKGDVYSFGVVL  877

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE EYGEN DIV W+ +K+ S+ES++ +VDS I +  KEDA+KVLRIA+ C
Sbjct  878  MELVTGKRPIEPEYGENKDIVQWILSKMGSRESVMGVVDSRIPDGLKEDAVKVLRIAVHC  937

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLD  259
            T+ LP  RP+MR VVQMLEDAEPCKL+S+ ++KD   L+
Sbjct  938  TSRLPALRPSMRTVVQMLEDAEPCKLISVAIAKDDPSLN  976



>gb|KHG10020.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=783

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSC-KDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE+ KP+I+DFGLAKI+Q  SS   D+THVI GTHGYIAPEYGYT KV EKSDVYSFGVV
Sbjct  620  DEYLKPKISDFGLAKIVQAKSSIGNDSTHVIAGTHGYIAPEYGYTCKVDEKSDVYSFGVV  679

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            L+ELV+GKKPIE EYGEN DIVSWV + LK KES+LS+VD  I   FKEDA+KVL+IAIL
Sbjct  680  LLELVTGKKPIEQEYGENKDIVSWVGSNLKGKESVLSIVDPNIPHAFKEDAMKVLKIAIL  739

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            CT  LP  RPTMRRVVQML++A P +LV I++ KD+
Sbjct  740  CTTTLPALRPTMRRVVQMLKEAGPYRLVGIVIGKDS  775



>emb|CDY22611.1| BnaC08g42450D [Brassica napus]
Length=943

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAPEYGY+ KV EK DVYSFGVVL
Sbjct  781  DESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAPEYGYSSKVNEKCDVYSFGVVL  840

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  841  MELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKLLRVAILC  900

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  901  TARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  935



>gb|KJB64050.1| hypothetical protein B456_010G030600 [Gossypium raimondii]
Length=985

 Score =   230 bits (587),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSC-KDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE+ KP+I+DFGLAKI+Q NSS   D+THVI GTHGYIAPEYGYT KV EKSDVYSFGVV
Sbjct  822  DEYLKPKISDFGLAKIVQANSSIGNDSTHVIAGTHGYIAPEYGYTCKVDEKSDVYSFGVV  881

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            L+EL++GKKPIE EYGEN DIVSWV + LK KES+LS+VD  I   FKEDA+KVL+IAIL
Sbjct  882  LLELMTGKKPIEPEYGENKDIVSWVGSNLKGKESVLSIVDPKIPHAFKEDAMKVLKIAIL  941

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            CT  LP  RPTMRRVVQML++AEP +L  +++ KD+
Sbjct  942  CTTTLPALRPTMRRVVQMLKEAEPYRLAGLVIGKDS  977



>emb|CDY53829.1| BnaA09g57210D [Brassica napus]
Length=897

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAPEYGY+ KV EK DVYSFGVVL
Sbjct  735  DESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAPEYGYSSKVNEKCDVYSFGVVL  794

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+GKKPIEAE+GE+ DIV WVS KLKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  795  IELVTGKKPIEAEFGESKDIVHWVSNKLKSKESVMEIVDKKIGEMYREDAIKLLRVAILC  854

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  855  TARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  889



>ref|XP_008466102.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=982

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 134/161 (83%), Gaps = 1/161 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKIL   ++  DTTHVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  816  DEFLKPRIADFGLAKILHTTTTSHDTTHVIAGTPGYIAPEYGYTYKVDEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELVSGKK IE EYGEN +IV WVS  LK++ES+LS+VDS I + +KEDAIKVLRIAILC
Sbjct  876  MELVSGKKAIEGEYGENKEIVQWVSKNLKTRESVLSIVDSRIPDAYKEDAIKVLRIAILC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD-AAKLDN  256
            TA LPN RPTMR VVQMLE+A+PC L+ +IV+KD  + +DN
Sbjct  936  TARLPNLRPTMRSVVQMLEEAQPCPLLRVIVTKDVGSNIDN  976



>ref|NP_172468.3| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE28523.1| leucine-rich receptor-like protein kinase [Arabidopsis thaliana]
Length=977

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP-EYGYTQKVKEKSDVYSFGVV  559
            DEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP EYGY  KV EK DVYSFGVV
Sbjct  814  DEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPAEYGYASKVTEKCDVYSFGVV  873

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+
Sbjct  874  LMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAII  933

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  934  CTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  969



>ref|XP_009118284.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=973

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ N+    +THV+ GT+GYIAPEYGY+ KV EK DVYSFGVVL
Sbjct  811  DESFKPRIADFGLAKILQTNNGDLHSTHVVAGTYGYIAPEYGYSSKVNEKCDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+GKKPIEAE+GE+ DIV WVS KLKSKES++ +VD  I E ++EDAIK+LR+AILC
Sbjct  871  IELVTGKKPIEAEFGESKDIVHWVSNKLKSKESVMEIVDKKIGEMYREDAIKLLRVAILC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P  RPTMR VV M+EDAEPC+L+ I++SK++
Sbjct  931  TARQPGLRPTMRSVVHMIEDAEPCRLMGIVISKES  965



>gb|AAL12626.1| leucine-rich repeat receptor-like kinase F21M12.36 [Arabidopsis 
thaliana]
Length=977

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP-EYGYTQKVKEKSDVYSFGVV  559
            DEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP EYGY  KV EK DVYSFGVV
Sbjct  814  DEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPAEYGYASKVTEKCDVYSFGVV  873

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+
Sbjct  874  LMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAII  933

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  934  CTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  969



>gb|EYU36421.1| hypothetical protein MIMGU_mgv1a000813mg [Erythranthe guttata]
Length=977

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KP IADFGLAKI+Q NS+  ++T +I GTHGYIAPEYGYT KV EKSD+YSFGVVL
Sbjct  810  DEHLKPTIADFGLAKIIQANST-TESTQIIAGTHGYIAPEYGYTCKVNEKSDLYSFGVVL  868

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKPIEAE+GEN DIV WV  KLK+KES++S+VD AI E ++E+AIKVL++AILC
Sbjct  869  MELVTGKKPIEAEFGENKDIVDWVCGKLKTKESVISIVDLAIPEFYRENAIKVLKVAILC  928

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA LP  RPTMR VVQMLE+A+P +LVSI+VSKD  
Sbjct  929  TARLPTLRPTMRTVVQMLEEAQPYQLVSIVVSKDGG  964



>ref|XP_003522732.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
Length=983

 Score =   228 bits (580),  Expect = 7e-65, Method: Composition-based stats.
 Identities = 108/157 (69%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAK++Q N     +T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  819  DEFLKPRIADFGLAKLVQANVGKDSSTRVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  878

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWV  K +SKE + S VDS I E + E+  KVLR A+LC
Sbjct  879  MELVTGKRPIEPEFGENKDIVSWVHNKARSKEGLRSAVDSRIPEMYTEETCKVLRTAVLC  938

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T  LP  RPTMR VVQ LEDAEPCKLV I++SKD ++
Sbjct  939  TGTLPALRPTMRAVVQKLEDAEPCKLVGIVISKDGSE  975



>gb|KHN08204.1| Receptor-like protein kinase HAIKU2-like protein [Glycine soja]
Length=822

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAK++Q N     +T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  658  DEFLKPRIADFGLAKLVQANVGKDSSTRVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  717

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWV  K +SKE + S VDS I E + E+  KVLR A+LC
Sbjct  718  MELVTGKRPIEPEFGENKDIVSWVHNKARSKEGLRSAVDSRIPEMYTEETCKVLRTAVLC  777

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T  LP  RPTMR VVQ LEDAEPCKLV I++SKD ++
Sbjct  778  TGTLPALRPTMRAVVQKLEDAEPCKLVGIVISKDGSE  814



>ref|XP_003526519.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN09043.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=983

 Score =   226 bits (577),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAK++Q N     +THVI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  819  DEFLKPRIADFGLAKVIQANVVKDSSTHVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  878

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E E+GEN DIVSWV  K +SKE + S VDS I E + E+A KVLR A+LC
Sbjct  879  MELVTGKRPTEPEFGENKDIVSWVHNKARSKEGLRSAVDSRIPEMYTEEACKVLRTAVLC  938

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            T  LP  RPTMR VVQ LEDAEPCKLV I+++KD
Sbjct  939  TGTLPALRPTMRAVVQKLEDAEPCKLVGIVITKD  972



>gb|KEH36109.1| LRR receptor-like kinase [Medicago truncatula]
Length=986

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 107/156 (69%), Positives = 126/156 (81%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI+  +   KD+TH+I GTHGYIAPEYGYT +V EKSDVYSFGVVL
Sbjct  823  DEFLKPRIADFGLAKIVHADV-VKDSTHIIAGTHGYIAPEYGYTYRVNEKSDVYSFGVVL  881

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E E+GEN DIVSWV  K +SKE  +S+VDS I E +KE+A KVLR A+LC
Sbjct  882  MELVTGKRPSEPEFGENKDIVSWVHGKTRSKEKFMSVVDSRIPEMYKEEACKVLRTAVLC  941

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA +P  RP+MR VVQ LEDA PCKLV I++SKD +
Sbjct  942  TATIPAMRPSMRAVVQKLEDAVPCKLVGIVISKDGS  977



>emb|CDY20667.1| BnaC08g13910D [Brassica napus]
Length=966

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 102/154 (66%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ  +   D+THV+ GT+GY+APEYGY+ KV EK DVYSFGVVL
Sbjct  811  DESFKPRIADFGLAKILQDKNGGLDSTHVVAGTYGYMAPEYGYSSKVNEKCDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+G+KPIEAE+GE+ DI++WVS  L SKES++ +VD  I E ++EDA+K+LR+AILC
Sbjct  871  IELVTGRKPIEAEFGESKDILNWVSNNLNSKESVMEIVDKNIGEMYREDAVKMLRVAILC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            TA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  931  TARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964



>ref|XP_011074301.1| PREDICTED: receptor-like protein kinase HAIKU2 [Sesamum indicum]
Length=980

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 130/156 (83%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KPRIADFGLAKI+Q NS+ K++T +I GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  814  DEDLKPRIADFGLAKIVQANSN-KESTQIIAGTHGYIAPEYAYTNKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIV WV  KLK+KES++S+VDSAI E  +E+AIKVL++AILC
Sbjct  873  MELVTGKRPIEPEFGENKDIVDWVCGKLKTKESVVSLVDSAIPEVHRENAIKVLKVAILC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA L   RPTMR VVQMLE+A+P  L+SI+VSKD  
Sbjct  933  TARLHTLRPTMRTVVQMLEEAQPWHLLSIVVSKDGG  968



>ref|XP_004501071.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=985

 Score =   225 bits (573),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 108/156 (69%), Positives = 124/156 (79%), Gaps = 1/156 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI++ N   KD+TH+I GTHGYIAPEYGYT +V EKSDVYSFGVVL
Sbjct  822  DEFLKPRIADFGLAKIVRANV-VKDSTHIIAGTHGYIAPEYGYTYRVNEKSDVYSFGVVL  880

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E+E+GEN DIVSWV  K  SKE   S VD  I E +KE+A KVLR A+LC
Sbjct  881  MELVTGKRPSESEFGENKDIVSWVHGKAGSKEKFKSAVDLRIPEMYKEEACKVLRTAVLC  940

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            TA LP  RP+MR VVQ LEDA PCKLV I++SKD +
Sbjct  941  TATLPAMRPSMRAVVQKLEDAAPCKLVRIVISKDGS  976



>ref|XP_004299841.2| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=1022

 Score =   225 bits (573),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 2/157 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DEF KPRIADFGLAKI+Q N    D+THV+ GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  855   DEFLKPRIADFGLAKIVQTNG-INDSTHVVAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  913

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+GKKPI+  +G+N DIV+W+   LK +ES+L +VDS I E ++E+AIKVLRIAILC
Sbjct  914   MELVTGKKPIDPSFGDNKDIVNWICDNLKCRESVLGVVDSYIPEAYREEAIKVLRIAILC  973

Query  375   TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAA  268
             TA LP  RP+MR VVQMLE+A EP KL+ I++SKD +
Sbjct  974   TARLPELRPSMRSVVQMLEEAHEPMKLLGIVISKDGS  1010



>ref|XP_009144482.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=966

 Score =   224 bits (571),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ  +   D+T V+ GT+GY+APEYGY+ KV EK DVYSFGVVL
Sbjct  811  DESFKPRIADFGLAKILQDKNGGLDSTLVVAGTYGYMAPEYGYSSKVNEKCDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+G+KPIEAE+GE+ DIV WVS  L SKES++ +VD  I E ++EDA+K+LR+AILC
Sbjct  871  MELVTGRKPIEAEFGESKDIVDWVSNNLNSKESVMEVVDKNIGEMYREDAVKMLRVAILC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            TA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  931  TARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964



>emb|CDY31055.1| BnaA08g26050D [Brassica napus]
Length=966

 Score =   224 bits (571),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 103/154 (67%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKILQ  +   D+T V+ GT+GY+APEYGY+ KV EK DVYSFGVVL
Sbjct  811  DESFKPRIADFGLAKILQDKNGGLDSTLVVAGTYGYMAPEYGYSSKVNEKCDVYSFGVVL  870

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+G+KPIEAE+GE+ DIV WVS  L SKES++ +VD  I E ++EDA+K+LR+AILC
Sbjct  871  MELVTGRKPIEAEFGESKDIVDWVSNNLNSKESVMEVVDKNIGEMYREDAVKMLRVAILC  930

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            TA  P  RPTMR VVQM+EDAEPC+L+ I++SK+
Sbjct  931  TARQPGRRPTMRSVVQMIEDAEPCRLMGIVISKE  964



>ref|XP_010544042.1| PREDICTED: receptor-like protein kinase HAIKU2 [Tarenaya hassleriana]
Length=969

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEFFKPRIADFGLAKILQ  ++  D+TH++ GT+GYIAPE GYT KV EKSDVYSFGVVL
Sbjct  813  DEFFKPRIADFGLAKILQAKNAGLDSTHIVAGTYGYIAPEQGYTWKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            ME+V+GKK IE  E GE  +IV WVS  LK KE +++MVD  I+E  +EDAI++LRI I+
Sbjct  873  MEIVTGKKAIEETESGEKKEIVKWVSENLKGKEEVMAMVDKRIEEIHREDAIRILRIGIM  932

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            CTA +P+SRPTMR+VV+M+EDAEPCKLV I++SKD
Sbjct  933  CTARVPSSRPTMRKVVEMIEDAEPCKLVGILISKD  967



>ref|XP_009335487.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=987

 Score =   222 bits (566),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 134/160 (84%), Gaps = 2/160 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KP+IADFGLAKI+Q +++ KD+THVI GT GYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  818  DEFLKPKIADFGLAKIVQ-DTADKDSTHVIAGTPGYIAPEYGYTYKVNEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIVSWVS+ L S++SILSMVDS I E  KE+ IKVLRIAILC
Sbjct  877  MELVTGKRPIEPEFGENKDIVSWVSSMLGSRDSILSMVDSYIPEVNKEEVIKVLRIAILC  936

Query  375  TAALPNSRPTMRRVVQMLEDA-EPCKLVSIIVSKDAAKLD  259
            TA +P  RP+MR VVQMLE+A E  +L+ I++SKD+A  D
Sbjct  937  TARVPELRPSMRSVVQMLEEAHETFQLLKIVISKDSAAAD  976



>ref|XP_007137286.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
 gb|ESW09280.1| hypothetical protein PHAVU_009G114500g [Phaseolus vulgaris]
Length=981

 Score =   221 bits (564),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 107/157 (68%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAK++Q N      T VI GTHGYIAPEYGYT KV EKSDVYSFGVVL
Sbjct  816  DEFLKPRIADFGLAKVVQANVGKDSYTGVIAGTHGYIAPEYGYTYKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN D+VSWV  K +S E + S VDS I E +KE+A KVLR A+LC
Sbjct  876  MELVTGKRPIETEFGENKDMVSWVHNKARSIEGLSSAVDSRIPEMYKEEACKVLRTAVLC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T  LP  RPTMR VVQ LEDAEP KLV I++SKD ++
Sbjct  936  TGTLPALRPTMRAVVQKLEDAEPFKLVGIVISKDGSE  972



>ref|XP_009779240.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=990

 Score =   221 bits (564),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KP+IADFGLAK+LQ N + KD++ V+ GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  818  DEKMKPKIADFGLAKVLQVNGT-KDSSQVVAGTHGYIAPEYAYTTKVTEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKP++AEYGENNDIV WV +K++SK S++ +VDS+I E FK+DA++VLRIA+ C
Sbjct  877  MELVTGKKPVDAEYGENNDIVQWVCSKIRSKTSMIDLVDSSILEGFKKDAVEVLRIAVHC  936

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            TA  P  RP+MR VV MLE+AEPCKL S++V+
Sbjct  937  TARTPALRPSMRMVVHMLEEAEPCKLTSVVVN  968



>ref|XP_009616818.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=986

 Score =   218 bits (556),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KP+IADFGLAK+LQ N + KD++HV+ GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  818  DEKMKPKIADFGLAKVLQVNGT-KDSSHVVAGTHGYIAPEYAYTTKVTEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            MELV+GKKP++AE YGENNDIV WV +K+++K S++ +VDS+I E FK+DA++VLRIA+ 
Sbjct  877  MELVTGKKPVDAEEYGENNDIVQWVCSKIRNKTSMIDLVDSSILEGFKKDAVEVLRIAVH  936

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            CTA  P  RP+MR VV MLE+AEPCKL S++V+
Sbjct  937  CTARTPALRPSMRMVVHMLEEAEPCKLTSVVVN  969



>gb|KJB16079.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=968

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q N S  D THVI GTHGY+APEY YT K+ EKSDVYSFGVVL
Sbjct  813  DEEWKPRIADFGLAKIVQ-NGSGGDWTHVIAGTHGYMAPEYAYTCKINEKSDVYSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIV W+ TKLK+KE+++  VD  I    KEDAIKVLRIA+ C
Sbjct  872  MELVTGKRPVEPEFGENKDIVYWIYTKLKTKETLVEAVDPKISMASKEDAIKVLRIAVHC  931

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR+VVQMLE+AEPCKL  IIV +   K
Sbjct  932  TAKIPALRPSMRKVVQMLEEAEPCKLTDIIVHEKGEK  968



>ref|XP_010061583.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 gb|KCW68568.1| hypothetical protein EUGRSUZ_F02181 [Eucalyptus grandis]
Length=982

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KP+IADFGLAKILQ     KD+T VI GT GYIAPEYGYT ++ EKSDVYSFGVVL
Sbjct  818  DEFMKPQIADFGLAKILQAGRGGKDSTQVIAGTPGYIAPEYGYTSRISEKSDVYSFGVVL  877

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            MELV+GK+PIE  YGEN DIVSW+S+ LK +ES++ +VDS I Q+  +E AI VLRIA+L
Sbjct  878  MELVTGKRPIEPGYGENMDIVSWISSNLKCRESVMRLVDSRIAQDHTREQAIMVLRIAVL  937

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            CT  LP+ RPTMR VVQMLEDAEPC  V I++ K
Sbjct  938  CTERLPSLRPTMRSVVQMLEDAEPCGPVDIVIEK  971



>gb|KJB16078.1| hypothetical protein B456_002G211900 [Gossypium raimondii]
Length=996

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q N S  D THVI GTHGY+APEY YT K+ EKSDVYSFGVVL
Sbjct  841  DEEWKPRIADFGLAKIVQ-NGSGGDWTHVIAGTHGYMAPEYAYTCKINEKSDVYSFGVVL  899

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIV W+ TKLK+KE+++  VD  I    KEDAIKVLRIA+ C
Sbjct  900  MELVTGKRPVEPEFGENKDIVYWIYTKLKTKETLVEAVDPKISMASKEDAIKVLRIAVHC  959

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR+VVQMLE+AEPCKL  IIV +   K
Sbjct  960  TAKIPALRPSMRKVVQMLEEAEPCKLTDIIVHEKGEK  996



>ref|XP_002271143.2| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=975

 Score =   216 bits (550),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
             KPRIADFGLAK+L + ++  DTTHVI GTHGYIAPEY YT KV EKSDVYSFGVVLMEL
Sbjct  816  LKPRIADFGLAKML-HGAAGGDTTHVIAGTHGYIAPEYAYTCKVTEKSDVYSFGVVLMEL  874

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PIE E+GEN DIV WV   +KS+E  + +VDSAI E FKEDA+KVL+I+I CTA 
Sbjct  875  VTGKRPIEPEFGENKDIVYWVYNNMKSREDAVGLVDSAISEAFKEDAVKVLQISIHCTAK  934

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            +P  RP+MR VVQMLED +PCKL +I+VSK  
Sbjct  935  IPVLRPSMRMVVQMLEDFKPCKLTNIVVSKGG  966



>emb|CAN65551.1| hypothetical protein VITISV_033329 [Vitis vinifera]
Length=1253

 Score =   215 bits (548),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
             KPRIADFGLAK+L + ++  DTTHVI GTHGYIAPEY YT KV EKSDVYSFGVVLMEL
Sbjct  816  LKPRIADFGLAKML-HGAAGGDTTHVIAGTHGYIAPEYAYTCKVTEKSDVYSFGVVLMEL  874

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PIE E+GEN DIV WV   +KS+E  + +VDSAI E FKEDA+KVL+I+I CTA 
Sbjct  875  VTGKRPIEPEFGENKDIVYWVYNNMKSREDAVGLVDSAISEAFKEDAVKVLQISIHCTAK  934

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDN  256
            +P  RP+MR VVQMLED +PCKL +I+VSK      N
Sbjct  935  IPVLRPSMRMVVQMLEDFKPCKLTNIVVSKGGEGRKN  971



>ref|XP_003593346.1| Receptor-like protein kinase HAIKU2 [Medicago truncatula]
 gb|AES63597.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=979

 Score =   213 bits (543),  Expect = 8e-60, Method: Composition-based stats.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q      + THVI GT GY+APEY YT KV EKSDVYSFGVVL
Sbjct  828  DEEWKPRIADFGLAKIVQGGG---NWTHVIAGTLGYMAPEYAYTCKVTEKSDVYSFGVVL  884

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIVSWV + ++SKES L +VDS I + FKEDAIKVLRIA LC
Sbjct  885  MELVTGKRPVEPEFGENKDIVSWVCSNIRSKESALELVDSTIAKHFKEDAIKVLRIATLC  944

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA  P+SRP+MR +VQMLE+AEPC    +IV+ D 
Sbjct  945  TAKAPSSRPSMRTLVQMLEEAEPCAPSKVIVTIDG  979



>ref|XP_007041450.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
 gb|EOX97281.1| Leucine-rich receptor-like protein kinase family protein, XI-23,RLK7, 
putative [Theobroma cacao]
Length=984

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q N    D THVI GT+GYIAPEY YT K+ EKSDVYSFGVVL
Sbjct  816  DEEWKPRIADFGLAKIVQ-NGGGGDWTHVIAGTYGYIAPEYAYTCKINEKSDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E EYGEN DIV W+  K KSKE ++ +VD  I E  KEDAI VLRIA+LC
Sbjct  875  MELVTGKRPAEPEYGENKDIVYWIQNKEKSKEKLVEVVDLNISEALKEDAINVLRIAVLC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPS-DNTSKM  232
            T   P  RP+MR VV+MLE+AEPCKL  IIV K+     N S  N  K+
Sbjct  935  TTKFPALRPSMRAVVKMLEEAEPCKLTDIIVHKNGESSPNGSWKNNGKL  983



>ref|XP_010271554.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nelumbo nucifera]
Length=993

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 124/155 (80%), Gaps = 1/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQ-YNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DEF KPRIADFGLAKI+        D++ VIPGTHGYIAPEY YT KV EKSDVYSFGVV
Sbjct  818  DEFLKPRIADFGLAKIVHASGGGGSDSSQVIPGTHGYIAPEYAYTCKVNEKSDVYSFGVV  877

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMELV+GKKPIEAEYGEN DIV WV +K  S+ES+  +VD  I + F+EDA+KVLRIAI 
Sbjct  878  LMELVTGKKPIEAEYGENKDIVQWVYSKAGSRESMTEVVDERIPQGFREDAVKVLRIAIR  937

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            CTA LP  RP+MR VVQMLEDAEP +LVSI +++D
Sbjct  938  CTARLPVLRPSMRTVVQMLEDAEPRQLVSIAIAED  972



>gb|KHG18049.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=164

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAK++Q N   +D+THVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  14   DEFLKPRIADFGLAKMVQANGG-QDSTHVILGTHGYIAPEYCYTYKVNEKSDVYSFGVVL  72

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV GK+P E E+G++ DIV+WV +K K K S+LS++D  I +  KE A KVL++AI C
Sbjct  73   MELVIGKRPTEPEFGDDEDIVTWVLSKTKDKASVLSIIDPRIADASKEYATKVLKMAIFC  132

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            T  L   RPTMR VVQMLE AEP +LV++ + 
Sbjct  133  TNTLAALRPTMRTVVQMLEAAEPRQLVTVAIG  164



>ref|XP_004230660.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=980

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KP+IADFGLAK+L  N + KD++ V+ GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  817  DEQMKPKIADFGLAKVLHVNGT-KDSSQVVAGTHGYIAPEYAYTTKVTEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKP+EAEYGEN DIV WV +K+++  S++ +VDS+I E FKEDA++VL+IA+ C
Sbjct  876  MELVTGKKPVEAEYGENIDIVQWVCSKIRNNTSMIDLVDSSIFEGFKEDAVEVLKIAVHC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            T+  P  RP+MR VV MLE+AEPCKL  ++V+
Sbjct  936  TSRTPALRPSMRMVVHMLEEAEPCKLTDVVVN  967



>ref|XP_006367082.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=1008

 Score =   210 bits (535),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KP+IADFGLAK+L  N + KD++ V+ GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  845  DEQMKPKIADFGLAKVLHVNGT-KDSSQVVAGTHGYIAPEYAYTTKVTEKSDVYSFGVVL  903

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKP++AE+GEN+DIV WV +K+++  S++ +VDS+I E FKEDA++VL+IA+ C
Sbjct  904  MELVTGKKPVDAEFGENSDIVQWVCSKIRNNTSMIDLVDSSIFEGFKEDAVEVLKIAVHC  963

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            T+  P  RP+MR VV MLE+AEPCKL +++V+
Sbjct  964  TSRTPALRPSMRMVVHMLEEAEPCKLTNVVVN  995



>ref|XP_002313944.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
 gb|EEE87899.2| hypothetical protein POPTR_0009s08540g [Populus trichocarpa]
Length=989

 Score =   209 bits (533),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q      D THVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  817  DEEWKPRIADFGLAKIVQAGGQ-GDWTHVIAGTHGYIAPEYAYTCKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+GEN DIV WV +KL+SKES L +VDS I E FKEDAIK+LRIAI C
Sbjct  876  MELVTGKRPIEPEFGENKDIVYWVCSKLESKESALQVVDSNISEVFKEDAIKMLRIAIHC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIV  283
            T+ +P  RP+MR VV MLE+ EP +L  ++V
Sbjct  936  TSKIPALRPSMRMVVHMLEEVEPLQLTDVVV  966



>ref|XP_008236214.1| PREDICTED: receptor-like protein kinase HAIKU2, partial [Prunus 
mume]
Length=950

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q  + C   THVI GT GYIAPEY YT KV EKSDVYSFGVVL
Sbjct  799  DGDWKPRIADFGLAKIMQVGADC---THVIAGTVGYIAPEYAYTCKVNEKSDVYSFGVVL  855

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+G+N DIVSWV +K++ KES+L +VDS+I +  KEDAIKVL IAI C
Sbjct  856  MELVTGKRPIEPEFGDNKDIVSWVCSKMQYKESVLELVDSSISDDLKEDAIKVLSIAIHC  915

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA +P  RP+MR VVQMLE+AEP KL SI ++K+ 
Sbjct  916  TARVPVLRPSMRMVVQMLEEAEPRKLTSINITKEG  950



>gb|KDP35915.1| hypothetical protein JCGZ_09887 [Jatropha curcas]
Length=1036

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DE +KPRIADFGLAKI+Q      D +H+I GTHGY+APEY YT KV EKSDVYSFGVVL
Sbjct  864   DEEWKPRIADFGLAKIVQAGGG-GDWSHIIAGTHGYMAPEYAYTCKVNEKSDVYSFGVVL  922

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+G++P+E E+GE  DIV WV +K+ SKES L M+DS I E  KEDAIKVLRIAI C
Sbjct  923   MELVTGRRPVEPEFGEYKDIVYWVCSKMSSKESALDMIDSNISENLKEDAIKVLRIAIHC  982

Query  375   TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
             TA +P  RP+MR VVQMLE+AEP KL  I V K  A
Sbjct  983   TAKIPALRPSMRMVVQMLEEAEPHKLTDITVIKKEA  1018



>ref|XP_010065822.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
Length=995

 Score =   208 bits (530),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ +KPRIADFGLAKI+Q  S   + TH I GT GYIAPEY YT KV EKSDVYSFGVVL
Sbjct  825  DKEWKPRIADFGLAKIVQA-SPGGNWTHAIAGTLGYIAPEYAYTMKVNEKSDVYSFGVVL  883

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+G++PIE+E+GEN DIV WV   + SK S+L +VDS I +  KEDA++VLRIAILC
Sbjct  884  MELVTGRRPIESEFGENKDIVYWVRENMSSKNSLLDLVDSNISDTLKEDAVEVLRIAILC  943

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            TA +P  RP+MR VVQMLE+AEPC L +I+V K
Sbjct  944  TANIPTVRPSMRMVVQMLEEAEPCSLNNILVDK  976



>gb|KCW63493.1| hypothetical protein EUGRSUZ_G01123 [Eucalyptus grandis]
Length=1003

 Score =   208 bits (529),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 1/153 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ +KPRIADFGLAKI+Q  S   + TH I GT GYIAPEY YT KV EKSDVYSFGVVL
Sbjct  833  DKEWKPRIADFGLAKIVQA-SPGGNWTHAIAGTLGYIAPEYAYTMKVNEKSDVYSFGVVL  891

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+G++PIE+E+GEN DIV WV   + SK S+L +VDS I +  KEDA++VLRIAILC
Sbjct  892  MELVTGRRPIESEFGENKDIVYWVRENMSSKNSLLDLVDSNISDTLKEDAVEVLRIAILC  951

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            TA +P  RP+MR VVQMLE+AEPC L +I+V K
Sbjct  952  TANIPTVRPSMRMVVQMLEEAEPCSLNNILVDK  984



>ref|XP_011002775.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=988

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q      D THVI GTHGY+APEY YT KV EKSDVYSFGVVL
Sbjct  817  DEEWKPRIADFGLAKIVQAGGQ-GDWTHVIAGTHGYMAPEYAYTCKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E E+GEN DIV WV +KL+SKES L +VDS I E +KEDAIK+LRIAI C
Sbjct  876  MELVTGKRPTEPEFGENKDIVYWVCSKLESKESALQVVDSNISEVYKEDAIKMLRIAIHC  935

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            T+ +P  RP+MR VV MLE+ EP +L  ++V K
Sbjct  936  TSKIPALRPSMRMVVHMLEEVEPLQLTDVVVDK  968



>ref|XP_004292067.1| PREDICTED: receptor-like protein kinase HAIKU2 [Fragaria vesca 
subsp. vesca]
Length=979

 Score =   207 bits (526),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 123/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q   +  + THVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  816  DGDWKPRIADFGLAKIVQ---AGGEMTHVIAGTHGYIAPEYAYTYKVNEKSDVYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIVSWV +K+  K++ L  VDS+I+E  KEDA+ VL IAI C
Sbjct  873  MELVTGKRPVEPEFGENKDIVSWVCSKITCKDTELESVDSSIEEALKEDALNVLSIAIRC  932

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA +P  RP+MR VVQMLE+A+PC+L SI ++K+ 
Sbjct  933  TARVPVLRPSMRMVVQMLEEAQPCQLTSISITKEG  967



>ref|XP_002889783.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66042.1| hypothetical protein ARALYDRAFT_888256 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 9/154 (6%)
 Frame = -3

Query  705  FGLAKILQY---------NSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLM  553
             G AK L+Y         ++   D+THV+ GT+GYIAPEYGY  KV EK DVYSFGVVLM
Sbjct  568  LGAAKGLEYLHHGYERPASNGGPDSTHVVAGTYGYIAPEYGYASKVTEKCDVYSFGVVLM  627

Query  552  ELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCT  373
            ELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDAIK+LRIAILCT
Sbjct  628  ELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAIKILRIAILCT  687

Query  372  AALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            A LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  688  ARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  721



>ref|XP_004485648.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Cicer arietinum]
Length=969

 Score =   206 bits (523),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q      + +H I GT GY+APEY YT KV EKSDVYSFGVVL
Sbjct  817  DEEWKPRIADFGLAKIVQGGGG--NWSHGIAGTLGYMAPEYAYTCKVTEKSDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIV WV + ++SKES   +VDS I + FKEDAIKVLRIA+LC
Sbjct  875  MELVTGKRPVEPEFGENKDIVGWVCSNIRSKESAFELVDSTISKKFKEDAIKVLRIAVLC  934

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T   P+SRP+MR +VQMLE+AEPC    + V+ D 
Sbjct  935  TTKTPSSRPSMRMLVQMLEEAEPCAPTKVTVTIDG  969



>gb|EPS73238.1| hypothetical protein M569_01518, partial [Genlisea aurea]
Length=947

 Score =   205 bits (521),  Expect = 6e-57, Method: Composition-based stats.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 1/154 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D+  +PRIADFGLAKIL+   S  D TT +IPGTHGYIAPEYGYT KV EKSD+YSFGVV
Sbjct  794  DDRMQPRIADFGLAKILRPEYSHGDSTTRIIPGTHGYIAPEYGYTSKVNEKSDIYSFGVV  853

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMELV+G KPI A+ GEN+D+V WV  +LK    ++ +VDS I + F+E AI+V+++A+L
Sbjct  854  LMELVTGLKPIVADSGENSDLVDWVCRRLKMNGDVMGLVDSRIADVFRESAIRVMKVAML  913

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            CTA +P+SRP+MR VVQML+ A+PC+L+S+ V K
Sbjct  914  CTARIPSSRPSMRTVVQMLKAAQPCELLSVFVGK  947



>ref|XP_007199705.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
 gb|EMJ00904.1| hypothetical protein PRUPE_ppa000895mg [Prunus persica]
Length=968

 Score =   203 bits (517),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 122/155 (79%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q  + C   THVI GT GYIAPEY YT KV EKSDVYSFGVVL
Sbjct  817  DGDWKPRIADFGLAKIMQVGADC---THVIAGTVGYIAPEYAYTCKVNEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P E E+G+N DIVSWV +K++ KES+L +VDS+  +  KEDAIKVL IAI C
Sbjct  874  MELVTGKRPTEPEFGDNMDIVSWVCSKMQYKESVLELVDSSTSDYLKEDAIKVLSIAIHC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA +P  RP+MR VVQMLE+AEP KL SI ++K+ 
Sbjct  934  TARVPVLRPSMRMVVQMLEEAEPRKLTSINITKEG  968



>gb|KDO67927.1| hypothetical protein CISIN_1g002250mg [Citrus sinensis]
Length=947

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            +KPRIADFGLAKI+Q      D THVI GTHGYIAPEY YT K+ EKSDVYSFGVVLMEL
Sbjct  784  WKPRIADFGLAKIVQ-TGEAGDLTHVIAGTHGYIAPEYAYTCKINEKSDVYSFGVVLMEL  842

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PI  E+G++ DIV+WV +K+ S++S+L++VD  I E  KEDA+KVLRIAI CT  
Sbjct  843  VTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLTVVDPNISEILKEDALKVLRIAIHCTNK  902

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  903  LPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  932



>ref|XP_009420699.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=995

 Score =   203 bits (516),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 97/154 (63%), Positives = 120/154 (78%), Gaps = 6/154 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCK------DTTHVIPGTHGYIAPEYGYTQKVKEKSDVY  574
            D+ FKPRIADFGLAK+LQ  +S         + HVI GT+GYIAPEY YT KV EKSDVY
Sbjct  823  DQCFKPRIADFGLAKVLQSAASGAGGGKEGSSAHVIAGTYGYIAPEYAYTWKVNEKSDVY  882

Query  573  SFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVL  394
            SFGVVLMELV+G++PIEAEYGEN DIV W S ++ ++ES+++MVD  I E  +E+A+KVL
Sbjct  883  SFGVVLMELVTGRQPIEAEYGENKDIVHWASRRMGNRESVMAMVDLRIPEWAREEAVKVL  942

Query  393  RIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            RIA+LCTA LP +RP+MR VVQMLE+A  C+  S
Sbjct  943  RIAVLCTARLPATRPSMRAVVQMLEEAGRCRAFS  976



>ref|XP_006486805.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=991

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            +KPRIADFGLAKI+Q      D THVI GTHGYIAPEY YT K+ EKSDVYSFGVVLMEL
Sbjct  828  WKPRIADFGLAKIVQ-TGEAGDLTHVIAGTHGYIAPEYAYTCKINEKSDVYSFGVVLMEL  886

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PI  E+G++ DIV+WV +K+ S++S+L++VD  I E  KEDA+KVLRIAI CT  
Sbjct  887  VTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLTVVDPNISEILKEDALKVLRIAIHCTNK  946

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  947  LPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  976



>ref|XP_006422685.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
 gb|ESR35925.1| hypothetical protein CICLE_v10027748mg [Citrus clementina]
Length=991

 Score =   203 bits (516),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            +KPRIADFGLAKI+Q   +  D THVI GTHGYIAPEY YT K+ EKSDVYSFGVVLMEL
Sbjct  828  WKPRIADFGLAKIVQAGEA-GDQTHVIAGTHGYIAPEYAYTCKINEKSDVYSFGVVLMEL  886

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PI  E+G++ DIV+WV +K+ S++S+L++VD  I E  KEDA+KVLRIAI CT  
Sbjct  887  VTGKRPIVPEFGDSKDIVNWVYSKMDSRDSMLTVVDPNISEILKEDALKVLRIAIHCTNK  946

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            LP  RP+MR VVQMLE+AEPC + +I+V K
Sbjct  947  LPAFRPSMRVVVQMLEEAEPCSVTNIVVKK  976



>ref|XP_007148314.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
 gb|ESW20308.1| hypothetical protein PHAVU_006G198200g [Phaseolus vulgaris]
Length=968

 Score =   202 bits (513),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 2/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKIL  N    + T+VI GT GYI PEY YT KV EKSDVYSFGVVL
Sbjct  816  DEEWKPRIADFGLAKIL--NGGAGNWTNVIAGTLGYIPPEYAYTCKVTEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+EAE+GEN+DIV WV +  +SKE  L +VD  I + FKEDA+KVLRIA+LC
Sbjct  874  MELVTGKRPMEAEFGENHDIVHWVCSTNRSKEEALELVDPTIAKHFKEDAMKVLRIALLC  933

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T+ +P SRP+MR +VQMLE+A+PC    + V+ DA
Sbjct  934  TSKIPASRPSMRMLVQMLEEADPCTPNQMTVTIDA  968



>ref|XP_008787835.1| PREDICTED: uncharacterized protein LOC103705762 [Phoenix dactylifera]
Length=2109

 Score =   204 bits (519),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 100/158 (63%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DE FKPRIADFGLAK+L        + HVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  1717  DECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAPEYAYTWKVNEKSDVYSFGVVL  1776

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+G++PIE E+GEN DIV WVS ++ S ES + +VD  I +  +EDA+KVLR+A+LC
Sbjct  1777  MELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVELVDRTIPDWGREDAVKVLRVAVLC  1836

Query  375   TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKL  262
             TA LP  RP+MR VVQMLE+AE   L   I S+DA+ L
Sbjct  1837  TARLPAMRPSMRTVVQMLEEAE---LYCSITSEDASLL  1871


 Score =   201 bits (512),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 97/167 (58%), Positives = 119/167 (71%), Gaps = 0/167 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAK+L        + HVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  691  DECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAPEYAYTWKVNEKSDVYSFGVVL  750

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+G++PIE E+GEN DIV WVS ++ S ES + +VD  I +  +EDA+KVLR+A+LC
Sbjct  751  MELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVELVDRTIPDWGREDAVKVLRVAVLC  810

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSK  235
            TA LP  RP+MR VVQMLE+AE   L   +   +  +   P+   S+
Sbjct  811  TARLPAMRPSMRTVVQMLEEAEARSLRLKVDKVEGGERSRPTSPISR  857


 Score =   201 bits (511),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             DE FKPRIADFGLAK+L        + HVI GTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  1936  DECFKPRIADFGLAKVLYAAGGGDSSAHVIAGTHGYIAPEYAYTWKVNEKSDVYSFGVVL  1995

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
             MELV+G++PIE E+GEN DIV WVS ++ S ES + +VD  I +  +EDA+KVLR+A+LC
Sbjct  1996  MELVTGRRPIEPEFGENKDIVCWVSRRMNSGESAVELVDRTIPDWEREDAVKVLRVAVLC  2055

Query  375   TAALPNSRPTMRRVVQMLEDAE  310
             TA LP  RP+MR VVQMLE+AE
Sbjct  2056  TARLPAMRPSMRTVVQMLEEAE  2077



>ref|XP_009346454.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q    C   T VI GT GYIAPEY YT K+ EKSDVYSFGVVL
Sbjct  820  DGDWKPRIADFGLAKIMQAGVDC---TQVIAGTLGYIAPEYAYTCKINEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKP+EA +GENNDIVSWV +K++  +S+L +VD++I +  KEDAI VL IA+ C
Sbjct  877  MELVTGKKPVEAVFGENNDIVSWVYSKMQCDDSVLELVDTSISDDLKEDAINVLSIAVRC  936

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR VVQMLE+AEP KL  I  +K+  K
Sbjct  937  TAKVPVLRPSMRMVVQMLEEAEPYKLTCISTAKEVEK  973



>gb|KJB77870.1| hypothetical protein B456_012G162000 [Gossypium raimondii]
Length=963

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 115/151 (76%), Gaps = 1/151 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKI+Q N S  D TH I GTHGYIAPEY YT  + EK DVYSFGVVL
Sbjct  813  DEEWKPRIADFGLAKIVQ-NGSGGDWTHFIAGTHGYIAPEYAYTCNINEKCDVYSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN DIV W+ TKL++ E +  +VD  I    KED IKVLRIA+ C
Sbjct  872  MELVTGKRPLEPEFGENKDIVHWIYTKLENNEILDEVVDMNIANALKEDVIKVLRIAVHC  931

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIV  283
            TA +P  RP+MR VVQMLE+A+P KL  IIV
Sbjct  932  TAKIPVLRPSMRMVVQMLEEADPSKLTDIIV  962



>ref|XP_007199391.1| hypothetical protein PRUPE_ppa025898mg, partial [Prunus persica]
 gb|EMJ00590.1| hypothetical protein PRUPE_ppa025898mg, partial [Prunus persica]
Length=688

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  KPRI DFGLAKI++  S+ +++THV+ GTHGYIAPEYGYT +V EKSDVYSFGVVL
Sbjct  542  DELLKPRITDFGLAKIVEA-SAGRESTHVVAGTHGYIAPEYGYTYRVNEKSDVYSFGVVL  600

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GKKP+E E+GE N+IVSW  +   S+ESI SMVDS + E  KE+AIKVLRIA+LC
Sbjct  601  MELVTGKKPMEPEFGETNNIVSWACSMHSSRESIPSMVDSYLPEACKEEAIKVLRIAMLC  660

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKL  298
            T  LP  RP+MR VV+MLE+A    L
Sbjct  661  TDRLPERRPSMRTVVRMLEEAHELGL  686



>ref|XP_008382378.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score =   198 bits (504),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q    C   T VI GT GYIAPEY YT K+ EKSDVYSFGVVL
Sbjct  820  DGDWKPRIADFGLAKIMQAGVDC---TQVIAGTLGYIAPEYAYTCKINEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+EA +GENNDIVSWV +K++  +S+L +VD++I +  KEDAI VL IA+ C
Sbjct  877  MELVTGKEPVEAAFGENNDIVSWVYSKMQCDDSVLELVDTSISDDLKEDAINVLSIAVRC  936

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR VVQMLE+AEP KL  I  +K+  K
Sbjct  937  TAKVPVLRPSMRMVVQMLEEAEPYKLTCISTAKEVEK  973



>ref|XP_009378558.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
 ref|XP_009378566.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=973

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 121/157 (77%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q    C   THVI GT GYIAPEY YT K+ EKSDVYSFGVVL
Sbjct  820  DGDWKPRIADFGLAKIMQAGVDC---THVIAGTLGYIAPEYAYTCKINEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+EAE+GEN DIVSWV +K++  +S L +VD +I +  K+DAI VL IA+ C
Sbjct  877  MELVTGKRPVEAEFGENTDIVSWVCSKMRCVDSELELVDRSISDDLKQDAINVLSIAVRC  936

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR VVQMLE+AEP KL  I ++K+A +
Sbjct  937  TAKVPVLRPSMRMVVQMLEEAEPYKLNCISIAKEADR  973



>ref|XP_008372891.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=973

 Score =   197 bits (502),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+Q    C   THVI GT GYIAPEY YT K+ EKSDVYSFGVVL
Sbjct  820  DGDWKPRIADFGLAKIMQAGVDC---THVIAGTLGYIAPEYAYTCKINEKSDVYSFGVVL  876

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+EAE+GEN DIVSWV +K++  +S L +VD +I +  K+DAI VL IA+ C
Sbjct  877  MELVTGKRPVEAEFGENTDIVSWVCSKMRCVDSELELVDRSISDDLKQDAINVLXIAVRC  936

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            TA +P  RP+MR VVQMLE+AEP KL  I  +K+A K
Sbjct  937  TAKVPVIRPSMRMVVQMLEEAEPYKLNCISXAKEADK  973



>ref|XP_010107637.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
 gb|EXC54479.1| Receptor-like protein kinase HAIKU2 [Morus notabilis]
Length=988

 Score =   197 bits (501),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 4/156 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  +KPRIADFGLAKI+    +  D TH I GT GYIAPEY YT KV EKSDVYSFGVVL
Sbjct  819  DGNWKPRIADFGLAKIVH---AGGDWTHAIAGTLGYIAPEYAYTYKVNEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKES-ILSMVDSAIQEPFKEDAIKVLRIAIL  379
            MELV+GK+P+E E+GEN DIV+WV  K +S+E+ +L +VDS I +  KEDA KVL+IAI 
Sbjct  876  MELVTGKRPVEPEFGENKDIVNWVYNKFRSQENDVLGLVDSNISDAQKEDAFKVLKIAIH  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            CT+ +P  RP+MR VV +LE+AEPCKL  I V K+A
Sbjct  936  CTSQVPGLRPSMRTVVHLLEEAEPCKLTGITVVKEA  971



>emb|CDO97335.1| unnamed protein product [Coffea canephora]
Length=1050

 Score =   197 bits (501),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNS-SCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
             D   KP+IADFGLAKIL  N  + +++THVI GT GYIAPEY Y   V EKSDVYSFGVV
Sbjct  872   DADLKPKIADFGLAKILLANEPNARESTHVIAGTPGYIAPEYAYACSVNEKSDVYSFGVV  931

Query  558   LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
             LMELV+GKKP+E E+G+N DIVSW+ +KL+S+   + +VD +I E  +EDA+KVL+IAI 
Sbjct  932   LMELVTGKKPVEPEFGDNKDIVSWIYSKLRSEHRTIELVDKSISEALREDAVKVLKIAIH  991

Query  378   CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
             CT+  P  RP+M+ VVQMLE+AEPCKL SI+V+
Sbjct  992   CTSRTPVLRPSMKMVVQMLENAEPCKLSSIVVN  1024



>ref|XP_010943231.1| PREDICTED: receptor-like protein kinase HAIKU2 [Elaeis guineensis]
Length=1002

 Score =   195 bits (496),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAK+L        + HVIPGTHGYIAPEY YT KV EKSDVYSFGVVL
Sbjct  830  DECFKPRIADFGLAKVLYPAGGGDSSAHVIPGTHGYIAPEYAYTWKVNEKSDVYSFGVVL  889

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PIE E+G+N DIV WVS ++ S ES++ ++D  I +  +E+A+KVL++A+LC
Sbjct  890  MELVTGKRPIEPEFGDNKDIVYWVSQRMNSGESVVELLDKRIPDWAREEALKVLKVAVLC  949

Query  375  TAALPNSRPTMRRVVQMLEDA  313
            TA LP  RP+MR VVQMLE+A
Sbjct  950  TARLPAMRPSMRTVVQMLEEA  970



>ref|XP_009407104.1| PREDICTED: uncharacterized protein LOC103989885 [Musa acuminata 
subsp. malaccensis]
Length=1974

 Score =   197 bits (501),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 120/157 (76%), Gaps = 4/157 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTT----HVIPGTHGYIAPEYGYTQKVKEKSDVYSF  568
            D+  KPRIADFGLAK+L   ++         HVI GTHGYIAPEY YT KV EKSDVYSF
Sbjct  832  DDCLKPRIADFGLAKVLHSAAAGGAEEASSAHVIAGTHGYIAPEYAYTWKVNEKSDVYSF  891

Query  567  GVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRI  388
            GVVLMELV+G++PIEAEYGE+ DIV W + ++ S+ES+ ++VD  IQEP +E+A+KVLR+
Sbjct  892  GVVLMELVTGRQPIEAEYGEDKDIVYWATRRMSSRESVAAVVDGRIQEPAREEAVKVLRV  951

Query  387  AILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            A LCTA LP  RP+MR VVQMLE+A   + ++ I+SK
Sbjct  952  AALCTARLPAMRPSMRTVVQMLEEATSGRALAAIISK  988


 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 107/146 (73%), Gaps = 1/146 (1%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D  F+P++ADFG+AK+LQ       +T VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  1817  DADFEPKVADFGIAKVLQARGDRDTSTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  1876

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
             MELV+GKKPIE E+GE+ DI+ WVS+K+ +KE  + ++D  I   P KE+ ++VLRIAI 
Sbjct  1877  MELVTGKKPIEPEFGESRDIIHWVSSKMCTKEGAMEVLDKQISWNPMKEEMVQVLRIAIR  1936

Query  378   CTAALPNSRPTMRRVVQMLEDAEPCK  301
             CT + P  RPTM  VVQ+L +A+PCK
Sbjct  1937  CTCSNPTLRPTMNEVVQLLIEAQPCK  1962



>ref|XP_004170874.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HAIKU2-like [Cucumis sativus]
Length=985

 Score =   194 bits (493),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSS--CKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            D  +KPRIADFGLAKILQ  +     D++HVI GT GYIAPEY YT K+ EKSDVYSFGV
Sbjct  826  DSDWKPRIADFGLAKILQDGNGHGVGDSSHVIAGTLGYIAPEYAYTCKINEKSDVYSFGV  885

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESILSMVDSAIQEPFKEDAIKVLRIA  385
            VLMEL +GK+P EAE+GEN DIV W  ++++  K ++  MVD +I E   E+A+KVLRIA
Sbjct  886  VLMELATGKQPNEAEFGENKDIVQWAHSRMRELKGNLKEMVDPSISEAQVENAVKVLRIA  945

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            + CTA +P++RP+MR VV MLE+AEPC  + I+V K+
Sbjct  946  LRCTAKIPSTRPSMRMVVHMLEEAEPCNFIDIVVKKE  982



>ref|XP_009416779.1| PREDICTED: receptor-like protein kinase HAIKU2 [Musa acuminata 
subsp. malaccensis]
Length=1026

 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQ-----YNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYS  571
             D+  KPRIADFGLAKIL        +      HVI GTHGYIAPEY YT KV EKSDVYS
Sbjct  843   DDCLKPRIADFGLAKILHSVPAGRGAGEASAAHVIAGTHGYIAPEYAYTWKVNEKSDVYS  902

Query  570   FGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLR  391
             FGVVLMELV+G++PIEAEYGEN DIV WV+ ++ S+ES++++VD    E  +E+A+KVLR
Sbjct  903   FGVVLMELVTGRQPIEAEYGENKDIVCWVAGRMISRESVMALVDGRTPEWRREEAVKVLR  962

Query  390   IAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDN  256
             +A+LCTA LP  RP+MR VVQML++A   +    I S    K++N
Sbjct  963   VAVLCTARLPTMRPSMRTVVQMLQEAGSGREFVAIGSGKNEKVEN  1007



>gb|KGN43819.1| hypothetical protein Csa_7G069690 [Cucumis sativus]
Length=985

 Score =   192 bits (489),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 92/157 (59%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSS--CKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            D  +KPRIADFGLAKILQ  +     D++HVI GT GYIAPEY YT K+ EKSDVYSFGV
Sbjct  826  DSDWKPRIADFGLAKILQDGNGHGVGDSSHVIAGTLGYIAPEYAYTCKINEKSDVYSFGV  885

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESILSMVDSAIQEPFKEDAIKVLRIA  385
            VLMEL +GK+P EAE+GEN DIV W  ++++  K ++  MVD +I E   E+A+KVLRIA
Sbjct  886  VLMELATGKQPNEAEFGENKDIVQWAHSRMRELKGNLKEMVDPSISEAQVENAVKVLRIA  945

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            + CTA +P++RP+M+ VV MLE+AEPC  + I+V K+
Sbjct  946  LRCTAKIPSTRPSMKMVVHMLEEAEPCNFIDIVVKKE  982



>ref|XP_003541774.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Glycine 
max]
 gb|KHN19047.1| Receptor-like protein kinase HAIKU2 [Glycine soja]
Length=964

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 93/155 (60%), Positives = 117/155 (75%), Gaps = 2/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +KPRIADFGLAKILQ      + T+VI GT GY+ PEY YT +V EKSDVYSFGVVL
Sbjct  812  DEEWKPRIADFGLAKILQ--GGAGNWTNVIAGTVGYMPPEYAYTCRVTEKSDVYSFGVVL  869

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+P+E E+GEN+DIV WV   ++S+E  L +VD  I +  KEDA+KVL+IA LC
Sbjct  870  MELVTGKRPMEPEFGENHDIVYWVCNNIRSREDALELVDPTIAKHVKEDAMKVLKIATLC  929

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            T  +P SRP+MR +VQMLE+A+P     +IV+ DA
Sbjct  930  TGKIPASRPSMRMLVQMLEEADPFTTTKMIVTIDA  964



>ref|XP_006852741.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
 gb|ERN14208.1| hypothetical protein AMTR_s00033p00104210 [Amborella trichopoda]
Length=967

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 89/143 (62%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEFF+ RIADFGLAK++Q   S ++ +  + GT GY+APEY Y+  V EK+DVYSFGVVL
Sbjct  809  DEFFEARIADFGLAKVVQRVGS-REVSRSVAGTLGYMAPEYAYSSNVSEKTDVYSFGVVL  867

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MELV+GK+PI+ E+G + DIV WVS+K+ S+ES+L +VDS IQE  +E+A+KVLRIA+LC
Sbjct  868  MELVTGKRPIQPEFGVHGDIVMWVSSKMTSRESVLGVVDSRIQESMREEAVKVLRIAVLC  927

Query  375  TAALPNSRPTMRRVVQMLEDAEP  307
            T+ LP  RPTMR VVQML DA+P
Sbjct  928  TSRLPALRPTMRGVVQMLLDADP  950



>ref|XP_002522038.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF40238.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   190 bits (483),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 118/156 (76%), Gaps = 3/156 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCK---DTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFG  565
            DE +KPRIADFGLAKI+Q         + +++I GT+GY+APEY YT KV EKSDVYSFG
Sbjct  820  DEDWKPRIADFGLAKIVQGGGGGGGGGEWSNMIAGTYGYMAPEYAYTCKVNEKSDVYSFG  879

Query  564  VVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            VVLMELV+GK+P E E+GEN DIV WV +K+  KE+ L +VDS I E  KEDAIKVL+IA
Sbjct  880  VVLMELVTGKRPTEPEFGENKDIVYWVHSKISRKENSLDIVDSNISERLKEDAIKVLQIA  939

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK  277
            + CTA +P  RPTMR VVQMLE+AE  +L  IIV K
Sbjct  940  VHCTAKIPALRPTMRLVVQMLEEAESHQLSDIIVVK  975



>ref|XP_008455077.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=983

 Score =   190 bits (482),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQ--YNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            D  +KPRIADFGLAKILQ  +     D++HVI GT GYIAPEY YT K+ EKSDVYSFGV
Sbjct  824  DSDWKPRIADFGLAKILQDGHGHGVGDSSHVIAGTLGYIAPEYAYTCKINEKSDVYSFGV  883

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESILSMVDSAIQEPFKEDAIKVLRIA  385
            VLMEL +GK+P EAE+GEN DIV W  ++++  K ++  MVD +I E   EDA+KVLRIA
Sbjct  884  VLMELATGKQPNEAEFGENKDIVQWAHSRMRELKGNLKDMVDPSISEAQVEDAVKVLRIA  943

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            + CTA +P++RP+MR VV MLE+AEP   + I+V K+
Sbjct  944  LRCTAKIPSTRPSMRMVVHMLEEAEPYNFIDIVVKKE  980



>ref|XP_010668040.1| PREDICTED: receptor-like protein kinase HAIKU2 [Beta vulgaris 
subsp. vulgaris]
Length=973

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 2/158 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKI++ N  C ++THV+ GT+GYIAPEYGYT KV EK DVYSFGVVL
Sbjct  816  DEFLKPRIADFGLAKIVKENVVCPNSTHVVAGTYGYIAPEYGYTSKVNEKCDVYSFGVVL  875

Query  555  MELVSGKKPI-EAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            +ELV+GK+PI E E+ E NDIV WVS KL++   I S++DS+I E   E+ IKVL+IAI 
Sbjct  876  LELVTGKRPINEPEFRE-NDIVDWVSIKLRNSNVISSIIDSSIMESENEEVIKVLKIAIF  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            CT  LP  RPTM+ VVQMLE+A P KLV  +++K   +
Sbjct  935  CTRKLPELRPTMKSVVQMLEEAAPSKLVPSLMAKAGQR  972



>ref|XP_009631895.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=958

 Score =   180 bits (457),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       +T VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  790  YQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  849

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E+E+GEN +IV WVSTK+++KE    ++D  + + FKED IKVLRIAI CT +
Sbjct  850  ITGKKPVESEFGENKNIVYWVSTKVETKEGAFEVLDKKVSDSFKEDMIKVLRIAIRCTYS  909

Query  366  LPNSRPTMRRVVQMLEDAEPCKL  298
             P  RPTM  VVQ+L +A+PCK 
Sbjct  910  TPAQRPTMNEVVQLLIEADPCKF  932



>ref|XP_009764826.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=958

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       +T VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  790  YQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  849

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E+E+GEN +IV WVSTK+++KE    ++D  + + FKED IKVLRIAI CT +
Sbjct  850  ITGKKPVESEFGENKNIVYWVSTKVETKEGAFEVLDKNVSDSFKEDMIKVLRIAIRCTYS  909

Query  366  LPNSRPTMRRVVQMLEDAEPCKL  298
             P  RPTM  VVQ+L +A+PCK 
Sbjct  910  TPALRPTMNEVVQLLIEADPCKF  932



>ref|XP_007227013.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
 gb|EMJ28212.1| hypothetical protein PRUPE_ppa001184mg [Prunus persica]
Length=886

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  718  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  777

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + ++D  + E FKE+ I+VLRIA+ C
Sbjct  778  MELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAMEVLDKRLSESFKEEMIQVLRIAVRC  837

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK-----DAAKLDNPSD  247
            T   P+ RPTM+ VVQ+L +A+PC+  S   SK     +  K+ +P D
Sbjct  838  TYKAPSLRPTMKEVVQLLIEADPCRFDSCKSSKTKESSNLTKIKSPYD  885



>gb|ACI42311.1| putative leucine rich repeat transmembrane protein kinase [Corchorus 
olitorius]
Length=957

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY ++ K   K DVYSFGVVL
Sbjct  786  DVNYRPKVADFGIAKVLQATGGKDSTTTVIAGTYGYLAPEYAFSSKATTKCDVYSFGVVL  845

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA++GEN +IV W+STKL +KE ++ ++D  +   F+++ I+VLRIA+ C
Sbjct  846  MELITGKKPVEADFGENKNIVYWISTKLDTKEGVMEVLDKQLSGSFRDEMIQVLRIAMRC  905

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T   P+ RPTM  VVQ+L +A+PC+L S  +S +  K
Sbjct  906  TCKNPSQRPTMNEVVQLLIEADPCRLDSCKLSSNKTK  942



>ref|XP_008219158.1| PREDICTED: receptor-like protein kinase HSL1 [Prunus mume]
Length=967

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  799  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  858

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + ++D  + E FKE+ I+VLRIA+ C
Sbjct  859  MELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAMEVLDKRLSESFKEEMIQVLRIAVRC  918

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK-----DAAKLDNPSD  247
            T   P+ RPTM+ VVQ+L +A+PC+  S   SK     +  K+ +P D
Sbjct  919  TYKAPSLRPTMKEVVQLLIEADPCRFDSCKSSKTKESSNMTKIKSPYD  966



>ref|XP_007018366.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
 gb|EOY15591.1| Leucine-rich repeat transmembrane protein kinase family protein 
[Theobroma cacao]
Length=954

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 117/168 (70%), Gaps = 7/168 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  785  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSNKATTKCDVYSFGVVL  844

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA++GEN +IV WVS +L +K+ ++ ++D  +   FK++ I+VLRIA+ C
Sbjct  845  MELITGKKPVEADFGENKNIVYWVSGRLDTKDGVMEVLDKRLSGSFKDEMIQVLRIAMRC  904

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSKM  232
            T+  PN RPTM  VVQ+L +A+PCK        D+ KL N +   S +
Sbjct  905  TSRNPNHRPTMNEVVQLLIEADPCKF-------DSCKLSNKTKEASNV  945



>gb|KDP41543.1| hypothetical protein JCGZ_15950 [Jatropha curcas]
Length=469

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 112/160 (70%), Gaps = 0/160 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  300  DVNYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYMAPEYAYSSKATTKCDVYSFGVVL  359

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKPI  ++GEN +I+ WVS K+ +KE ++ ++D  +   F+++ I+VLRIAI C
Sbjct  360  MELITGKKPIHTDFGENKNIIYWVSGKVDTKEGVMEVLDKRLSGSFRDEMIQVLRIAIRC  419

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDN  256
            T + P  RPTM  VVQML +A+PC+  S   S  + ++ N
Sbjct  420  TCSTPALRPTMSEVVQMLIEADPCRFDSCKSSTKSKEMSN  459



>gb|AAB60752.1| Similar to A. thaliana receptor-like protein kinase (gb|RLK5_ARATH). 
ESTs gb|ATTS0475,gb|ATTS4362 come from this gene [Arabidopsis 
thaliana]
Length=921

 Score =   178 bits (451),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 110/155 (71%), Gaps = 26/155 (17%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP                     
Sbjct  785  DEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAP---------------------  823

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
                 GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+C
Sbjct  824  -----GKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAIIC  878

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA  271
            TA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct  879  TARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES  913



>ref|XP_004238044.1| PREDICTED: receptor-like protein kinase HSL1 [Solanum lycopersicum]
Length=957

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       +T VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  788  YQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  847

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E E+G+N +IV WVSTK+++KE    ++D  + + FKED IKVLRIAI CT +
Sbjct  848  ITGKKPVEPEFGDNKNIVYWVSTKVETKEGAFEVLDKKVSDSFKEDMIKVLRIAIRCTYS  907

Query  366  LPNSRPTMRRVVQMLEDAEPCKL  298
             P  RPTM  VVQ+L +A+PCK 
Sbjct  908  TPTLRPTMNEVVQLLIEADPCKF  930



>ref|XP_002526416.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF35992.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=210

 Score =   166 bits (421),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AK+++ +    D++ V  GTHGYIAPE  YT KV EKSDVYSFGVVL
Sbjct  56   DEDYEPKIADFGVAKLVEVSYKGCDSSSV-AGTHGYIAPEMAYTLKVTEKSDVYSFGVVL  114

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE  YGE+ DIV WV T L  +E+++ ++D  +  E  + D IKVL+IAIL
Sbjct  115  LELVTGRRPIEEAYGESKDIVYWVWTHLNDRENVIKVLDHEVASESLQGDMIKVLKIAIL  174

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LPN RP MR VV+ML DA+P
Sbjct  175  CTTKLPNLRPNMREVVKMLVDADP  198



>ref|XP_006356797.1| PREDICTED: receptor-like protein kinase HSL1-like [Solanum tuberosum]
Length=955

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       +T VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  789  YQPKVADFGIAKVLQARGGKDSSTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  848

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E E+G+N +IV WVSTK+++KE    ++D  + + FKED IKVLRIAI CT +
Sbjct  849  ITGKKPVEPEFGDNKNIVYWVSTKVETKEGAFEVLDKKVSDSFKEDMIKVLRIAIRCTYS  908

Query  366  LPNSRPTMRRVVQMLEDAEPCKL  298
             P  RPTM  VVQ+L +A+PCK 
Sbjct  909  TPTLRPTMNEVVQLLIEADPCKF  931



>ref|XP_009786287.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana sylvestris]
Length=953

 Score =   177 bits (450),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 106/148 (72%), Gaps = 5/148 (3%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  789  YQPKVADFGIAKVLQAKGGKDCTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  848

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E E+GEN +IV WVSTK+ +KE    ++D  I  PFKE+ IKVLRIAI CT  
Sbjct  849  ITGKKPVEPEFGENKNIVCWVSTKVDTKEGAFEVLDKKISGPFKEEMIKVLRIAIGCTYT  908

Query  366  LPNSRPTMRRVVQMLEDAEP-----CKL  298
             P  RPTM  VVQML +AEP     CKL
Sbjct  909  SPAFRPTMNEVVQMLTEAEPRRYDCCKL  936



>ref|XP_009599063.1| PREDICTED: receptor-like protein kinase HSL1 [Nicotiana tomentosiformis]
Length=950

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 112/165 (68%), Gaps = 7/165 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  784  YQPKVADFGIAKVLQAKGGKDCTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  843

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E E+GEN +IV WVSTK  +KE    ++D  I  PFKE+ IKVLRIAI CT +
Sbjct  844  ITGKKPVETEFGENKNIVYWVSTKADTKEGAFEVLDKKISGPFKEEMIKVLRIAIGCTYS  903

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSKM  232
             P  RPTM  VVQML +AEP +        D  KL N + +T  +
Sbjct  904  SPAFRPTMNEVVQMLTEAEPRR-------YDCCKLPNKNKHTENI  941



>ref|XP_006442751.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
 gb|ESR55991.1| hypothetical protein CICLE_v10018723mg [Citrus clementina]
Length=963

 Score =   177 bits (449),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 119/170 (70%), Gaps = 7/170 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  793  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  852

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++G+KP+E ++G+N +I+ WVSTK+ +KE I+ ++D  +   F+++ I+VLRIAI C
Sbjct  853  MELITGRKPVEDDFGDNKNIIYWVSTKVDTKEGIMEVLDKKLSGSFRDEMIEVLRIAIRC  912

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-------SKDAAKLDNPSD  247
            T+  P +RPTM  VVQ+L +A+PC+  S          S +A K+ NPS+
Sbjct  913  TSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSNKESSNATKIKNPSE  962



>emb|CDP00973.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  840  YQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  899

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+EA+YGEN DI+ WVSTK+++KE  L ++D  I   FK++ IK+LR+AI CT  
Sbjct  900  ITGKKPVEADYGENKDIIYWVSTKVETKEGPLEVLDKKISGSFKDEMIKMLRVAIRCTCR  959

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVS  292
             P  RPTM  VVQ+L +A+PCK  S
Sbjct  960  NPALRPTMSEVVQLLIEADPCKFGS  984



>ref|NP_188604.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
 sp|Q9LJM4.1|IKU2_ARATH RecName: Full=Receptor-like protein kinase HAIKU2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02557.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AEE76277.1| leucine rich repeat kinase HAIKU 2 [Arabidopsis thaliana]
Length=991

 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  823  DEEWRPRIADFGLAKIIQADSVQRDFSAPLVKGTLGYIAPEYAYTTKVNEKSDVYSFGVV  882

Query  558  LMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E ++GENNDIV WV   +K  ++E ++ ++D++I++ +KEDA+KVL IA
Sbjct  883  LMELVTGKKPLETDFGENNDIVMWVWSVSKETNREMMMKLIDTSIEDEYKEDALKVLTIA  942

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
            +LCT   P +RP M+ VV MLE  EP
Sbjct  943  LLCTDKSPQARPFMKSVVSMLEKIEP  968



>gb|KHG16379.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
 gb|KHG22296.1| Receptor-like protein kinase HSL1 [Gossypium arboreum]
Length=475

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 111/157 (71%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ          VI GT+GY+APEY Y+ K   KSDVYSFGVVL
Sbjct  305  DANYEPKVADFGIAKVLQARGGKDSIITVIAGTYGYLAPEYAYSSKATTKSDVYSFGVVL  364

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA++GEN +I+ WVSTKL +KE ++ ++D  +   FK++ I+VLRIA+ C
Sbjct  365  MELITGKKPVEADFGENKNIIYWVSTKLDTKEGVMEVLDKRVSGSFKDEMIQVLRIAMRC  424

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T   P  RP M  VVQ+L +A+PC+  S  +S +  K
Sbjct  425  TYRNPTQRPPMNEVVQLLIEADPCRFDSCKLSINKTK  461



>gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus capsularis]
Length=958

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY ++ K   K DVYSFGVVL
Sbjct  787  DVNYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAFSSKATTKCDVYSFGVVL  846

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+E+++GEN +IV W+STKL +KE ++ ++D  +   F+++ I+VLRIA+ C
Sbjct  847  MELITGKKPVESDFGENKNIVYWISTKLDTKEGVMEVLDKQLSGSFRDEMIQVLRIAMRC  906

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T   P+ RPTM  VVQ+L +A+PC+L S  ++ +  K
Sbjct  907  TCKNPSQRPTMNEVVQLLIEADPCRLDSCKLTSNKTK  943



>gb|KDO42901.1| hypothetical protein CISIN_1g003199mg [Citrus sinensis]
Length=840

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  670  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  729

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++G+KP+E ++G+N +I+ WVS K+ +KE I+ ++D  +   F+++ I+VLRIAI C
Sbjct  730  MELITGRKPVEDDFGDNKNIIYWVSIKVDTKEGIMEVLDKKLSGSFRDEMIQVLRIAIRC  789

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-------SKDAAKLDNPSD  247
            T+  P +RPTM  VVQ+L +A+PC+  S          S +A K+ NPS+
Sbjct  790  TSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSNKESSNATKIKNPSE  839



>ref|XP_004299842.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=965

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  + P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  796  DVNYHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  855

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EAE+G+N +I+ WVS K+ +KE  + ++D  + E FKE+ I+VLRIA+ C
Sbjct  856  MELITGKKPVEAEFGDNKNIIYWVSNKVDTKEGAMEVLDKRLSESFKEEMIQVLRIAVRC  915

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKL  298
            T   P+ RPTM+ VVQ+L +A+PC+ 
Sbjct  916  TYKAPSLRPTMKEVVQLLIEADPCRF  941



>gb|KJB59873.1| hypothetical protein B456_009G278200 [Gossypium raimondii]
Length=975

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 126/172 (73%), Gaps = 11/172 (6%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD+T+ VI GT+GY+APEY Y+ K   K DVYS+GVV
Sbjct  805  DANYQPKVADFGIAKVLQ--ARGKDSTNTVIAGTYGYLAPEYAYSNKATTKCDVYSYGVV  862

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+E+++GEN +IV WVSTKL++KE ++  +D ++   FK++ I+VLR A+ 
Sbjct  863  LMELITGKKPVESDFGENKNIVYWVSTKLETKEGVMEALDKSLSTSFKDEMIQVLRTAMR  922

Query  378  CTAALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSKDAA---KLDNPSD  247
            CT   P+ RPTM  VVQ+L DA+P     CKL+S   +KDA+   K+ N +D
Sbjct  923  CTCKNPSQRPTMNEVVQLLIDADPCRLGSCKLLSTNKTKDASNVTKIKNQTD  974



>ref|XP_006487758.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=963

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  793  DVNYQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  852

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++G+KP+E ++G+N +I+ WVS K+ +KE I+ ++D  +   F+++ I+VLRIAI C
Sbjct  853  MELITGRKPVEDDFGDNKNIIYWVSIKVDTKEGIMEVLDKKLSGSFRDEMIQVLRIAIRC  912

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIV-------SKDAAKLDNPSD  247
            T+  P +RPTM  VVQ+L +A+PC+  S          S +A K+ NPS+
Sbjct  913  TSKSPATRPTMNEVVQLLAEADPCRFESCKFPNKSNKESSNATKIKNPSE  962



>ref|XP_002883200.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59459.1| hypothetical protein ARALYDRAFT_479487 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   175 bits (444),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 85/146 (58%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +   +D++  ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  826  DEEWRPRIADFGLAKIIQPDWVQRDSSAPLVEGTLGYIAPEYAYTTKVNEKSDVYSFGVV  885

Query  558  LMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E E+ EN+DIV WV   +K  ++E ++ +VD +I++ +KEDA+KVL IA
Sbjct  886  LMELVTGKKPVETEFSENSDIVMWVWSISKEMNREMMMELVDPSIEDEYKEDALKVLTIA  945

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
            +LCT   P +RP M+ VV MLE  EP
Sbjct  946  LLCTDKSPQARPFMKSVVSMLEKIEP  971



>ref|XP_011074306.1| PREDICTED: receptor-like protein kinase HSL1 [Sesamum indicum]
Length=961

 Score =   175 bits (443),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 7/164 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ   S   TT  I GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  795  YQPKVADFGIAKVLQARGSKDSTTTEIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  854

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+EAE+GEN +I+ WVSTK+++KE    ++D  +   ++ED IKVLR+A+ CT  
Sbjct  855  ITGKKPVEAEFGENKNIIYWVSTKVETKEGAADVLDKRVVGSYEEDMIKVLRVAVRCTCR  914

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSK  235
             P  RPTM  VVQ+L +A+PCK        D  KL N +  T+ 
Sbjct  915  TPVLRPTMNEVVQLLIEADPCKF-------DCCKLSNKTKETAN  951



>ref|XP_010247922.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=975

 Score =   175 bits (443),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AK +   ++  + +    GTHGYIAPE+ Y+ KV EKSD+YSFGVVL
Sbjct  824  DEDYEPKIADFGIAKTV---AASPNDSSCFAGTHGYIAPEFAYSLKVTEKSDIYSFGVVL  880

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+G++PIE EYGE  DIV WVST L S++ ++ ++D  +    ++D IKVLRIAILC
Sbjct  881  LELVTGRRPIELEYGEGKDIVYWVSTHLDSRDDVIKILDHKVSNSVEDDMIKVLRIAILC  940

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKL  298
            T  LP+ RPTMR VV+ML DA+PC  
Sbjct  941  TKKLPSLRPTMRDVVKMLIDADPCNF  966



>ref|XP_004136411.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 ref|XP_004165067.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN60297.1| hypothetical protein Csa_3G893960 [Cucumis sativus]
Length=947

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  + P++ADFG+AK+LQ  +    TT VI GT+GY+APEY Y+ K   K DVYSFG+VL
Sbjct  782  DVNYHPKVADFGIAKVLQARTGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGIVL  841

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + ++D  +   FK++ I+VLRIAI C
Sbjct  842  MELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAMEVLDKRVSCSFKDEMIEVLRIAIRC  901

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS--KDAAKLDNPSD  247
            T   P  RPTM+ VVQ+L +A+PCK  S   S      K++NP D
Sbjct  902  TYKNPALRPTMKEVVQLLIEADPCKFDSHNKSSKHTTTKINNPFD  946



>ref|XP_008466101.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HSL1 [Cucumis melo]
Length=946

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  + P++ADFG+AK+LQ  +    TT VI GT+GY+APEY Y+ K   K DVYSFG+VL
Sbjct  781  DVNYHPKVADFGIAKVLQARTGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGIVL  840

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EAE+GEN +I+ WVS K+ +KE  + ++D  +   FK++ I+VLRIAI C
Sbjct  841  MELITGKKPVEAEFGENKNIIYWVSNKVDTKEGAMEVLDKRVSCSFKDEMIEVLRIAIRC  900

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS--KDAAKLDNPSD  247
            T   P  RPTM+ VVQ+L +A+PCK  S   S      K++NP D
Sbjct  901  TYKNPALRPTMKEVVQLLIEADPCKFDSHNKSSKHTTTKINNPFD  945



>gb|EYU36418.1| hypothetical protein MIMGU_mgv1a000952mg [Erythranthe guttata]
Length=935

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDT-THVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLME  550
            ++P++ADFG+AK+LQ   S KD+ T VI GT+GY+APEY Y+ K   + DVYSFGVVLME
Sbjct  766  YQPKVADFGIAKVLQARGSSKDSSTTVIAGTYGYLAPEYAYSSKATTRCDVYSFGVVLME  825

Query  549  LVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTA  370
            L++GKKP+EAE+GEN +I+ WVS+K+++KE  + ++D  +   +K+D IKVLRIA+ CT 
Sbjct  826  LLTGKKPVEAEFGENKNIIYWVSSKVETKEGAIDVLDKRLLGNYKDDMIKVLRIAMRCTC  885

Query  369  ALPNSRPTMRRVVQMLEDAEPCKL  298
              PN RPTM  V Q+L +A+PCK 
Sbjct  886  KNPNLRPTMNEVAQLLIEADPCKF  909



>ref|XP_006441549.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
 gb|ESR54789.1| hypothetical protein CICLE_v10018710mg [Citrus clementina]
Length=973

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AKI + +    D +    GTHGYIAPE  YT KV EKSDV+SFGVVL
Sbjct  813  DEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAPELAYTCKVSEKSDVFSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE EYG+  DIV WVST L + E++L ++D  +  E  KED IKVL+IA++
Sbjct  872  LELVTGRKPIEEEYGDGKDIVYWVSTHLNNHENVLKVLDREVASESIKEDMIKVLKIAVV  931

Query  378  CTAALPNSRPTMRRVVQMLEDAEPC  304
            CT  LPN RP MR VV+ML DA+PC
Sbjct  932  CTTKLPNLRPPMREVVKMLADADPC  956



>ref|XP_010061584.1| PREDICTED: receptor-like protein kinase HSL1 [Eucalyptus grandis]
 gb|KCW68569.1| hypothetical protein EUGRSUZ_F02182 [Eucalyptus grandis]
Length=954

 Score =   174 bits (441),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  F+P++ADFG+AK+LQ       T+ VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  790  DAHFQPKVADFGIAKVLQARGGKDSTSTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  849

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +EL++GK+P+E E+GEN +I  WVSTK+ +KE  + ++D  +   F+ED I+VLRIAI C
Sbjct  850  LELITGKRPVEHEFGENKNITCWVSTKVDTKEGTVEVLDKRLSSSFREDIIRVLRIAICC  909

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            T   P  RPTM  VV +L +A+PCK  S
Sbjct  910  TYGAPALRPTMNEVVHLLIEADPCKFGS  937



>gb|KJB29386.1| hypothetical protein B456_005G097700 [Gossypium raimondii]
Length=956

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            + P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  789  YHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSNKATTKCDVYSFGVVLMEL  848

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E ++GEN +IV W+S KL++KE ++ ++D  + + FKE+ +KVLRIA+ CT  
Sbjct  849  ITGKKPVETDFGENKNIVLWISAKLETKEGVVEVLDKKLSKTFKEEMVKVLRIAMRCTCK  908

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVS-------IIVSKDAAKLDNPSD  247
             P+ RPTM  VVQ+L ++EP +L S       I  + +A K+ N SD
Sbjct  909  NPSQRPTMNEVVQLLIESEPFRLDSSCKSPSKIKEAANANKIKNQSD  955



>gb|KDO45819.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
 gb|KDO45820.1| hypothetical protein CISIN_1g002063mg [Citrus sinensis]
Length=973

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AKI + +    D +    GTHGYIAPE  YT KV EKSDV+SFGVVL
Sbjct  813  DEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAPELAYTCKVSEKSDVFSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G+KP+E EYG+  DIV WVST L + E++L ++D  +  E  KED IK+L+IA++
Sbjct  872  LELVTGRKPVEEEYGDGKDIVYWVSTHLNNHENVLKVLDCEVASESIKEDMIKLLKIAVV  931

Query  378  CTAALPNSRPTMRRVVQMLEDAEPC  304
            CT  LPN RP MR VV+ML DA+PC
Sbjct  932  CTTKLPNLRPPMREVVKMLADADPC  956



>gb|AEX11047.1| hypothetical protein 0_1169_01 [Pinus taeda]
Length=148

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -3

Query  642  GTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSK  463
            GTHGY APEY Y++KV EKSDVYSFGVVL+EL++GK P E E+GENNDIV W+S K+  K
Sbjct  11   GTHGYFAPEYAYSKKVTEKSDVYSFGVVLLELITGKGPNEPEFGENNDIVYWISQKIYEK  70

Query  462  ESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC  304
            +    ++DS I   FKE+ I+ L+IA+ CT  LPNSRP+MR VVQML+DA+PC
Sbjct  71   KDAFVVLDSRISNSFKEEMIRALKIAVFCTHKLPNSRPSMREVVQMLKDADPC  123



>ref|XP_006478192.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Citrus sinensis]
Length=973

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AKI + +    D +    GTHGYIAPE  YT KV EKSDV+SFGVVL
Sbjct  813  DEDYEPKIADFGVAKIAENSPKVSDYS-CFAGTHGYIAPELAYTCKVSEKSDVFSFGVVL  871

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G+KP+E EYG+  DIV WVST L + E++L ++D  +  E  KED IK+L+IA++
Sbjct  872  LELVTGRKPVEEEYGDGKDIVYWVSTHLNNHENVLKVLDCEVASESIKEDMIKLLKIAVV  931

Query  378  CTAALPNSRPTMRRVVQMLEDAEPC  304
            CT  LPN RP MR VV+ML DA+PC
Sbjct  932  CTTKLPNLRPPMREVVKMLADADPC  956



>ref|XP_007020166.1| Leucine-rich receptor-like protein kinase family protein isoform 
1 [Theobroma cacao]
 gb|EOY17391.1| Leucine-rich receptor-like protein kinase family protein isoform 
1 [Theobroma cacao]
Length=1004

 Score =   172 bits (436),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AKI + +    + +    GTHGY APE  YT KV EKSDVYSFGVVL
Sbjct  844  DEDYEPKIADFGVAKIAEKSPKGSEYS-CFAGTHGYFAPELAYTPKVTEKSDVYSFGVVL  902

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G+ P+E EYGE  DIV WV T L + ES+L ++D+ +  E  ++D IKVL++ IL
Sbjct  903  LELVTGRGPVEEEYGEGKDIVYWVLTHLNNLESVLKVLDNEVASETVRDDMIKVLKVGIL  962

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CTA LP+SRPTMR VV+ML DAEPC  +S
Sbjct  963  CTAKLPSSRPTMREVVKMLIDAEPCTFMS  991



>ref|XP_002510008.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF52195.1| receptor protein kinase, putative [Ricinus communis]
Length=956

 Score =   171 bits (434),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 114/167 (68%), Gaps = 0/167 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       T+ V+ GT+GYIAPEY Y+ K   K DVYSFGVVL
Sbjct  787  DVSYQPKVADFGIAKVLQARGGKDSTSTVVAGTYGYIAPEYAYSSKATTKCDVYSFGVVL  846

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+E ++GEN +IV+WVSTK+++KE ++ ++D  +   F  + I+VLRIAI C
Sbjct  847  MELITGKKPVEEDFGENKNIVNWVSTKVETKEGVMEVLDKKLSGSFWNEMIQVLRIAIRC  906

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTSK  235
                P  RPTM  VVQ+L +A+PC+  S   S  A +  N +   SK
Sbjct  907  ICKTPAPRPTMNEVVQLLIEADPCRFDSCKSSNKAKETSNVTKINSK  953



>gb|KJB58763.1| hypothetical protein B456_009G225100 [Gossypium raimondii]
Length=958

 Score =   171 bits (434),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 111/157 (71%), Gaps = 0/157 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ          VI GT+GY+APEY Y+ K   KSDVYSFGVVL
Sbjct  788  DANYEPKVADFGIAKVLQARGGKDSIITVIAGTYGYLAPEYAYSSKATTKSDVYSFGVVL  847

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA +GEN +IV WVSTKL +KE ++ ++D  +   FK++ I+VLRIA+ C
Sbjct  848  MELITGKKPVEAVFGENKNIVYWVSTKLDTKEGVMEVLDKRVSGSFKDEMIQVLRIAMRC  907

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK  265
            T   P+ RP M  VVQ+L +A+PC+  S  +S +  K
Sbjct  908  TYRNPSQRPPMNEVVQLLIEADPCRFDSCKLSINKTK  944



>ref|XP_010667798.1| PREDICTED: receptor-like protein kinase HSL1 [Beta vulgaris subsp. 
vulgaris]
Length=958

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLME  550
            F+P++ADFG+AK+LQ +   KD++H +I GT+GY+ P+Y  T K   K DVYSFGVVLME
Sbjct  792  FQPKVADFGVAKVLQ-SKVGKDSSHTLIAGTYGYMDPDYANTSKATTKCDVYSFGVVLME  850

Query  549  LVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTA  370
            LV+GKKP+EAE+GEN +I++W+STK+K+KE  + ++D+ I   F++D IKV+RIAI CTA
Sbjct  851  LVTGKKPVEAEFGENKNIINWISTKVKTKEGAMEVLDNQISGLFRDDMIKVIRIAIRCTA  910

Query  369  ALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPS  250
              P  RPTM  +VQ+L + +PC+  S   +K      +P+
Sbjct  911  RAPVPRPTMNEIVQLLSEIDPCRFDSCKSTKKTKDTLDPT  950



>ref|XP_006300009.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
 gb|EOA32907.1| hypothetical protein CARUB_v10016232mg [Capsella rubella]
Length=982

 Score =   171 bits (434),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 113/146 (77%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S+ +D +  ++ GT GYIAPEY YT+ V EKSDVYSFGVV
Sbjct  825  DEEWRPRIADFGLAKIIQPDSAQQDFSAPLVKGTLGYIAPEYAYTRNVNEKSDVYSFGVV  884

Query  558  LMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E E+GEN+DIV WV   +K  ++E ++ ++D +I++ +KEDA+KVL IA
Sbjct  885  LMELVTGKKPVEIEFGENSDIVMWVWRMSKEMNREMMMELIDPSIEDEYKEDALKVLTIA  944

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
             LCT   P +RP M+ VV MLE  EP
Sbjct  945  SLCTDKSPQARPFMKSVVSMLEKIEP  970



>ref|XP_009335485.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=964

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            + ++ADFG+AK+LQ +     TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL+
Sbjct  799  QAKVADFGIAKVLQASGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMELI  858

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAAL  364
            +GKKP+EAE+G+N +I+ WVS K+ +KE  + ++D  + + F+E+ I+VLRIA+ CT   
Sbjct  859  TGKKPVEAEFGDNKNIIYWVSNKVDTKEGAMEVLDKQLLDSFQEEMIQVLRIAVRCTCKA  918

Query  363  PNSRPTMRRVVQMLEDAEPCKLVS  292
            P+ RP+M+ VVQ+L +A+PC+ VS
Sbjct  919  PSLRPSMKEVVQLLIEADPCRFVS  942



>ref|XP_009357235.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=1008

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            +P++ADFG+AK+LQ  +    TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL+
Sbjct  843  QPKVADFGIAKVLQARAGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMELI  902

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAAL  364
            +GK+P+EAE+G+N +I+ WVS K+ +KE    ++D  + + FKE+ I+VLRIA+ CT   
Sbjct  903  TGKRPVEAEFGDNKNIIYWVSNKVDTKEGATEVLDKRLSDSFKEEMIQVLRIAVRCTYKA  962

Query  363  PNSRPTMRRVVQMLEDAEPCKLVS  292
            P+ RP+M++VVQ+L +A+PC+  S
Sbjct  963  PSLRPSMKKVVQLLIEADPCRFDS  986



>ref|XP_004148401.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 ref|XP_004166649.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus]
 gb|KGN62784.1| hypothetical protein Csa_2G372790 [Cucumis sativus]
Length=942

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 109/147 (74%), Gaps = 4/147 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ     KD+T+ VI GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  780  DANYQPKVADFGIAKVLQ---GTKDSTNSVIAGTYGYLAPEYAYSSKATTKCDVYSFGVV  836

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKPIE EYGEN +IV WVS K+ +KE +L ++D+ ++  FK+D IK LRIAI 
Sbjct  837  LMELITGKKPIETEYGENKNIVFWVSNKVDTKEGVLEILDNKLKGLFKDDIIKALRIAIR  896

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKL  298
            CT   P  RP +  VVQ+L++ +PCK 
Sbjct  897  CTYKNPVLRPAIGEVVQLLQEVDPCKF  923



>gb|KJB60054.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
 gb|KJB60055.1| hypothetical protein B456_009G287800 [Gossypium raimondii]
Length=977

 Score =   170 bits (430),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++P+IADFG+AKI + +    + +    GTHGYIAPE  YT KV EKSDVYSFGVVL
Sbjct  817  DDDYEPKIADFGVAKIAEKSLEGSEYSS-FAGTHGYIAPELAYTLKVTEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
            +ELV+GK  IE EYGE  DIV WV T L   E+++ ++D  +  E  ++D IKVL+I IL
Sbjct  876  LELVTGKASIEEEYGEGKDIVYWVLTHLGDGENVVKVLDDRVDVETVQDDMIKVLKIGIL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            C A LPN RPTMR VV ML DAEPC  +S  +  D
Sbjct  936  CAAKLPNLRPTMREVVNMLMDAEPCTAISADIKSD  970



>ref|XP_008444976.1| PREDICTED: receptor-like protein kinase HSL1 [Cucumis melo]
Length=944

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 107/143 (75%), Gaps = 4/143 (3%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            +P++ADFG+AK+LQ     KD+T+ VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  784  QPKVADFGIAKVLQ---GTKDSTNSVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMEL  840

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKPIE EYGEN +IV WVS K+ +KE +L ++D+ ++  F++D IK LRIAI CT  
Sbjct  841  ITGKKPIETEYGENKNIVFWVSNKVDTKEGVLEILDNKLKGLFRDDIIKALRIAIRCTYK  900

Query  366  LPNSRPTMRRVVQMLEDAEPCKL  298
             P  RP M  VVQ+L++ +PCK 
Sbjct  901  NPVLRPAMGEVVQLLQEVDPCKF  923



>emb|CDY42201.1| BnaA01g25940D [Brassica napus]
Length=921

 Score =   168 bits (426),  Expect = 8e-44, Method: Composition-based stats.
 Identities = 84/142 (59%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGL+KI+Q +S  +D ++ ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  753  DEEWRPRIADFGLSKIIQSDSVQRDVSSSIVEGTLGYIAPEYAYTTKVNEKSDVYSFGVV  812

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E E+GEN DIVSWV ++     KE ++ ++D  I+  +KEDA+KVL IA
Sbjct  813  LMELVTGKKPMEVEFGENRDIVSWVLSRSKEMEKEKMMELIDPVIEYEYKEDALKVLTIA  872

Query  384  ILCTAALPNSRPTMRRVVQMLE  319
            +LCT   P  RP M+ VV+MLE
Sbjct  873  LLCTGKSPQVRPFMKSVVRMLE  894



>gb|KFK39298.1| hypothetical protein AALP_AA3G226400 [Arabis alpina]
Length=986

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++P+IADFGLAKI+Q +S  +D +  ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  819  DEEWRPKIADFGLAKIIQPDSIQRDFSAPIVKGTLGYIAPEYAYTTKVNEKSDVYSFGVV  878

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E E+GEN DIV WV +K K  ++E ++ ++D  I+   KEDA+KVL IA
Sbjct  879  LMELVTGKKPVETEFGENRDIVMWVWSKSKDMNREKMMELIDPIIEYEHKEDALKVLTIA  938

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
            +LCT   P +RP M+ VV ML+  EP
Sbjct  939  LLCTNKSPQARPFMKSVVCMLKKTEP  964



>ref|XP_002962293.1| hypothetical protein SELMODRAFT_77558 [Selaginella moellendorffii]
 gb|EFJ37553.1| hypothetical protein SELMODRAFT_77558 [Selaginella moellendorffii]
Length=1023

 Score =   169 bits (427),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  F+ R+ADFGLAK+ Q +S   ++   I G++GYIAPEY YT KV EKSD+YSFGVVL
Sbjct  855  DAEFQARVADFGLAKLFQ-DSGKSESMSSIAGSYGYIAPEYAYTLKVNEKSDIYSFGVVL  913

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE---PFKEDAIKVLRIA  385
            +ELVSG++PIE E+G+  DIV WV  K+++K+ +L ++DS I+E   P +E  + VLR+A
Sbjct  914  LELVSGRRPIEPEFGDGVDIVQWVRKKIQTKDGVLEVLDSRIREENLPLQEIML-VLRVA  972

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCK  301
            +LCT+ LP  RPTMR VVQML DA P K
Sbjct  973  LLCTSDLPVDRPTMRDVVQMLGDARPGK  1000



>ref|XP_002965214.1| hypothetical protein SELMODRAFT_83051 [Selaginella moellendorffii]
 gb|EFJ34052.1| hypothetical protein SELMODRAFT_83051 [Selaginella moellendorffii]
Length=1023

 Score =   169 bits (427),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 83/148 (56%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  F+ R+ADFGLAK+ Q +S   ++   I G++GYIAPEY YT KV EKSD+YSFGVVL
Sbjct  855  DAEFQARVADFGLAKLFQ-DSGKSESMSSIAGSYGYIAPEYAYTLKVNEKSDIYSFGVVL  913

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE---PFKEDAIKVLRIA  385
            +ELVSG++PIE E+G+  DIV WV  K+++K+ +L ++DS I+E   P +E  + VLR+A
Sbjct  914  LELVSGRRPIEPEFGDGVDIVQWVRKKIQTKDGVLEVLDSRIREENLPLQEIML-VLRVA  972

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCK  301
            +LCT+ LP  RPTMR VVQML DA P K
Sbjct  973  LLCTSDLPVDRPTMRDVVQMLGDARPGK  1000



>ref|XP_003634589.1| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
 ref|XP_010665363.1| PREDICTED: receptor-like protein kinase HAIKU2 [Vitis vinifera]
Length=974

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AKI   NSS +  +    GTHGYIAPE  YT KV EKSD+YSFGVVL
Sbjct  814  DEEYEPKIADFGVAKIAD-NSSTESYSSCFAGTHGYIAPELAYTLKVTEKSDIYSFGVVL  872

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE EYGE  DIV WV T L  +E++  ++D  I  +  +ED +KVL++AIL
Sbjct  873  LELVTGRRPIEEEYGEGKDIVYWVGTHLSDQENVQKLLDRDIVSDLVQEDMLKVLKVAIL  932

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP  RPTMR VV+M+ DA+ C L S
Sbjct  933  CTNKLPTPRPTMRDVVKMIIDADSCTLKS  961



>ref|XP_010103492.1| Receptor-like protein kinase HSL1 [Morus notabilis]
 gb|EXC46783.1| Receptor-like protein kinase HSL1 [Morus notabilis]
Length=982

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 115/167 (69%), Gaps = 13/167 (8%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P++ADFG+AKI  +  S  D + V  GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  819  DEEYEPKVADFGVAKIAAHKGS--DFSSV-AGTHGYIAPELAYTLKVTEKCDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE EYGE  DIV WVST L + E ++ ++D  +  E  ++D IKVL+IA+ 
Sbjct  876  LELVTGRRPIEDEYGEGKDIVYWVSTHLNNLEDVMKVLDCRVASEVLQDDMIKVLKIAVS  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSDNTS  238
            CT  LP  RP+MR VV+ML DAEPC L S          DN SD++S
Sbjct  936  CTKKLPTLRPSMREVVKMLVDAEPCTLKS---------QDNNSDHSS  973



>ref|XP_010062414.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 ref|XP_010062415.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 ref|XP_010062416.1| PREDICTED: receptor-like protein kinase HAIKU2 [Eucalyptus grandis]
 gb|KCW69556.1| hypothetical protein EUGRSUZ_F02986 [Eucalyptus grandis]
Length=989

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 109/147 (74%), Gaps = 2/147 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AK ++ +    + +  I GTHGY+APE  YT KV EK+DVYSFGVVL
Sbjct  828  DEHYEPKIADFGVAKTVEKSHKGPNCSR-IAGTHGYLAPELAYTLKVSEKTDVYSFGVVL  886

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +E+V+G++P+E EYGE  DIV W  T L  ++++L ++D  +  +  ++D IKVL++A+L
Sbjct  887  LEIVTGRRPLEDEYGEGRDIVHWTLTHLSDRKNVLKVLDDKVASDHIEDDMIKVLKVAVL  946

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKL  298
            CTA LP+ RPTMR VV ML DAEPC L
Sbjct  947  CTAKLPSLRPTMREVVSMLSDAEPCTL  973



>gb|KDP31632.1| hypothetical protein JCGZ_14857 [Jatropha curcas]
Length=971

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AK+ + +SS    +  + GTHGYIAPE  YT KV EK+DVYS GVVL
Sbjct  810  DEDYEPKIADFGVAKLAKMSSSKSCDSSCLAGTHGYIAPEMAYTLKVTEKNDVYSLGVVL  869

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++ IE  YGE  DIV WV T L +++++L ++D  I  E  +ED IKVL+IAIL
Sbjct  870  LELVTGRRAIEDAYGEGKDIVYWVWTHLNNRKNVLKVLDEKISSESVQEDMIKVLKIAIL  929

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LPN RPTMR VV+ML DA+PC   S
Sbjct  930  CTTKLPNLRPTMREVVKMLVDADPCSFRS  958



>ref|XP_010943249.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Elaeis 
guineensis]
Length=894

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE F+P++ADFG+AK+LQ     + +  VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  732  DEDFEPKVADFGIAKVLQARGDRESSASVIIGTYGYLAPEYAYSTKATTKCDVYSFGVVL  791

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
            MELV+GKKP E E+GEN DI+ WVS+K+ +KE  +  +D  +   PFKED I++LRIA+ 
Sbjct  792  MELVTGKKPNEPEFGENQDIIHWVSSKMGTKEGAMDAIDKKLSWSPFKEDMIQILRIALR  851

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKL  298
            CT   P  RP+M  VVQ+L + +P K 
Sbjct  852  CTCRSPALRPSMNEVVQLLNEVDPSKF  878



>ref|XP_002521777.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF40587.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=919

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++P+IADFG+AK+++ +    D++ V  GTHGYIAPE  YT KV EKSDVYSFGVVL
Sbjct  765  DEDYEPKIADFGVAKLVEVSYKGCDSSSV-AGTHGYIAPEMAYTLKVTEKSDVYSFGVVL  823

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE  YGE+ DIV WV T L  +E+++ ++D  +  E  + D IKVL+IAIL
Sbjct  824  LELVTGRRPIEEAYGESKDIVYWVWTHLNDRENVIKVLDHEVASESLQGDMIKVLKIAIL  883

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LPN RP MR VV+ML DA+P   VS
Sbjct  884  CTTKLPNLRPNMREVVKMLVDADPYITVS  912



>ref|XP_009111593.1| PREDICTED: receptor-like protein kinase HAIKU2 [Brassica rapa]
Length=970

 Score =   167 bits (424),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGL+KI+Q +S  +D ++ ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  802  DEEWRPRIADFGLSKIIQSDSVQRDVSSSIVEGTLGYIAPEYAYTTKVNEKSDVYSFGVV  861

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP E E+GEN DIVSWV ++     KE ++ ++D  I+  +KEDA+KVL IA
Sbjct  862  LMELVTGKKPTEVEFGENRDIVSWVLSRSKEMEKEKMMELIDPVIEYEYKEDALKVLTIA  921

Query  384  ILCTAALPNSRPTMRRVVQMLE  319
            +LCT   P  RP M+ VV+MLE
Sbjct  922  LLCTGKSPQVRPFMKSVVRMLE  943



>gb|KHN37211.1| Receptor-like protein kinase HSL1-like protein [Glycine soja]
Length=840

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GY+APE+ Y+ +   K DVYSFGV+LMEL
Sbjct  674  YQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEFAYSSRATTKCDVYSFGVILMEL  733

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAILCT  373
            ++GKKP+EAE+GEN +IV WVS K++ KE      ++D  +   FKED +KVLRIAI CT
Sbjct  734  LTGKKPVEAEFGENRNIVFWVSNKVEGKEGARPSEVLDPKLSCSFKEDMVKVLRIAIRCT  793

Query  372  AALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSK  277
               P SRPTM+ VVQ+L +AEP     CKL +  VS 
Sbjct  794  YKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTKDVSN  830



>ref|XP_010943241.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Elaeis 
guineensis]
Length=968

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE F+P++ADFG+AK+LQ     + +  VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  806  DEDFEPKVADFGIAKVLQARGDRESSASVIIGTYGYLAPEYAYSTKATTKCDVYSFGVVL  865

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
            MELV+GKKP E E+GEN DI+ WVS+K+ +KE  +  +D  +   PFKED I++LRIA+ 
Sbjct  866  MELVTGKKPNEPEFGENQDIIHWVSSKMGTKEGAMDAIDKKLSWSPFKEDMIQILRIALR  925

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKL  298
            CT   P  RP+M  VVQ+L + +P K 
Sbjct  926  CTCRSPALRPSMNEVVQLLNEVDPSKF  952



>ref|XP_010268650.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=951

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+L    S   +T VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL
Sbjct  792  YQPKVADFGVAKVLLARGSKDSSTTVIAGTYGYMAPEYAYSSKATVKCDVYSFGVVLMEL  851

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            V+GK+PIEAE+GEN +I+ WVS+K+++K+  + ++D  +   FKE+ I+VLRI+I CT  
Sbjct  852  VTGKQPIEAEFGENKNIIYWVSSKVETKQGAVEVLDKRLLGLFKEEMIQVLRISIRCTCK  911

Query  366  LPNSRPTMRRVVQMLEDAEPCK  301
             P+ RPTM  VVQ+L +A+PC+
Sbjct  912  APSLRPTMNEVVQLLVEADPCR  933



>gb|EPS67674.1| hypothetical protein M569_07098, partial [Genlisea aurea]
Length=878

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  + P++ADFG+AKI+Q   S +D TT  I GT+GY+APEY YT K   K DVYSFGVV
Sbjct  735  DLNYHPKVADFGIAKIMQCRESSRDSTTTAIAGTYGYLAPEYAYTSKATTKCDVYSFGVV  794

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMELV+GKKP+E E+GEN DIV WVS+ L++KE  + +VD  +Q  + ++ I+VLR+A+L
Sbjct  795  LMELVTGKKPVETEFGENKDIVYWVSSNLETKEEAIKLVDKRVQSSYHDEMIEVLRLAML  854

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT    ++RPTM  VV++L + +P
Sbjct  855  CTCKAASTRPTMNDVVRLLLEGDP  878



>ref|XP_008352752.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=963

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 105/144 (73%), Gaps = 0/144 (0%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            +P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL+
Sbjct  798  QPKVADFGIAKVLQARXGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMELI  857

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAAL  364
            +GKKP+EAE+G+N +I+ WVS K+ +KE    ++D    + FKE+ I+VLRIA+ CT   
Sbjct  858  TGKKPVEAEFGDNKNIIYWVSNKVDTKEGATEVLDKRSSDSFKEEMIQVLRIAVRCTYKA  917

Query  363  PNSRPTMRRVVQMLEDAEPCKLVS  292
            P+ RP+M+  VQ+L +A+PC+  S
Sbjct  918  PSLRPSMKEXVQLLIEADPCRFDS  941



>ref|XP_003526517.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=963

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 110/157 (70%), Gaps = 7/157 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GY+APE+ Y+ +   K DVYSFGV+LMEL
Sbjct  797  YQPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEFAYSSRATTKCDVYSFGVILMEL  856

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAILCT  373
            ++GKKP+EAE+GEN +IV WVS K++ KE      ++D  +   FKED +KVLRIAI CT
Sbjct  857  LTGKKPVEAEFGENRNIVFWVSNKVEGKEGARPSEVLDPKLSCSFKEDMVKVLRIAIRCT  916

Query  372  AALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSK  277
               P SRPTM+ VVQ+L +AEP     CKL +  VS 
Sbjct  917  YKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTKDVSN  953



>ref|XP_006406469.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
 gb|ESQ47922.1| hypothetical protein EUTSA_v10022054mg [Eutrema salsugineum]
Length=994

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAPE  YT  V EKSDVYSFGVV
Sbjct  825  DEEWRPRIADFGLAKIIQPDSVQQDFSAPLVKGTLGYIAPECAYTTNVSEKSDVYSFGVV  884

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+EAE+GEN DIV WV ++ K  ++E ++ +VD  I++ +K+DA++VL IA
Sbjct  885  LMELVTGKKPVEAEFGENRDIVMWVWSRSKEMNRERMMELVDPIIEDEYKKDALRVLTIA  944

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
            ++CT   P  RP M+ VV MLE  EP
Sbjct  945  LICTNKSPQVRPFMKSVVSMLEKTEP  970



>gb|ABF73316.1| clavata-like receptor [Picea glauca]
Length=998

 Score =   166 bits (421),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 71/143 (50%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE +   +ADFG+AKILQ  +   D+   I G++GYIAPEY YT KV EKSD+YSFGVV+
Sbjct  830  DEDYVAHVADFGVAKILQSCARGADSMSAIAGSYGYIAPEYAYTLKVNEKSDIYSFGVVI  889

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+G++P++ E+GEN D+V W+  K++ K  +  ++D  + + FKE+   V+R+ +LC
Sbjct  890  LELVTGRRPVDPEFGENKDLVKWLCNKIEKKNGLHEVLDPKLVDCFKEEMTMVMRVGLLC  949

Query  375  TAALPNSRPTMRRVVQMLEDAEP  307
            T+ LP +RP+MRRVV+ML++A P
Sbjct  950  TSVLPINRPSMRRVVEMLQEANP  972



>ref|XP_009362411.1| PREDICTED: receptor-like protein kinase HSL1 [Pyrus x bretschneideri]
Length=986

 Score =   166 bits (421),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +    GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  817  DDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE +YGE  DIV WVST L  +E+++ ++D  +  E  ++D IKVL++A+L
Sbjct  876  LELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVKILDEKVADESVQDDMIKVLKVAVL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML DA+PC   S
Sbjct  936  CTTKLPSLRPTMREVIKMLADADPCSFRS  964



>ref|XP_007137285.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
 gb|ESW09279.1| hypothetical protein PHAVU_009G114400g [Phaseolus vulgaris]
Length=959

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 109/157 (69%), Gaps = 7/157 (4%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++PR+ADFG+AK+LQ       TT VI GT+GY+APE+ Y+ +   K DVYSFGV+LMEL
Sbjct  793  YQPRVADFGIAKVLQARGVKDSTTTVIAGTYGYLAPEFAYSSRATTKCDVYSFGVILMEL  852

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAILCT  373
            ++GKKP+EAE+GEN +IV WVS K++ KE      + D  +   FK+D IKVLR+AI CT
Sbjct  853  LTGKKPVEAEFGENRNIVFWVSNKVEGKEGARPSEVFDPRLSCSFKDDMIKVLRVAIRCT  912

Query  372  AALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSK  277
               P SRPTM+ VVQ+L +AEP     CKL +  VS 
Sbjct  913  YKAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTKDVSN  949



>gb|KHN08203.1| Receptor-like protein kinase HSL1-like protein [Glycine soja]
Length=840

 Score =   165 bits (417),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            +P++ADFG+AK+LQ       TT VI GT+GY+APE+ Y+ +   K DVYS+GV+LMEL+
Sbjct  675  QPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEFAYSSRATTKCDVYSYGVILMELL  734

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAILCTA  370
            +GKKP+EAE+GEN +IV WVS K++ KE      ++D  +   FKED IKVLRIAI CT 
Sbjct  735  TGKKPVEAEFGENRNIVFWVSNKVEGKEGARPSEVLDPKLSCSFKEDMIKVLRIAIRCTY  794

Query  369  ALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSK  277
              P SRPTM+ VVQ+L +AEP     CKL +  VS 
Sbjct  795  KAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTNDVSN  830



>ref|XP_008787759.1| PREDICTED: receptor-like protein kinase HSL1 [Phoenix dactylifera]
Length=952

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE F+P++ADFG+AK+LQ     + +  VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  790  DEDFEPKVADFGVAKVLQARGDHESSATVITGTYGYLAPEYAYSTKATTKCDVYSFGVVL  849

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
            MELV+GKKP E E+GEN DI+ WVS+K+ +KE  +  +D  +   PFKE+ I+VLRIA+ 
Sbjct  850  MELVTGKKPNEPEFGENQDIIHWVSSKMGTKERAMDAIDKQLSWSPFKEEMIQVLRIALR  909

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKL  298
            CT   P  RP+M  VVQ+L + +P K 
Sbjct  910  CTLRTPALRPSMNEVVQLLLEVDPSKF  936



>ref|XP_011096686.1| PREDICTED: receptor-like protein kinase HAIKU2 [Sesamum indicum]
Length=989

 Score =   166 bits (419),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +IADFG+AK+    S          GTHGYIAPE  Y+ KV EKSDVYSFGVVL
Sbjct  829  DEDYEAKIADFGVAKVADQVSPGGSELSCFAGTHGYIAPEMAYSIKVTEKSDVYSFGVVL  888

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+GKKPIE +YGE  D+V WVST L ++E++  ++D  +  E  ++D IKVL+IA L
Sbjct  889  LELVTGKKPIEEDYGEGKDLVYWVSTHLNNRENVQKILDHKVATELVQDDMIKVLKIATL  948

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT+ LPN RP+M+ VV+ML DAEPC   S
Sbjct  949  CTSKLPNLRPSMKEVVKMLIDAEPCSFRS  977



>ref|XP_004501072.1| PREDICTED: receptor-like protein kinase HSL1-like [Cicer arietinum]
Length=966

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 108/154 (70%), Gaps = 7/154 (5%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE + P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ +   K DVYSFGV+L
Sbjct  795  DEDYHPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSRATTKCDVYSFGVIL  854

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAI  382
            MEL++G+KPIE+E+GEN +IV WVS K++ KE      + D  +   FK+D +K+LRIAI
Sbjct  855  MELLTGRKPIESEFGENRNIVFWVSNKVEGKEGARPSEVFDPKLSCSFKDDMVKLLRIAI  914

Query  381  LCTAALPNSRPTMRRVVQMLEDAEP-----CKLV  295
             CT   P SRPTM+ VVQ+L +AEP     CKL+
Sbjct  915  RCTYKAPASRPTMKEVVQLLIEAEPKSSDSCKLL  948



>ref|XP_006852742.1| hypothetical protein AMTR_s00033p00105380 [Amborella trichopoda]
 gb|ERN14209.1| hypothetical protein AMTR_s00033p00105380 [Amborella trichopoda]
Length=960

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 114/164 (70%), Gaps = 2/164 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  F+P++ADFG+AK+LQ   S    TT  I GT+GY+APEY Y+ K   K DVYS+GV+
Sbjct  798  DADFQPKVADFGVAKVLQSRGSGDSITTTAIAGTYGYLAPEYAYSSKATTKCDVYSYGVL  857

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+EAE+GEN +IV W+S K+ +KE    ++D  + E F +D +K LRI++L
Sbjct  858  LMELITGKKPVEAEFGENKNIVYWISKKVATKEGTKDVLDKQLAELFTDDMVKALRISVL  917

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSD  247
            CT  +P  RP M  VVQML +A+P +  +   S +A K+ +PS+
Sbjct  918  CTNNMPAYRPKMNEVVQMLIEADPARGFNAFKS-EAIKVKSPSE  960



>ref|XP_003523762.1| PREDICTED: receptor-like protein kinase HSL1-like [Glycine max]
Length=966

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 7/156 (4%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            +P++ADFG+AK+LQ       TT VI GT+GY+APE+ Y+ +   K DVYS+GV+LMEL+
Sbjct  801  QPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEFAYSSRATTKCDVYSYGVILMELL  860

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAILCTA  370
            +GKKP+EAE+GEN +IV WVS K++ KE      ++D  +   FKED IKVLRIAI CT 
Sbjct  861  TGKKPVEAEFGENRNIVFWVSNKVEGKEGARPSEVLDPKLSCSFKEDMIKVLRIAIRCTY  920

Query  369  ALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSK  277
              P SRPTM+ VVQ+L +AEP     CKL +  VS 
Sbjct  921  KAPTSRPTMKEVVQLLIEAEPRGSDSCKLSTNDVSN  956



>ref|XP_008339164.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +    GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  817  DDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE-PFKEDAIKVLRIAIL  379
            +ELV+G++PIE +YGE  DIV WVST L  +E+++ ++D  + +   ++D IKVL++A+L
Sbjct  876  LELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVKILDEKVADVSVQDDMIKVLKVAVL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML DA+PC   S
Sbjct  936  CTTKLPSLRPTMREVIKMLADADPCSFRS  964



>ref|XP_008361619.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=986

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +    GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  817  DDDYEAKVADFGVAKIAENSQKGSDYSS-FAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE-PFKEDAIKVLRIAIL  379
            +ELV+G++PIE +YGE  DIV WVST L  +E+++ ++D  + +   ++D IKVL++A+L
Sbjct  876  LELVTGRRPIEEDYGEGKDIVYWVSTHLSDREAVVKILDEKVADVSVQDDMIKVLKVAVL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML DA+PC   S
Sbjct  936  CTTKLPSLRPTMREVIKMLADADPCSFRS  964



>ref|XP_006664773.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
HAIKU2-like [Oryza brachyantha]
Length=883

 Score =   164 bits (416),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 84/153 (55%), Positives = 111/153 (73%), Gaps = 12/153 (8%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPRIADFGLAKIL   ++   T  V+ GT GY+APEY YT KV EKSDVYSFGVVL
Sbjct  713  DESFKPRIADFGLAKILDGAATADTTPGVVAGTLGYMAPEYAYTWKVTEKSDVYSFGVVL  772

Query  555  MELVSGKKPIEAEY-GENNDIVS----------WVSTKLKSKESILSMVDSAIQEPF-KE  412
            +ELV+G+ PI AE  GE+ DIV           WV+ +L S++ ++S++D+ I E + +E
Sbjct  773  LELVTGRTPIMAERGGESIDIVDWVARRLDVGGWVARRLDSRDKVVSLLDAGIGEEWARE  832

Query  411  DAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA  313
            +A++VLR+A+LCT+  P+ RP+MR VVQMLE A
Sbjct  833  EAVRVLRVAVLCTSRTPSMRPSMRSVVQMLEAA  865



>ref|XP_010489950.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=987

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 110/145 (76%), Gaps = 3/145 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAPEY YT+ V EKSDVYSFGVV
Sbjct  825  DEEWRPRIADFGLAKIIQPDSVQQDFSAPLVKGTLGYIAPEYAYTRSVSEKSDVYSFGVV  884

Query  558  LMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            L+ELV+GKKP+E E+GEN+DIV WV   +K  ++E +  ++D +I+  +KEDA+KVL IA
Sbjct  885  LLELVTGKKPVEIEFGENSDIVMWVWRMSKEMNREMMTELIDPSIEVEYKEDALKVLTIA  944

Query  384  ILCTAALPNSRPTMRRVVQMLEDAE  310
            +LCT   P +RP M+ VV MLE  E
Sbjct  945  LLCTNKSPQARPFMKSVVSMLEKIE  969



>emb|CDX95422.1| BnaC01g33140D [Brassica napus]
Length=970

 Score =   164 bits (416),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S  +D ++ ++ GT GYIAPEY YT KV EKSDVYSFGVV
Sbjct  802  DEEWRPRIADFGLAKIIQPDSVQRDVSSSIVEGTLGYIAPEYAYTTKVNEKSDVYSFGVV  861

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTK--LKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            LMELV+GKKP+E E+GEN DIVSWV ++     KE ++ ++D  I+  +KEDA+KVL I 
Sbjct  862  LMELVTGKKPMEVEFGENRDIVSWVLSRSKEMEKEKMMELIDPVIEYEYKEDALKVLTIG  921

Query  384  ILCTAALPNSRPTMRRVVQMLE  319
            +LCT   P  RP M+ VV+MLE
Sbjct  922  LLCTGKSPQVRPFMKSVVRMLE  943



>ref|XP_008378674.1| PREDICTED: receptor-like protein kinase HSL1 [Malus domestica]
Length=964

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -3

Query  723  KPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELV  544
            + ++ADFG+AK+LQ +     TT VI GT+GY+APEY Y+ K   K DVYSFGVVLMEL+
Sbjct  799  QAKVADFGIAKVLQASGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVLMELI  858

Query  543  SGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAAL  364
            +GK+P+EAE+G+N +I+ WVS K+ +KE  + ++D  + +  +E+ I+VLRIA+ CT   
Sbjct  859  TGKRPVEAEFGDNKNIIYWVSNKVDTKEGAMEVLDKRLSDSXQEEMIQVLRIAVXCTYKA  918

Query  363  PNSRPTMRRVVQMLEDAEPCKLVS  292
            P+ RP+M+ VVQ+L +A+PC+  S
Sbjct  919  PSLRPSMKEVVQLLIEADPCRFDS  942



>gb|KFK40815.1| hypothetical protein AALP_AA2G044900 [Arabis alpina]
Length=959

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  S  KD TT VI GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  790  DVNYQPKVADFGIAKVLQARS--KDSTTTVIAGTYGYLAPEYAYSSKATIKCDVYSFGVV  847

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP++A +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI 
Sbjct  848  LMELITGKKPVDACFGENKNIVNWVSTKIDTKEGLIETLDKRLTESSKADMINALRVAIR  907

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  908  CTSRTPTIRPTMNEVVQLLIDAAP  931



>gb|EAY84008.1| hypothetical protein OsI_39239 [Oryza sativa Indica Group]
Length=992

 Score =   164 bits (415),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 88/155 (57%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            DE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+APEY YT KV EKSDVYSFGV
Sbjct  831  DESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAPEYSYTWKVTEKSDVYSFGV  890

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLRIA  385
            VL+ELV+G+  I AEYGE+ DIV WVS +L S++ ++S++D++I E + KE+A++VLR+A
Sbjct  891  VLLELVTGRTAIMAEYGESRDIVEWVSRRLDSRDKVMSLLDASIGEEWEKEEAVRVLRVA  950

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  951  VVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  985



>ref|NP_001067347.2| Os12g0632800 [Oryza sativa Japonica Group]
 gb|ABA99940.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30366.2| Os12g0632800 [Oryza sativa Japonica Group]
Length=1007

 Score =   164 bits (415),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 88/155 (57%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            DE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+APEY YT KV EKSDVYSFGV
Sbjct  846  DESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAPEYSYTWKVTEKSDVYSFGV  905

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLRIA  385
            VL+ELV+G+  I AEYGE+ DIV WVS +L S++ ++S++D++I E + KE+A++VLR+A
Sbjct  906  VLLELVTGRTAIMAEYGESRDIVEWVSRRLDSRDKVMSLLDASIGEEWEKEEAVRVLRVA  965

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  966  VVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  1000



>ref|XP_002442601.1| hypothetical protein SORBIDRAFT_08g022780 [Sorghum bicolor]
 gb|EES16439.1| hypothetical protein SORBIDRAFT_08g022780 [Sorghum bicolor]
Length=1002

 Score =   163 bits (413),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 81/144 (56%), Positives = 108/144 (75%), Gaps = 8/144 (6%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE FKPR+ADFGLAKIL    +   +  V+ GT GY+APEY YT KV EKSDVYSFGVVL
Sbjct  841  DECFKPRLADFGLAKIL--GGAGDSSAGVVAGTLGYMAPEYAYTWKVTEKSDVYSFGVVL  898

Query  555  MELVSGKKPI-----EAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVL  394
            +ELV+G+  +     E E GE+ D+V WVS +L+S+E ++S+VD AI E + +E+A++VL
Sbjct  899  LELVTGRPAVVVVQGEGEGGESRDLVDWVSRRLESREKVMSLVDPAIVEGWAREEAVRVL  958

Query  393  RIAILCTAALPNSRPTMRRVVQML  322
            R+A+LCT+  P+ RP+MR VVQML
Sbjct  959  RVAVLCTSRTPSMRPSMRSVVQML  982



>ref|XP_002966807.1| hypothetical protein SELMODRAFT_168561 [Selaginella moellendorffii]
 gb|EFJ31406.1| hypothetical protein SELMODRAFT_168561 [Selaginella moellendorffii]
Length=992

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D   +P +ADFGLA+I+Q + +    T  I GT+GYIAPEY YT KV EKSD+YSFGVVL
Sbjct  841  DAELEPHVADFGLARIIQQHGNGVSMTS-IAGTYGYIAPEYAYTLKVTEKSDIYSFGVVL  899

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+GK+PIEAE+G+  DIV WV  K++++ S+  + DS I   F ED + +LR+ +LC
Sbjct  900  LELVTGKRPIEAEFGDGVDIVRWVCDKIQARNSLAEIFDSRIPSYFHEDMMLMLRVGLLC  959

Query  375  TAALPNSRPTMRRVVQMLEDAEP  307
            T+ALP  RP M+ VVQML +A P
Sbjct  960  TSALPVQRPGMKEVVQMLVEARP  982



>ref|XP_007225361.1| hypothetical protein PRUPE_ppa000880mg [Prunus persica]
 gb|EMJ26560.1| hypothetical protein PRUPE_ppa000880mg [Prunus persica]
Length=972

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AKI + +    D +  + GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  797  DNDYEPKVADFGVAKIAENSQKGSDYSS-LAGTHGYIAPELAYTPKVTEKCDVYSFGVVL  855

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE +YGE  DIV WVST L  +E+++ ++D  +  E   +D IKVL++A+L
Sbjct  856  LELVTGRRPIEEDYGEGKDIVYWVSTNLSDRENVVKILDDKVANESVLDDMIKVLKVAVL  915

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LP+ RPTMR V++ML DA+P
Sbjct  916  CTTKLPSLRPTMRDVIKMLTDADP  939



>gb|EEE52987.1| hypothetical protein OsJ_35661 [Oryza sativa Japonica Group]
Length=734

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            DE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+APEY YT KV EKSDVYSFGV
Sbjct  573  DESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAPEYAYTWKVTEKSDVYSFGV  632

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLRIA  385
            VL+ELV+G+  I AEYGE  DIV WV  +L S++ ++S++D++I E + KE+A++VLR+A
Sbjct  633  VLLELVTGRTAIMAEYGEGRDIVEWVFRRLDSRDKVMSLLDASIAEEWEKEEAVRVLRVA  692

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++CT+  P+ RP+MR VVQMLE A   + ++++ S
Sbjct  693  VVCTSRTPSMRPSMRSVVQMLEAAGIGRELAMVTS  727



>ref|XP_008218929.1| PREDICTED: receptor-like protein kinase HAIKU2 [Prunus mume]
Length=985

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D   +P++ADFG+AKI + +    D +  + GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  819  DNDHEPKVADFGVAKIAENSQKGSDYSS-LAGTHGYIAPELAYTPKVTEKCDVYSFGVVL  877

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++PIE +YGE  DIV WVST L  +E+++ ++D  +  E  ++D IKVL++A+L
Sbjct  878  LELVTGRRPIEEDYGEGKDIVYWVSTNLSDRENVVKILDDRVANESVQDDMIKVLKVAVL  937

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR +++ML DA+P    S
Sbjct  938  CTTKLPSLRPTMRDIIKMLTDADPSTFRS  966



>gb|KHG27129.1| Receptor-like protein kinase HAIKU2 [Gossypium arboreum]
Length=977

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++P+IADFG+AKI + +    + +    GTHGYIAPE  YT KV EKSDVYSFGVVL
Sbjct  817  DDNYEPKIADFGVAKIAEKSLEGSEYSS-FAGTHGYIAPELAYTLKVTEKSDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ-EPFKEDAIKVLRIAIL  379
            +ELV+GK  IE EYGE  DIV WV T L   E+++ ++D  +  E  ++D IKVL+I IL
Sbjct  876  LELVTGKASIEEEYGEGKDIVYWVLTHLGDGENVVKVLDDRVAVETVQDDMIKVLKIGIL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            C A LPN RPTMR VV ML DAE C  +S  +  D
Sbjct  936  CAAKLPNLRPTMREVVNMLMDAETCTSISADIKSD  970



>gb|KEH36108.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=965

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE + P++ADFG+AK+LQ   +   TT VI GT+GY+APEY Y+ +   K DVYSFGV+L
Sbjct  795  DEDYHPKVADFGIAKVLQARGAKDSTTTVIAGTYGYLAPEYAYSPRATTKCDVYSFGVIL  854

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL--SMVDSAIQEPFKEDAIKVLRIAI  382
            +EL++G+KPIE+E+GEN +IV WV+ K++ KE      + D  +   FK+D +KVLRIAI
Sbjct  855  LELLTGRKPIESEFGENRNIVFWVANKVEGKEGARPSEVFDPKLSCSFKDDMVKVLRIAI  914

Query  381  LCTAALPNSRPTMRRVVQMLEDAEP-----CKLVSIIVSKDAA  268
             C+   P SRPTM+ VVQ+L +AEP     CKL +  VS +  
Sbjct  915  RCSYKAPASRPTMKEVVQLLIEAEPRKSDSCKLSTKDVSTNVT  957



>ref|XP_010468302.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=985

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 110/145 (76%), Gaps = 3/145 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAK +Q +   +D +  ++ GT GYIAPEY YT+ V EKSDVYSFGVV
Sbjct  823  DEEWRPRIADFGLAKFIQPDLVQQDFSAPLVKGTLGYIAPEYAYTRNVNEKSDVYSFGVV  882

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLK--SKESILSMVDSAIQEPFKEDAIKVLRIA  385
            L+ELV+GKKP+E E+GEN+DIV WV  K K  ++E ++ ++D +I+  +KEDA+KVL IA
Sbjct  883  LLELVTGKKPVEIEFGENSDIVMWVRRKSKKMNREMMMELMDPSIEVEYKEDALKVLTIA  942

Query  384  ILCTAALPNSRPTMRRVVQMLEDAE  310
            ++CT   P++RP M+ VV MLE  E
Sbjct  943  LICTDKSPHARPFMKSVVSMLEKIE  967



>ref|XP_006858563.1| hypothetical protein AMTR_s00071p00174710 [Amborella trichopoda]
 gb|ERN20030.1| hypothetical protein AMTR_s00071p00174710 [Amborella trichopoda]
Length=913

 Score =   162 bits (410),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 77/159 (48%), Positives = 110/159 (69%), Gaps = 5/159 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE  + +I DFG+A+++   S   + +    GTHGYIAPE  Y+ K  EKSDVYSFGV+L
Sbjct  758  DEALEAKIGDFGIARVV---SEGGEASSGFVGTHGYIAPELAYSMKATEKSDVYSFGVIL  814

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            +ELV+GK+P+E E+ E  DIV WV + L ++E+  S++D+ + + ++ED +KVL++A LC
Sbjct  815  LELVTGKRPLEPEFQEGKDIVDWVCSHLATRETACSILDTRVSDYYEEDMLKVLKMATLC  874

Query  375  TAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLD  259
            T  LP  RP+MR VV+ML DAEPC  VS I  K + + D
Sbjct  875  TTKLPTLRPSMREVVKMLVDAEPC--VSGIKDKLSERFD  911



>ref|XP_004309904.1| PREDICTED: receptor-like protein kinase HSL1 [Fragaria vesca 
subsp. vesca]
Length=982

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI+Q N+          GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  817  DDDYEAKVADFGVAKIVQ-NTHKGSEYSSFAGTHGYIAPELAYTAKVTEKCDVYSFGVVL  875

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+GK+PIE +YGE  DIV W S  L  +E +L ++D  +  E  ++D IKVL++AIL
Sbjct  876  LELVTGKRPIEDDYGEGKDIVYWASANLNDREHVLKVLDDKVADENIQDDMIKVLKVAIL  935

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML DA+P    S
Sbjct  936  CTTKLPSLRPTMREVIKMLTDADPSTFTS  964



>ref|XP_008456679.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
 ref|XP_008456680.1| PREDICTED: receptor-like protein kinase HAIKU2 [Cucumis melo]
Length=976

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 109/145 (75%), Gaps = 4/145 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P+IADFG+AK+  Q+ S+ + ++  + GTHGYIAPE  YT KV EKSDVYS+GVV
Sbjct  815  DGDYEPKIADFGVAKVADQFQSASEHSS--LAGTHGYIAPELAYTPKVSEKSDVYSYGVV  872

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAI  382
            L+EL++G++PIE EYGE  DIV W+ST L  +++ L ++D  +  E  + D IKVL+IA+
Sbjct  873  LLELITGRRPIEDEYGEGKDIVYWISTHLDDRDNALKLLDIRVASEAIQNDMIKVLKIAV  932

Query  381  LCTAALPNSRPTMRRVVQMLEDAEP  307
            LCT  LP+ RP+MR VV+ML DA+P
Sbjct  933  LCTTKLPSLRPSMREVVKMLSDADP  957



>ref|NP_199777.1| receptor like kinase [Arabidopsis thaliana]
 dbj|BAB10911.1| receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59387.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED95842.1| receptor like kinase [Arabidopsis thaliana]
Length=966

 Score =   162 bits (410),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT V+ GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  797  DVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVVL  855

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI C
Sbjct  856  MELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKADMINALRVAIRC  915

Query  375  TAALPNSRPTMRRVVQMLEDAEP  307
            T+  P  RPTM  VVQ+L DA P
Sbjct  916  TSRTPTIRPTMNEVVQLLIDATP  938



>ref|XP_006402253.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
 gb|ESQ43706.1| hypothetical protein EUTSA_v10012576mg [Eutrema salsugineum]
Length=976

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  798  DINYQPKVADFGIAKVLQ--ARGKDSTTTVIAGTYGYLAPEYAYSSKATIKCDVYSFGVV  855

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  VD  + E  K D I  LR+AI 
Sbjct  856  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETVDKRLSESSKADIINALRVAIR  915

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  916  CTSRTPTIRPTMTEVVQLLIDAAP  939



>dbj|BAC42540.1| putative receptor protein kinase [Arabidopsis thaliana]
Length=966

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 75/143 (52%), Positives = 102/143 (71%), Gaps = 1/143 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT V+ GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  797  DVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVVL  855

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI C
Sbjct  856  MELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKADMINALRVAIRC  915

Query  375  TAALPNSRPTMRRVVQMLEDAEP  307
            T+  P  RPTM  VVQ+L DA P
Sbjct  916  TSRTPTIRPTMNEVVQLLIDATP  938



>ref|XP_010420074.1| PREDICTED: receptor-like protein kinase HAIKU2 [Camelina sativa]
Length=988

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 3/145 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAPEY YT+ V EKSDV+SFGVV
Sbjct  826  DEKWRPRIADFGLAKIIQPDSVQRDFSAPLVKGTLGYIAPEYAYTRSVSEKSDVFSFGVV  885

Query  558  LMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESILSMVDSAIQEPFKEDAIKVLRIA  385
            L+ELV+GKKP+E E+GEN DIV WV   +K  ++E +  ++D +I+  +KEDA+KVL IA
Sbjct  886  LLELVTGKKPVEIEFGENIDIVMWVWRMSKEMNREMMAELIDPSIEVEYKEDALKVLTIA  945

Query  384  ILCTAALPNSRPTMRRVVQMLEDAE  310
            +LCT   P +RP M+ VV MLE  E
Sbjct  946  LLCTNKSPQARPFMKSVVSMLEKIE  970



>ref|XP_010271555.1| PREDICTED: receptor-like protein kinase HSL1 [Nelumbo nucifera]
Length=952

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 0/145 (0%)
 Frame = -3

Query  726  FKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMEL  547
            ++P++ADFG+AK+LQ       TT VI GT+GYIAPEY Y+ K   K DVYSFGVVLMEL
Sbjct  794  YQPKVADFGVAKVLQARGGKDSTTTVIAGTYGYIAPEYAYSSKATVKCDVYSFGVVLMEL  853

Query  546  VSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTAA  367
            ++GKKP+E E+GE+ +I+ WVS K+++KE  + ++D  +   F E+ I+VLRIAI CT  
Sbjct  854  ITGKKPVEPEFGESKNIIYWVSCKVETKEGAMEVLDKRLVGLFMEEMIQVLRIAIRCTCR  913

Query  366  LPNSRPTMRRVVQMLEDAEPCKLVS  292
            +P  RPTM  VVQ+L +A+P +  S
Sbjct  914  VPALRPTMNEVVQLLIEADPYRFDS  938



>ref|XP_002301126.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
 gb|EEE80399.1| hypothetical protein POPTR_0002s11230g [Populus trichocarpa]
Length=925

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  756  DANYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  815

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA+YGE+ +I++ VSTK+ +KE ++ ++D  +   F+++ I+VLRIAI C
Sbjct  816  MELITGKKPVEADYGESKNIINLVSTKVDTKEGVMEVLDKRLSGSFRDEMIQVLRIAIRC  875

Query  375  TAALPNSRPTMRRVVQMLEDA  313
            T   P  RPTM  VVQ+L +A
Sbjct  876  TYKTPALRPTMNEVVQLLIEA  896



>ref|XP_009123552.1| PREDICTED: receptor-like protein kinase HSL1 [Brassica rapa]
Length=966

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 115/168 (68%), Gaps = 8/168 (5%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APEY Y+ K   K DVYSFGV+
Sbjct  797  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVM  854

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI 
Sbjct  855  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKADMINALRVAIR  914

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS-----KDAAKLDNPS  250
            CT+  P  RP+M  VVQ+L DA P + + +        KDA   DNP+
Sbjct  915  CTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTKIKDAILSDNPT  962



>gb|KJB64049.1| hypothetical protein B456_010G030500 [Gossypium raimondii]
Length=951

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 105/144 (73%), Gaps = 5/144 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+L+       T+ +I GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  786  DINYQPKVADFGIAKVLK-----DSTSTIIAGTYGYLAPEYAYSNKATTKCDVYSFGVVL  840

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP++A++GE  +IV WV+TKL +KE ++ ++D  +   FK++ I+VLRIA+ C
Sbjct  841  MELITGKKPVDADFGEYKNIVYWVTTKLDTKEGVMEVIDKNLLGSFKDEMIQVLRIAMCC  900

Query  375  TAALPNSRPTMRRVVQMLEDAEPC  304
            T   P+ RPTM  VVQ+L   +PC
Sbjct  901  TCKNPSQRPTMNEVVQLLIQTDPC  924



>ref|XP_004159444.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
Length=976

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P+IADFG+AK+  Q+ S+ + ++  + GTHGYIAPE  YT KV EKSDVYS+GVV
Sbjct  815  DGDYEPKIADFGVAKVADQFQSASEHSS--LAGTHGYIAPELAYTPKVSEKSDVYSYGVV  872

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAI  382
            L+EL++G++PIE EYGE  DIV W+ST L  ++  L ++D  +  E  + D IKVL+IA+
Sbjct  873  LLELITGRRPIEDEYGEGKDIVYWISTHLDDRDHALKLLDIRVASEAIQNDMIKVLKIAV  932

Query  381  LCTAALPNSRPTMRRVVQMLEDAEP  307
            LCT  LP+ RP+MR VV+ML DA+P
Sbjct  933  LCTTKLPSLRPSMREVVKMLSDADP  957



>ref|XP_004140933.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Cucumis sativus]
 gb|KGN46082.1| hypothetical protein Csa_6G052080 [Cucumis sativus]
Length=976

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 108/145 (74%), Gaps = 4/145 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P+IADFG+AK+  Q+ S+ + ++  + GTHGYIAPE  YT KV EKSDVYS+GVV
Sbjct  815  DGDYEPKIADFGVAKVADQFQSASEHSS--LAGTHGYIAPELAYTPKVSEKSDVYSYGVV  872

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAI  382
            L+EL++G++PIE EYGE  DIV W+ST L  ++  L ++D  +  E  + D IKVL+IA+
Sbjct  873  LLELITGRRPIEDEYGEGKDIVYWISTHLDDRDHALKLLDIRVASEAIQNDMIKVLKIAV  932

Query  381  LCTAALPNSRPTMRRVVQMLEDAEP  307
            LCT  LP+ RP+MR VV+ML DA+P
Sbjct  933  LCTTKLPSLRPSMREVVKMLSDADP  957



>ref|XP_002865749.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42008.1| hypothetical protein ARALYDRAFT_495025 [Arabidopsis lyrata subsp. 
lyrata]
Length=964

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 106/144 (74%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  795  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  852

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D ++ E  K D I  LR+AI 
Sbjct  853  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKSLSESSKADMINALRVAIR  912

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  913  CTSRTPTIRPTMNEVVQLLIDAAP  936



>gb|EYU22821.1| hypothetical protein MIMGU_mgv1a000956mg [Erythranthe guttata]
Length=934

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +IADFG+AK+    S          GTHGYIAPE  Y+ K+ EKSDVYSFGVVL
Sbjct  772  DEDYEAKIADFGVAKMADQVSPRGSEFSSFAGTHGYIAPEMAYSLKITEKSDVYSFGVVL  831

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+GK+P+E  YGE  DIV WVST L  +E+++ ++D   + +  ++D IKVL+IA L
Sbjct  832  LELVTGKRPVEDGYGEGKDIVYWVSTHLNERENVIKVLDQKVVTDLIRDDMIKVLKIATL  891

Query  378  CTAALPNSRPTMRRVVQMLEDAEPC  304
            C A LPN RP+M+ VV+ML DAEPC
Sbjct  892  CAAKLPNLRPSMKEVVKMLVDAEPC  916



>ref|XP_008357591.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
 ref|XP_008357592.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=990

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +  + GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  816  DDDYEAKVADFGVAKIAESSQKGCDYSS-LAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++P+E +YGE  DIV WVST L  +E+++ ++D  +  E  ++D IKVL++A+L
Sbjct  875  LELVTGRRPVEEDYGEGKDIVYWVSTHLSDREAVVKILDDKVAHECVEDDMIKVLKVAVL  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML  A+PC   S
Sbjct  935  CTTKLPSLRPTMRDVIKMLTAADPCTFRS  963



>ref|XP_008378748.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
 ref|XP_008378749.1| PREDICTED: receptor-like protein kinase HAIKU2 [Malus domestica]
Length=990

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +  + GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  816  DDDYEAKVADFGVAKIAESSQKGCDYSS-LAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++P+E +YGE  DIV WVST L  +E+++ ++D  +  E  ++D IKVL++A+L
Sbjct  875  LELVTGRRPVEEDYGEGKDIVYWVSTHLSDREAVVKILDDKVAHECVEDDMIKVLKVAVL  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML  A+PC   S
Sbjct  935  CTTKLPSLRPTMRDVIKMLTAADPCTFRS  963



>gb|EAZ21323.1| hypothetical protein OsJ_36977 [Oryza sativa Japonica Group]
Length=1006

 Score =   161 bits (407),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 87/155 (56%), Positives = 117/155 (75%), Gaps = 3/155 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            DE FKPRIADFGLAKIL   ++  DTT   V+ GT GY+APEY YT KV EKSDVYSFGV
Sbjct  845  DESFKPRIADFGLAKILDGAAATPDTTSAGVVAGTLGYMAPEYSYTWKVTEKSDVYSFGV  904

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLRIA  385
            VL+ELV+G+  I AEYGE  DIV WV  +L S++ ++S++D++I E + KE+A++VLR+A
Sbjct  905  VLLELVTGRTAIMAEYGEGRDIVEWVFRRLDSRDKVMSLLDASIGEEWEKEEAVRVLRVA  964

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS  280
            ++CT+  P+ RP+MR VVQMLE A   +  +++ S
Sbjct  965  VVCTSRTPSMRPSMRSVVQMLEAAAIGREFAVVTS  999



>ref|XP_007131311.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 ref|XP_007131312.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 gb|ESW03305.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
 gb|ESW03306.1| hypothetical protein PHAVU_011G003200g [Phaseolus vulgaris]
Length=974

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 11/153 (7%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYS  571
            DE ++P+IADFG+A+       Q   SC      + GT GYIAPE  Y   + EKSDVYS
Sbjct  815  DEDYEPKIADFGIARFAEKSDKQLGYSC------LAGTLGYIAPELAYATDITEKSDVYS  868

Query  570  FGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLR  391
            FGVVL+ELVSG++PIE +YGE  DIV WV T L  +ESIL+++D  +     ED IK+L+
Sbjct  869  FGVVLLELVSGREPIEEDYGEAKDIVYWVLTHLNDRESILNILDERVASECVEDMIKMLK  928

Query  390  IAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            I I CT  LP+ RPTMR VV+ML DAEPC L S
Sbjct  929  IGIKCTTKLPSVRPTMREVVKMLIDAEPCALKS  961



>emb|CDX71602.1| BnaC09g26430D [Brassica napus]
Length=953

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 115/168 (68%), Gaps = 8/168 (5%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APEY Y+ K   K DVYSFGV+
Sbjct  784  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVIAGTYGYLAPEYAYSSKATIKCDVYSFGVM  841

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI 
Sbjct  842  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKTDMINALRVAIR  901

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS-----KDAAKLDNPS  250
            CT+  P  RP+M  VVQ+L DA P + + +        KDA   DNP+
Sbjct  902  CTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTKIKDAILSDNPT  949



>emb|CDY37769.1| BnaA10g05520D [Brassica napus]
Length=1111

 Score =   160 bits (406),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 115/168 (68%), Gaps = 8/168 (5%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
             D  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APEY Y+ K   K DVYSFGV+
Sbjct  942   DVNYQPKVADFGIAKVLQ--ARGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVM  999

Query  558   LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
             LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  K D I  LR+AI 
Sbjct  1000  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLSESSKADMINALRVAIR  1059

Query  378   CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVS-----KDAAKLDNPS  250
             CT+  P  RP+M  VVQ+L DA P + + +        KDA   DNP+
Sbjct  1060  CTSRTPTIRPSMNEVVQLLIDAAPQEGLDMASKSRTKIKDAILSDNPT  1107



>ref|XP_009416959.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416961.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416962.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416963.1| PREDICTED: receptor-like protein kinase HSL1 [Musa acuminata 
subsp. malaccensis]
Length=963

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 107/149 (72%), Gaps = 8/149 (5%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQ-YNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE ++ +IADFG+AKI +  +SSC        GTHGYIAPE  Y+ KV EK+DVYSFG+V
Sbjct  813  DEDYEAKIADFGIAKIAEESDSSC------FAGTHGYIAPELAYSVKVTEKTDVYSFGIV  866

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            L+EL++G  P+E +YGE  DIV WVST L ++++   ++DS +  P +E  +KVL++AIL
Sbjct  867  LLELLTGHGPVEPQYGEGKDIVYWVSTHL-NQQNASEILDSRVSSPAEECMMKVLKVAIL  925

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LPN RPTMR VV ML DA+PC L +
Sbjct  926  CTTKLPNLRPTMREVVNMLIDADPCNLAA  954



>ref|XP_006350342.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=957

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +++DFG+AK+ + +S   + +    GTHGY+APE  YT +V EKSDVYSFGVVL
Sbjct  815  DEEYEAKVSDFGVAKVSEISSRVSEFS-CFAGTHGYLAPEIAYTSRVTEKSDVYSFGVVL  873

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  YGE  D+V W ST L  K S+L+++D   + E  ++D IKVLRI+ L
Sbjct  874  LELVTGRKPIEETYGEGKDLVYWASTHLNDKGSVLNILDQKVVSELIQDDMIKVLRISAL  933

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LPN RP+M+ VV ML DAEP
Sbjct  934  CTTKLPNLRPSMKEVVNMLVDAEP  957



>ref|NP_001048946.2| Os03g0145000 [Oryza sativa Japonica Group]
 gb|AAO17351.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF93945.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ25561.1| hypothetical protein OsJ_09387 [Oryza sativa Japonica Group]
 dbj|BAF10860.2| Os03g0145000 [Oryza sativa Japonica Group]
Length=1030

 Score =   160 bits (405),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 79/170 (46%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D+    +IADFGLA+++   +   +T  V+ G++GYIAPEYGYT KV +KSD+YSFGVVL
Sbjct  858   DDNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAPEYGYTLKVDQKSDIYSFGVVL  914

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ---EPFKEDAIKVLRIA  385
             MEL++G++PIE EYGE+ DIV W+  +L+S   +  ++D+++    +  +E+ + VLR+A
Sbjct  915   MELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEELLDASVGGRVDHVREEMLLVLRVA  974

Query  384   ILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVSKDAAKLDNPSDNTS  238
             +LCTA  P  RPTMR VV ML +A+P  K  S  V+      D P   TS
Sbjct  975   VLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTS  1024



>ref|XP_004963298.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Setaria 
italica]
Length=987

 Score =   160 bits (404),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 82/145 (57%), Positives = 109/145 (75%), Gaps = 8/145 (6%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH-VIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE FKPR+ADFGLAKIL   S+  D++  V+ GT GY+APEY YT KV EKSDVYSFGVV
Sbjct  826  DEAFKPRLADFGLAKILTAASARVDSSAGVVAGTLGYMAPEYAYTWKVTEKSDVYSFGVV  885

Query  558  LMELVSGKK---PIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLR  391
            L+ELV+G+    P+E   G   D+V WVS +L+S+E  +S+VD+ + E + +E+A++VLR
Sbjct  886  LLELVTGRPAMVPVEEGGG---DLVEWVSRRLESREKAMSLVDARVTEGWAREEAVQVLR  942

Query  390  IAILCTAALPNSRPTMRRVVQMLED  316
            +A+LCT+  P  RP+MR VVQMLED
Sbjct  943  VAVLCTSRTPAMRPSMRSVVQMLED  967



>ref|XP_010482245.1| PREDICTED: receptor-like protein kinase HSL1 isoform X2 [Camelina 
sativa]
Length=970

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  800  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  857

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  + D I  LR+AI 
Sbjct  858  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLMETLDKRLAESSRADMINALRVAIR  917

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  918  CTSRTPTIRPTMNEVVQLLIDAAP  941



>ref|XP_010440851.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  800  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  857

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  + D I  LR+AI 
Sbjct  858  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLMETLDKRLAESSRADMINALRVAIR  917

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  918  CTSRTPTIRPTMNEVVQLLIDAAP  941



>ref|XP_009628481.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana tomentosiformis]
Length=987

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +I+DFG+AK+ + +S   + +    GTHGY+APE  YT +V EKSD+YSFGVVL
Sbjct  826  DEDYEAKISDFGVAKVSEISSRGSELS-CFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVL  884

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  +GE  D+V W ST L  KESI+ ++D   + E  +ED IKVLRIA L
Sbjct  885  LELVTGRKPIEDTFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATL  944

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LPN RP M+ VV++L DAEP
Sbjct  945  CTTKLPNLRPNMKEVVKLLVDAEP  968



>ref|XP_010442431.1| PREDICTED: receptor-like protein kinase HSL1 [Camelina sativa]
Length=970

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  800  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  857

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  + D I  LR+AI 
Sbjct  858  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLAESSRADMINALRVAIR  917

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  918  CTSRTPTIRPTMNEVVQLLIDAAP  941



>ref|XP_010482244.1| PREDICTED: receptor-like protein kinase HSL1 isoform X1 [Camelina 
sativa]
Length=970

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  800  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  857

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + E  + D I  LR+AI 
Sbjct  858  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLAESSRADMINALRVAIR  917

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  918  CTSRTPTIRPTMNEVVQLLIDAAP  941



>ref|XP_002465865.1| hypothetical protein SORBIDRAFT_01g047250 [Sorghum bicolor]
 gb|EER92863.1| hypothetical protein SORBIDRAFT_01g047250 [Sorghum bicolor]
Length=1039

 Score =   159 bits (403),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 79/170 (46%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D     +IADFGLA+++   +   +T  V+ G++GYIAPEYGYT KV +KSD+YSFGVVL
Sbjct  867   DTNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAPEYGYTLKVDQKSDIYSFGVVL  923

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ---EPFKEDAIKVLRIA  385
             MEL++G++P+E EYGE+ DIV W+  +L+S   +  ++D+++    +  +E+ + VLRIA
Sbjct  924   MELLTGRRPVEPEYGESQDIVGWIRERLRSNSGVEELLDASVGGCVDHVREEMLLVLRIA  983

Query  384   ILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVSKDAAKLDNPSDNTS  238
             +LCTA  P  RPTMR VV ML +A+P  K  S  V+      D P   TS
Sbjct  984   VLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTS  1033



>gb|EAY88517.1| hypothetical protein OsI_09989 [Oryza sativa Indica Group]
Length=1030

 Score =   159 bits (402),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 79/170 (46%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D     +IADFGLA+++   +   +T  V+ G++GYIAPEYGYT KV +KSD+YSFGVVL
Sbjct  858   DANMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAPEYGYTLKVDQKSDIYSFGVVL  914

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ---EPFKEDAIKVLRIA  385
             MEL++G++PIE EYGE+ DIV W+  +L+S   +  ++D+++    +  +E+ + VLR+A
Sbjct  915   MELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEELLDASVGGRVDHVREEMLLVLRVA  974

Query  384   ILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVSKDAAKLDNPSDNTS  238
             +LCTA  P  RPTMR VV ML +A+P  K  S  V+      D P   TS
Sbjct  975   VLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTS  1024



>ref|XP_009780300.1| PREDICTED: receptor-like protein kinase HAIKU2 [Nicotiana sylvestris]
Length=1001

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +++DFG+AK+ + +S   + +    GTHGY+APE  YT +V EKSD+YSFGVVL
Sbjct  840  DEDYEAKVSDFGVAKVSEISSRGSELS-CFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVL  898

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  +GE  D+V W ST L  KESI+ ++D   + E  +ED IKVLRIA L
Sbjct  899  LELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATL  958

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LPN RP M+ VV++L DAEP
Sbjct  959  CTTKLPNLRPNMKEVVKLLVDAEP  982



>ref|XP_010556500.1| PREDICTED: receptor-like protein kinase HSL1 [Tarenaya hassleriana]
Length=956

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 111/157 (71%), Gaps = 3/157 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT VI GT+GY+APE+ Y+ K   K DVYSFGVV
Sbjct  789  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVIAGTYGYLAPEFAYSSKATVKCDVYSFGVV  846

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + +  KE  I  LR+AI 
Sbjct  847  LMELITGKKPVDSAFGENKNIVNWVSTKIDTKEGLMETLDKRLSDLSKEFMINALRVAIR  906

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA  268
            CT+  P  RPTM  VVQ+L DA P +      ++DA+
Sbjct  907  CTSRSPTIRPTMNEVVQLLIDAAPHRFEPSNKARDAS  943



>ref|NP_001241340.1| receptor-like protein kinase HSL1-like [Glycine max]
 gb|ACM89538.1| leucine-rich repeat transmembrane protein kinase [Glycine max]
 gb|KHN32461.1| Receptor-like protein kinase HSL1 [Glycine soja]
Length=955

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 102/153 (67%), Gaps = 11/153 (7%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYS  571
            DE ++ +IADFG+A+       Q   SC      + GT GYIAPE  Y   + EKSDVYS
Sbjct  800  DEDYESKIADFGIARFAEKSDKQLGYSC------LAGTLGYIAPELAYATDITEKSDVYS  853

Query  570  FGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLR  391
            FGVVL+ELVSG++PIE EYGE  DIV WV + L  +ESIL+++D  +     ED IKVL+
Sbjct  854  FGVVLLELVSGREPIEEEYGEAKDIVYWVLSNLNDRESILNILDERVTSESVEDMIKVLK  913

Query  390  IAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            IAI CT  LP+ RPTMR VV+ML DAEPC   S
Sbjct  914  IAIKCTTKLPSLRPTMREVVKMLIDAEPCAFKS  946



>ref|XP_006279956.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12854.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=945

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  773  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  830

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + +  K D I  LR+AI 
Sbjct  831  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLADSSKGDMINALRVAIR  890

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  891  CTSRTPTIRPTMNEVVQLLIDAAP  914



>ref|XP_006591868.1| PREDICTED: receptor-like protein kinase HSL1-like isoform X1 
[Glycine max]
Length=970

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 102/153 (67%), Gaps = 11/153 (7%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKIL-----QYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYS  571
            DE ++ +IADFG+A+       Q   SC      + GT GYIAPE  Y   + EKSDVYS
Sbjct  815  DEDYESKIADFGIARFAEKSDKQLGYSC------LAGTLGYIAPELAYATDITEKSDVYS  868

Query  570  FGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLR  391
            FGVVL+ELVSG++PIE EYGE  DIV WV + L  +ESIL+++D  +     ED IKVL+
Sbjct  869  FGVVLLELVSGREPIEEEYGEAKDIVYWVLSNLNDRESILNILDERVTSESVEDMIKVLK  928

Query  390  IAILCTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            IAI CT  LP+ RPTMR VV+ML DAEPC   S
Sbjct  929  IAIKCTTKLPSLRPTMREVVKMLIDAEPCAFKS  961



>ref|XP_006279955.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
 gb|EOA12853.1| hypothetical protein CARUB_v10025822mg [Capsella rubella]
Length=968

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 105/144 (73%), Gaps = 3/144 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            D  ++P++ADFG+AK+LQ  +  KD TT V+ GT+GY+APEY Y+ K   K DVYSFGVV
Sbjct  796  DVNYQPKVADFGIAKVLQ--ARGKDSTTTVMAGTYGYLAPEYAYSSKATIKCDVYSFGVV  853

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAIL  379
            LMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++  +D  + +  K D I  LR+AI 
Sbjct  854  LMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIETLDKRLADSSKGDMINALRVAIR  913

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT+  P  RPTM  VVQ+L DA P
Sbjct  914  CTSRTPTIRPTMNEVVQLLIDAAP  937



>ref|XP_011017021.1| PREDICTED: receptor-like protein kinase HSL1 [Populus euphratica]
Length=958

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  ++P++ADFG+AK+LQ       TT VI GT+GY+APEY Y+ K   K DVYSFGVVL
Sbjct  789  DANYRPKVADFGIAKVLQARGGKDSTTTVIAGTYGYLAPEYAYSSKATTKCDVYSFGVVL  848

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILC  376
            MEL++GKKP+EA++GE  +I+  VSTK+ +KE ++ ++D  +   F+++ I+VLRIAI C
Sbjct  849  MELITGKKPVEADFGECKNIIHLVSTKVDTKEGVMEVLDKKLSGSFRDEMIQVLRIAIRC  908

Query  375  TAALPNSRPTMRRVVQMLEDA  313
            T   P  RPTM  VVQ+L +A
Sbjct  909  TYKTPALRPTMNEVVQLLIEA  929



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score =   159 bits (401),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 75/146 (51%), Positives = 106/146 (73%), Gaps = 5/146 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D  F+  +ADFGLAK+ Q ++   ++   I G++GYIAPEY YT KV EKSD+YSFGVVL
Sbjct  820  DSTFQAHVADFGLAKLFQ-DTGKSESMSSIAGSYGYIAPEYAYTLKVNEKSDIYSFGVVL  878

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD---SAIQEPFKEDAIKVLRIA  385
            MEL++GK+PIEAE+G+  DIV WV  K+++K+ ++ ++D     +  P +E  + VLR+A
Sbjct  879  MELLTGKRPIEAEFGDGVDIVQWVRRKIQTKDGVIDVLDPRMGGVGVPLQE-VMLVLRVA  937

Query  384  ILCTAALPNSRPTMRRVVQMLEDAEP  307
            +LC++ LP  RPTMR VVQML D +P
Sbjct  938  LLCSSDLPVDRPTMRDVVQMLSDVKP  963



>ref|XP_006353616.1| PREDICTED: receptor-like protein kinase HAIKU2-like [Solanum 
tuberosum]
Length=977

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE+++ +++DFG+AK+ + +S   + +    GTHGY+APE  YT +V EK+D+YSFGVVL
Sbjct  816  DEYYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYMAPEMAYTLRVTEKNDIYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  YGE  D++ W ST L  KESI  ++D   + E  +++ IKVLRIA L
Sbjct  875  LELVTGRKPIEEAYGEGKDLIYWTSTHLNDKESINKVLDQKVVSELVQDEMIKVLRIATL  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LPN RP+M+ VV ML DAEP    S
Sbjct  935  CTTKLPNLRPSMKEVVNMLVDAEPLTFRS  963



>ref|XP_010322765.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=977

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE+++ +++DFG+AK+ + +S   + +    GTHGY+APE  YT +V EK+D+YSFGVVL
Sbjct  816  DEYYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYMAPEIAYTLRVTEKNDIYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  YGE  D+V W ST L  KESI  ++D   + +  +++ IKVLRIA L
Sbjct  875  LELVTGRKPIEEAYGEGKDLVYWTSTHLNDKESINKVLDQKVVSDLVQDEMIKVLRIATL  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAKLDNPSD  247
            CT  LPN RP+M+ VV ML DAEP    S   SK   K +N S+
Sbjct  935  CTTKLPNLRPSMKEVVNMLVDAEPLTFRS--SSKSEKKGNNFSE  976



>ref|XP_004985730.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2-like 
[Setaria italica]
Length=1040

 Score =   158 bits (400),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 79/170 (46%), Positives = 112/170 (66%), Gaps = 7/170 (4%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D     +IADFGLA+++   +   +T  V+ G++GYIAPEYGYT KV +KSD+YSFGVVL
Sbjct  868   DTNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAPEYGYTLKVDQKSDIYSFGVVL  924

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQ---EPFKEDAIKVLRIA  385
             MEL++G++PIE EYG++ DIV W+  +L+S   +  ++D+ +    +  +E+ + VLRIA
Sbjct  925   MELLTGRRPIEPEYGDSTDIVGWIRERLRSNSGVEDLLDAGVGGRVDHVREEMLLVLRIA  984

Query  384   ILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVSKDAAKLDNPSDNTS  238
             +LCTA  P  RPTMR VV ML +A+P  K  S  V+      D P   TS
Sbjct  985   VLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTS  1034



>ref|XP_004250411.1| PREDICTED: receptor-like protein kinase HAIKU2 [Solanum lycopersicum]
Length=961

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            DE ++ +++DFG+AK+ + +S   + +    GTHGY+APE  YT +V EKSDVYSFGVVL
Sbjct  819  DEEYEAKVSDFGVAKVSEISSRGSEFS-CFAGTHGYLAPELAYTSRVTEKSDVYSFGVVL  877

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDS-AIQEPFKEDAIKVLRIAIL  379
            +ELV+G+KPIE  YGE  D+V W ST L  K S+L+++D   + E  ++D IKVLRI+ L
Sbjct  878  LELVTGRKPIEEAYGEGKDLVYWASTHLNDKGSVLNILDQKVVSELVQDDMIKVLRISAL  937

Query  378  CTAALPNSRPTMRRVVQMLEDAEP  307
            CT  LPN RP+M+ VV+ML D EP
Sbjct  938  CTTKLPNLRPSMKEVVKMLVDVEP  961



>ref|XP_009379270.1| PREDICTED: receptor-like protein kinase HAIKU2 [Pyrus x bretschneideri]
Length=990

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
            D+ ++ ++ADFG+AKI + +    D +    GTHGYIAPE  YT KV EK DVYSFGVVL
Sbjct  816  DDDYEAKVADFGVAKIAESSQKGCDYSS-FAGTHGYIAPELAYTAKVNEKCDVYSFGVVL  874

Query  555  MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAI-QEPFKEDAIKVLRIAIL  379
            +ELV+G++P+E +YGE  DIV WVS  L  +E+++ ++D  +  E  ++D IKVL++A+L
Sbjct  875  LELVTGRRPVEEDYGEGKDIVYWVSKHLSDREAVVKILDDKVAHECVEDDMIKVLKVAVL  934

Query  378  CTAALPNSRPTMRRVVQMLEDAEPCKLVS  292
            CT  LP+ RPTMR V++ML  A+PC   S
Sbjct  935  CTTKLPSLRPTMRDVIKMLTAADPCTFRS  963



>ref|XP_006837283.1| hypothetical protein AMTR_s00111p00013770 [Amborella trichopoda]
 gb|ERN00137.1| hypothetical protein AMTR_s00111p00013770 [Amborella trichopoda]
Length=1027

 Score =   158 bits (399),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 72/146 (49%), Positives = 107/146 (73%), Gaps = 7/146 (5%)
 Frame = -3

Query  735   DEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVL  556
             D   + R+ADFG+AK++Q + S       I G++GYIAPEY YT +V EKSD+YSFGVVL
Sbjct  861   DAEMEARVADFGVAKLIQGDES----MSAIAGSYGYIAPEYAYTLQVDEKSDIYSFGVVL  916

Query  555   MELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE---PFKEDAIKVLRIA  385
             ME++SG++ +E+E+G+ N IV WV +K+K+KE +  ++D  +     P +E+ + VLR+A
Sbjct  917   MEILSGRRSVESEFGDGNSIVDWVRSKIKTKEGVSEVLDKNVGASCGPVREEMMLVLRVA  976

Query  384   ILCTAALPNSRPTMRRVVQMLEDAEP  307
             +LCTA  PN+RP+MR VV ML++A+P
Sbjct  977   LLCTARCPNNRPSMRDVVSMLQEAKP  1002



>tpg|DAA54762.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=548

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 7/142 (5%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYNSSCKDTTH--VIPGTHGYIAPEYGYTQKVKEKSDVYSFGV  562
            DE FKPR+ADFGLAKIL         +   V+ GT GY+APEY YT KV EKSDVYSFGV
Sbjct  392  DESFKPRLADFGLAKILSSAGGGGGHSSAGVVAGTLGYMAPEYAYTCKVTEKSDVYSFGV  451

Query  561  VLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPF-KEDAIKVLRIA  385
            VL+ELV+G+  +     E+ D+V WVS +L+S+E ++S+VD  I E + +E+A++VLR+A
Sbjct  452  VLLELVTGRPAVV----ESRDLVDWVSRRLESREKVMSLVDPGIVEGWAREEAVRVLRVA  507

Query  384  ILCTAALPNSRPTMRRVVQMLE  319
            +LCT+  P+ RP+MR VVQMLE
Sbjct  508  VLCTSRTPSMRPSMRSVVQMLE  529



>ref|XP_002325963.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 ref|XP_006371455.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 ref|XP_006371456.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 gb|EEF00345.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP49252.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
 gb|ERP49253.1| hypothetical protein POPTR_0019s10720g [Populus trichocarpa]
Length=977

 Score =   157 bits (397),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE  +P+IADFG+AK+ + +   C +++    GTHGYIAPE  Y+ KV EKSDVYSFGVV
Sbjct  817  DEDNEPKIADFGVAKLAEMSLKGCDNSSFT--GTHGYIAPEMAYSLKVTEKSDVYSFGVV  874

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE-PFKEDAIKVLRIAI  382
            L+ELV+GK+PIE  YGE  DI  WV + L  +E++L ++D  +     +E+ IKVL+I +
Sbjct  875  LLELVTGKRPIEEAYGEGKDIAYWVLSHLNDRENLLKVLDEEVASGSAQEEMIKVLKIGV  934

Query  381  LCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            LCT  LPN RPTMR VV+ML DA+ C   S   S D
Sbjct  935  LCTTKLPNLRPTMREVVKMLVDADSCAYRSPDYSSD  970



>ref|XP_011031514.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
 ref|XP_011031515.1| PREDICTED: receptor-like protein kinase HAIKU2 [Populus euphratica]
Length=977

 Score =   157 bits (397),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = -3

Query  735  DEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVV  559
            DE  +P+IADFG+AK+ + +   C +++    GTHGYIAPE  Y+ KV EKSDVYSFGVV
Sbjct  817  DEDNEPKIADFGVAKLAEMSLKGCDNSSFT--GTHGYIAPEMAYSLKVTEKSDVYSFGVV  874

Query  558  LMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQE-PFKEDAIKVLRIAI  382
            L+ELV+GK+PI+  YGE  DI  WV + L  +E+IL ++D  +     +E+ IKVL+I +
Sbjct  875  LLELVTGKRPIDEAYGEGKDIAYWVLSNLNDRENILKVLDEEVASGSAQEEMIKVLKIGV  934

Query  381  LCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD  274
            LCT  LPN RPTMR VV+ML DA+ C   S   S D
Sbjct  935  LCTTKLPNLRPTMREVVKMLVDADSCAYRSPDYSSD  970



>ref|XP_003562099.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL2 
[Brachypodium distachyon]
Length=1046

 Score =   157 bits (397),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 80/165 (48%), Positives = 112/165 (68%), Gaps = 8/165 (5%)
 Frame = -3

Query  717   RIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPEYGYTQKVKEKSDVYSFGVVLMELVSG  538
             +IADFGLA+++   +   +T  V+ G++GYIAPEYGYT KV +KSD+YSFGVVLMEL++G
Sbjct  879   KIADFGLARVM---ARPNETVSVVAGSYGYIAPEYGYTLKVDQKSDIYSFGVVLMELLTG  935

Query  537   KKPIEAEYGENN-DIVSWVSTKLKSKESILSMVDSAIQ---EPFKEDAIKVLRIAILCTA  370
             ++PIEAEYGE   DIV W+  +L+S   +  ++D+ +    +  +E+ + VLR+A+LCTA
Sbjct  936   RRPIEAEYGETGVDIVGWIRERLRSNTGVEELLDAGVGGRVDHVREEMLLVLRVAVLCTA  995

Query  369   ALPNSRPTMRRVVQMLEDAEP-CKLVSIIVSKDAAKLDNPSDNTS  238
              LP  RPTMR VV ML +A+P  K  S  V+      D P   TS
Sbjct  996   RLPKDRPTMRDVVTMLGEAKPRRKSSSATVAATVVDKDKPVFTTS  1040



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500